F394718

General Info

Members Datasets Scaffolds Average Seq Length
299 215 598 116

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_101766144|Ga0070707_1017661441
Length 124
Sequence MDRDDELWAAIGDPSRRRVLDALVAHGEATPTMLARELPLTRQAITKHLVVLDRAGLLEGRRRGREMRYVVSAERLAAAAGVMARAAARWDARLAAIMRIAESVHRQRNARAEETSSNSARADS

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
109 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
110 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
113 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
114 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
115 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
116 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
117 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
210 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
211 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
212 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
213 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
214 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
215 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.99
Metatranscriptomes 0.67
Isolates 2.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.34
Nodule 1
Rhizoplane 11.71
Rhizosphere 82.94
Stem 0
Stem Tuber 0
Unclassified 3.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_101766144 3300005468 Bacteria 586
2 JGI24737J22298_10020373 3300001990 Bacteria 2117
3 rootH2_10044220 3300003320 Bacteria 1038
4 Ga0070676_10208889 3300005328 Bacteria 1284
5 Ga0068869_101508043 3300005334 Bacteria 597
6 Ga0070666_10555090 3300005335 Bacteria 835
7 Ga0070669_100302035 3300005353 Bacteria 1288
8 Ga0070675_100252621 3300005354 Bacteria 1544
9 Ga0070671_100277738 3300005355 Bacteria 1424
10 Ga0070671_101023100 3300005355 Bacteria 724
11 Ga0070674_100086518 3300005356 Bacteria 2252
12 Ga0070674_100800472 3300005356 Bacteria 814
13 Ga0070673_101314934 3300005364 Bacteria 679
14 Ga0070659_100518175 3300005366 Bacteria 1018
15 Ga0070667_100432739 3300005367 Bacteria 1201
16 Ga0070667_100668602 3300005367 Bacteria 960
17 Ga0070713_101446518 3300005436 Unclassified 667
18 Ga0070708_101428924 3300005445 Bacteria 645
19 Ga0070678_101124579 3300005456 Bacteria 726
20 Ga0070678_102159068 3300005456 Bacteria 528
21 Ga0068867_101516301 3300005459 Bacteria 624
22 Ga0070685_10477338 3300005466 Bacteria 878
23 Ga0070685_10583366 3300005466 Bacteria 802
24 Ga0070707_100361993 3300005468 Bacteria 1409
25 Ga0070698_100016130 3300005471 Bacteria 7888
26 Ga0070698_101480134 3300005471 Bacteria 630
27 Ga0070679_100490058 3300005530 Bacteria 1173
28 Ga0070684_100443204 3300005535 Bacteria 1200
29 Ga0068853_101558339 3300005539 Bacteria 640
30 Ga0070672_101111632 3300005543 Bacteria 702
31 Ga0070672_101119786 3300005543 Bacteria 700
32 Ga0070686_100366575 3300005544 Bacteria 1087
33 Ga0068855_100525501 3300005563 Bacteria 1283
34 Ga0068855_101594168 3300005563 Bacteria 668
35 Ga0068857_100964656 3300005577 Bacteria 820
36 Ga0070702_100022520 3300005615 Bacteria 3333
37 Ga0070702_100258266 3300005615 Bacteria 1185
38 Ga0068852_100645994 3300005616 Bacteria 1065
39 Ga0068859_101881330 3300005617 Bacteria 661
40 Ga0068866_10021649 3300005718 Bacteria 2965
41 Ga0068861_100154749 3300005719 Bacteria 1884
42 Ga0068861_100592865 3300005719 Bacteria 1016
43 Ga0068858_100982553 3300005842 Bacteria 827
44 Ga0081455_10034300 3300005937 Bacteria 4549
45 Ga0081455_10244395 3300005937 Bacteria 1317
46 Ga0081539_10145740 3300005985 Bacteria 1145
47 Ga0097621_100781155 3300006237 Bacteria 884
48 Ga0075370_10299638 3300006353 Bacteria 956
49 Ga0068871_100926916 3300006358 Unclassified 808
50 Ga0075428_100272684 3300006844 Bacteria 1820
51 Ga0075430_100004849 3300006846 Bacteria 11317
52 Ga0075430_100315140 3300006846 Bacteria 1293
53 Ga0075434_102497254 3300006871 Bacteria 518
54 Ga0075429_100323543 3300006880 Bacteria 1349
55 Ga0068865_100372269 3300006881 Bacteria 1163
56 Ga0068865_101211099 3300006881 Bacteria 669
57 Ga0075436_100323028 3300006914 Bacteria 1109
58 Ga0097620_101881532 3300006931 Bacteria 661
59 Ga0105240_10472990 3300009093 Bacteria 1398
60 Ga0111539_10072216 3300009094 Bacteria 4070
61 Ga0114129_10537877 3300009147 Bacteria 1521
62 Ga0114129_11027911 3300009147 Bacteria 1036
63 Ga0114129_11527385 3300009147 Bacteria 820
64 Ga0105243_10010224 3300009148 Bacteria 7131
65 Ga0105243_10020747 3300009148 Bacteria 4985
66 Ga0105242_10003832 3300009176 Bacteria 11694
67 Ga0105248_10127398 3300009177 Bacteria 2872
68 Ga0105248_10446037 3300009177 Bacteria 1458
69 Ga0105238_10299094 3300009551 Unclassified 1593
70 Ga0105238_11342246 3300009551 Bacteria 742
71 Ga0105238_12178857 3300009551 Bacteria 589
72 Ga0105249_10989046 3300009553 Bacteria 910
73 Ga0105249_11004867 3300009553 Bacteria 903
74 Ga0105246_10201215 3300011119 Bacteria 1548
75 Ga0105246_10371104 3300011119 Bacteria 1179
76 Ga0157369_10845992 3300013105 Bacteria 939
77 Ga0157369_12319696 3300013105 Bacteria 544
78 Ga0157374_10745421 3300013296 Bacteria 994
79 Ga0157378_10020538 3300013297 Bacteria 5807
80 Ga0163162_11149384 3300013306 Bacteria 880
81 Ga0163162_11604472 3300013306 Bacteria 742
82 Ga0157372_11992767 3300013307 Bacteria 667
83 Ga0157375_10022621 3300013308 Bacteria 5787
84 Ga0163163_11432821 3300014325 Bacteria 752
85 Ga0163163_11596628 3300014325 Bacteria 713
86 Ga0163163_12951832 3300014325 Bacteria 531
87 Ga0157380_10250130 3300014326 Bacteria 1604
88 Ga0157380_10397974 3300014326 Bacteria 1306
89 Ga0157380_10419049 3300014326 Bacteria 1276
90 Ga0157380_10757227 3300014326 Bacteria 983
91 Ga0157380_11626800 3300014326 Bacteria 702
92 Ga0157380_11660102 3300014326 Bacteria 696
93 Ga0157380_13429965 3300014326 Bacteria 507
94 Ga0182008_10500062 3300014497 Bacteria 668
95 Ga0157379_10131034 3300014968 Bacteria 2257
96 Ga0157376_10707793 3300014969 Bacteria 1013
97 Ga0163161_10060225 3300017792 Bacteria 2763
98 Ga0163161_11627015 3300017792 Bacteria 570
99 Ga0206354_11501099 3300020081 Bacteria 598
100 Ga0206353_10323317 3300020082 Bacteria 1141
101 Ga0207697_10109231 3300025315 Bacteria 1184
102 Ga0207642_10013685 3300025899 Bacteria 2968
103 Ga0207688_10708878 3300025901 Bacteria 636
104 Ga0207647_10340885 3300025904 Bacteria 849
105 Ga0207695_10743888 3300025913 Unclassified 861
106 Ga0207662_10154902 3300025918 Bacteria 1460
107 Ga0207652_10298972 3300025921 Bacteria 1453
108 Ga0207652_10617339 3300025921 Bacteria 971
109 Ga0207646_10285756 3300025922 Bacteria 1491
110 Ga0207686_10276631 3300025934 Bacteria 1237
111 Ga0207709_10169711 3300025935 Bacteria 1530
112 Ga0207670_10384464 3300025936 Bacteria 1119
113 Ga0207669_10126476 3300025937 Bacteria 1747
114 Ga0207691_10379334 3300025940 Bacteria 1207
115 Ga0207691_11121156 3300025940 Bacteria 654
116 Ga0207711_10645193 3300025941 Bacteria 988
117 Ga0207661_10115287 3300025944 Bacteria 2279
118 Ga0207661_10165069 3300025944 Bacteria 1924
119 Ga0207667_11492029 3300025949 Bacteria 647
120 Ga0207651_10443432 3300025960 Bacteria 1113
121 Ga0207712_10628046 3300025961 Bacteria 932
122 Ga0207639_11900823 3300026041 Bacteria 556
123 Ga0207708_10928568 3300026075 Bacteria 754
124 Ga0207648_10012326 3300026089 Bacteria 8004
125 Ga0207674_10713687 3300026116 Unclassified 968
126 Ga0207675_100374343 3300026118 Bacteria 1399
127 Ga0207675_100385815 3300026118 Bacteria 1378
128 Ga0207683_10416960 3300026121 Bacteria 1236
129 Ga0207683_10613316 3300026121 Bacteria 1007
130 Ga0307517_10152404 3300028786 Bacteria 1581
131 Ga0307408_100033361 3300031548 Bacteria 3597
132 Ga0307408_101893332 3300031548 Bacteria 572
133 Ga0307405_10394503 3300031731 Bacteria 1081
134 Ga0307413_10047704 3300031824 Bacteria 2556
135 Ga0307413_10536325 3300031824 Bacteria 946
136 Ga0307410_10042724 3300031852 Bacteria 2998
137 Ga0326468_10000005 3300031889 Bacteria 15246
138 Ga0307406_10058748 3300031901 Bacteria 2473
139 Ga0307406_10095655 3300031901 Bacteria 2010
140 Ga0307407_10069113 3300031903 Bacteria 2095
141 Ga0307412_10336660 3300031911 Bacteria 1206
142 Ga0307409_100156484 3300031995 Bacteria 1986
143 Ga0307416_100146949 3300032002 Bacteria 2154
144 Ga0307414_11495204 3300032004 Bacteria 628
145 Ga0307414_11751597 3300032004 Bacteria 579
146 Ga0307415_100007143 3300032126 Bacteria 6085
147 Ga0307415_102173268 3300032126 Bacteria 543
148 Ga0373925_0002448 3300037068 Bacteria 14870
149 Ga0395898_0733427 3300037466 Bacteria 930
150 Ga0395901_0164876 3300038443 Bacteria 2327
151 Ga0439436_0223821 3300041404 Bacteria 542
152 Ga0439466_0040307 3300041411 Bacteria 1562
153 Ga0451793_1908416 3300041452 Bacteria 763
154 Ga0451807_0539318 3300041486 Bacteria 1502
155 Ga0451807_2319512 3300041486 Bacteria 669
156 Ga0451841_0690728 3300041498 Bacteria 600
157 Ga0439442_100239 3300042002 Bacteria 627
158 Ga0439454_085562 3300042011 Bacteria 577
159 Ga0439455_0102235 3300042012 Bacteria 793
160 Ga0439463_189759 3300042016 Bacteria 533
161 Ga0439459_0083912 3300042438 Bacteria 756
162 Ga0466966_0028097 3300044684 Bacteria 3665
163 Ga0466961_0088091 3300044693 Bacteria 1961
164 Ga0466961_0325090 3300044693 Bacteria 938
165 Ga0466963_0499671 3300044694 Bacteria 859
166 Ga0466964_0149412 3300044706 Bacteria 1082
167 Ga0466968_0238601 3300044735 Bacteria 860
168 Ga0466970_0111727 3300044765 Bacteria 1492
169 Ga0466957_0024635 3300044842 Bacteria 3562
170 Ga0466960_0000037 3300044901 Bacteria 43394
171 Ga0466960_0292527 3300044901 Bacteria 916
172 Ga0466960_0624931 3300044901 Bacteria 641
173 Ga0466960_0756965 3300044901 Bacteria 586
174 Ga0466959_0097786 3300045049 Bacteria 2103
175 Ga0466958_0208206 3300045836 Bacteria 1245
176 Ga0466967_0022661 3300045976 Bacteria 5131
177 Ga0466967_0086998 3300045976 Bacteria 2832
178 Ga0466967_0174609 3300045976 Bacteria 2024
179 Ga0466967_1854046 3300045976 Bacteria 600
180 Ga0466967_2362738 3300045976 Bacteria 527
181 Ga0495592_0095470 3300046454 Bacteria 2126
182 Ga0495603_0800317 3300046455 Bacteria 538
183 Ga0495641_0531383 3300046461 Bacteria 537
184 Ga0495653_0046428 3300046463 Bacteria 3363
185 Ga0495580_0061237 3300046472 Bacteria 2643
186 Ga0495582_0146479 3300046473 Bacteria 1340
187 Ga0495662_0058266 3300046476 Bacteria 1865
188 Ga0495664_0025707 3300046477 Bacteria 3427
189 Ga0495608_0008514 3300046511 Bacteria 7186
190 Ga0495628_0222416 3300046516 Bacteria 1417
191 Ga0495630_0534994 3300046517 Bacteria 898
192 Ga0495666_0002032 3300046526 Bacteria 10009
193 Ga0495665_0014615 3300046531 Bacteria 4232
194 Ga0495640_0007945 3300046533 Bacteria 8342
195 Ga0495587_0067664 3300046536 Bacteria 2081
196 Ga0495645_0048106 3300046543 Bacteria 3106
197 Ga0495667_0033400 3300046559 Bacteria 3443
198 Ga0495634_0041799 3300046642 Bacteria 3112
199 Ga0495635_0027796 3300046663 Bacteria 3933
200 Ga0495588_0033267 3300046674 Bacteria 2603
201 Ga0495657_0024267 3300046675 Bacteria 4321
202 Ga0495599_0033534 3300046678 Bacteria 3226
203 Ga0495623_0069349 3300046679 Bacteria 2197
204 Ga0495613_0095386 3300046689 Bacteria 2151
205 Ga0495600_0054708 3300046809 Bacteria 2606
206 Ga0495581_0120291 3300047315 Bacteria 1528
207 Ga0495604_0044122 3300047317 Bacteria 3487
208 Ga0495675_0027095 3300047444 Bacteria 3652
209 Ga0495685_125510 3300047447 Bacteria 841
210 Ga0495684_0032544 3300047471 Bacteria 4003
211 Ga0495593_0065545 3300047673 Bacteria 1894
212 Ga0495602_0015454 3300048088 Bacteria 7701
213 Ga0496100_0076953 3300048903 Bacteria 2242
214 Ga0496101_0369808 3300048904 Bacteria 1127
215 Ga0496102_0108380 3300048905 Bacteria 2587
216 Ga0496103_0682360 3300048906 Bacteria 652
217 Ga0496104_0113125 3300048907 Bacteria 2603
218 Ga0496105_0061614 3300048908 Bacteria 3096
219 Ga0496105_0079546 3300048908 Bacteria 2707
220 Ga0496105_0420831 3300048908 Bacteria 1058
221 Ga0496106_0018243 3300048909 Bacteria 5189
222 Ga0496107_0093936 3300048910 Bacteria 2194
223 Ga0496108_0093282 3300048911 Bacteria 2561
224 Ga0496108_0754191 3300048911 Bacteria 842
225 Ga0496108_1526990 3300048911 Bacteria 555
226 Ga0496109_0319664 3300048912 Bacteria 1465
227 Ga0496109_1377924 3300048912 Bacteria 641
228 Ga0496110_0042394 3300048913 Bacteria 3972
229 Ga0496110_0409522 3300048913 Bacteria 1236
230 Ga0496110_0886697 3300048913 Bacteria 798
231 Ga0496111_0092784 3300048914 Bacteria 2213
232 Ga0496111_0126210 3300048914 Bacteria 1892
233 Ga0496111_0910518 3300048914 Bacteria 633
234 Ga0496113_0590295 3300048916 Bacteria 890
235 Ga0496114_0029730 3300048917 Bacteria 4492
236 Ga0496114_0050906 3300048917 Bacteria 3448
237 Ga0496114_0071180 3300048917 Bacteria 2922
238 Ga0496114_0275009 3300048917 Bacteria 1484
239 Ga0496114_0375966 3300048917 Bacteria 1258
240 Ga0496114_0416528 3300048917 Bacteria 1190
241 Ga0496114_0466789 3300048917 Bacteria 1117
242 Ga0496114_0980105 3300048917 Bacteria 728
243 Ga0496115_0052555 3300048918 Bacteria 3269
244 Ga0496115_0186916 3300048918 Bacteria 1712
245 Ga0496119_0566984 3300048922 Bacteria 520
246 Ga0501033_0915252 3300049570 Bacteria 589
247 Ga0501034_0005460 3300049571 Bacteria 13884
248 Ga0501034_0080155 3300049571 Bacteria 3268
249 Ga0501036_1141095 3300049572 Unclassified 636
250 Ga0501036_1292324 3300049572 Bacteria 593
251 Ga0501038_0337733 3300049574 Bacteria 1175
252 Ga0501039_0274707 3300049575 Bacteria 1325
253 Ga0501039_0413157 3300049575 Bacteria 1060
254 Ga0501068_0143620 3300049584 Bacteria 1497
255 Ga0501069_0023754 3300049585 Bacteria 3342
256 Ga0501069_0183726 3300049585 Bacteria 1209
257 Ga0501070_0378711 3300049586 Bacteria 1146
258 Ga0501070_1048884 3300049586 Bacteria 630
259 Ga0501071_0689520 3300049587 Unclassified 786
260 Ga0501071_0747344 3300049587 Bacteria 753
261 Ga0501074_0058846 3300049590 Bacteria 2769
262 Ga0501075_0355757 3300049591 Bacteria 1116
263 Ga0501075_0812077 3300049591 Unclassified 712
264 Ga0501079_0290126 3300049741 Bacteria 1279
265 Ga0501079_0423847 3300049741 Bacteria 1045
266 Ga0501080_0013135 3300049742 Bacteria 7607
267 Ga0501081_0690177 3300049743 Bacteria 766
268 Ga0501044_0469760 3300049823 Bacteria 1162
269 nmdc:mga03n38_782398_c1 3300050490 Bacteria 554
270 nmdc:mga00v17_502537_c1 3300050491 Bacteria 786
271 nmdc:mga0yw44_810967_c1 3300050492 Bacteria 635
272 nmdc:mga07m45_247474_c1 3300050496 Bacteria 1037
273 nmdc:mga05p37_284719_c1 3300050507 Bacteria 1970
274 nmdc:mga05p37_579979_c1 3300050507 Unclassified 1270
275 nmdc:mga09592_911098_c1 3300050508 Bacteria 739
276 nmdc:mga0qj67_1034412_c1 3300050509 Bacteria 643
277 nmdc:mga0qj67_116442_c1 3300050509 Bacteria 2160
278 nmdc:mga0qj67_16301_c1 3300050509 Bacteria 5632
279 nmdc:mga06r32_1726493_c1 3300050510 Bacteria 563
280 nmdc:mga06r32_453662_c1 3300050510 Bacteria 1262
281 nmdc:mga0n895_943542_c1 3300050512 Bacteria 846
282 nmdc:mga08x19_637144_c1 3300050514 Bacteria 756
283 Ga0495601_0022729 3300053077 Bacteria 3853
284 Ga0495612_0270444 3300053078 Bacteria 758
285 Ga0495655_0020967 3300053083 Bacteria 1473
286 Ga0495655_0257437 3300053083 Bacteria 588
287 Ga0495595_0299562 3300053084 Bacteria 809
288 Ga0495619_0364855 3300053085 Bacteria 998
289 Ga0495619_0578835 3300053085 Bacteria 769
290 Ga0500568_0061283 3300053139 Bacteria 1455
291 Ga0500616_0000157 3300053153 Bacteria 114082
292 Ga0530510_0692242 3300061734 Bacteria 777
293 2515495335 2515154088 Bacteria 5526283
294 2515759387 2515154137 Bacteria 5711575
295 2644000986 2643221598 Bacteria 4578346
296 2891397561 2891395885 Bacteria 9251614
297 8054916426 8054913762 Bacteria 7713009
298 8054917570 8054913762 Bacteria 7713009
299 8055418763 8055412473 Bacteria 6257500
300 Ga0070707_101766144
301 JGI24737J22298_10020373
302 rootH2_10044220
303 Ga0070676_10208889
304 Ga0068869_101508043
305 Ga0070666_10555090
306 Ga0070669_100302035
307 Ga0070675_100252621
308 Ga0070671_100277738
309 Ga0070671_101023100
310 Ga0070674_100086518
311 Ga0070674_100800472
312 Ga0070673_101314934
313 Ga0070659_100518175
314 Ga0070667_100432739
315 Ga0070667_100668602
316 Ga0070713_101446518
317 Ga0070708_101428924
318 Ga0070678_101124579
319 Ga0070678_102159068
320 Ga0068867_101516301
321 Ga0070685_10477338
322 Ga0070685_10583366
323 Ga0070707_100361993
324 Ga0070698_100016130
325 Ga0070698_101480134
326 Ga0070679_100490058
327 Ga0070684_100443204
328 Ga0068853_101558339
329 Ga0070672_101111632
330 Ga0070672_101119786
331 Ga0070686_100366575
332 Ga0068855_100525501
333 Ga0068855_101594168
334 Ga0068857_100964656
335 Ga0070702_100022520
336 Ga0070702_100258266
337 Ga0068852_100645994
338 Ga0068859_101881330
339 Ga0068866_10021649
340 Ga0068861_100154749
341 Ga0068861_100592865
342 Ga0068858_100982553
343 Ga0081455_10034300
344 Ga0081455_10244395
345 Ga0081539_10145740
346 Ga0097621_100781155
347 Ga0075370_10299638
348 Ga0068871_100926916
349 Ga0075428_100272684
350 Ga0075430_100004849
351 Ga0075430_100315140
352 Ga0075434_102497254
353 Ga0075429_100323543
354 Ga0068865_100372269
355 Ga0068865_101211099
356 Ga0075436_100323028
357 Ga0097620_101881532
358 Ga0105240_10472990
359 Ga0111539_10072216
360 Ga0114129_10537877
361 Ga0114129_11027911
362 Ga0114129_11527385
363 Ga0105243_10010224
364 Ga0105243_10020747
365 Ga0105242_10003832
366 Ga0105248_10127398
367 Ga0105248_10446037
368 Ga0105238_10299094
369 Ga0105238_11342246
370 Ga0105238_12178857
371 Ga0105249_10989046
372 Ga0105249_11004867
373 Ga0105246_10201215
374 Ga0105246_10371104
375 Ga0157369_10845992
376 Ga0157369_12319696
377 Ga0157374_10745421
378 Ga0157378_10020538
379 Ga0163162_11149384
380 Ga0163162_11604472
381 Ga0157372_11992767
382 Ga0157375_10022621
383 Ga0163163_11432821
384 Ga0163163_11596628
385 Ga0163163_12951832
386 Ga0157380_10250130
387 Ga0157380_10397974
388 Ga0157380_10419049
389 Ga0157380_10757227
390 Ga0157380_11626800
391 Ga0157380_11660102
392 Ga0157380_13429965
393 Ga0182008_10500062
394 Ga0157379_10131034
395 Ga0157376_10707793
396 Ga0163161_10060225
397 Ga0163161_11627015
398 Ga0206354_11501099
399 Ga0206353_10323317
400 Ga0207697_10109231
401 Ga0207642_10013685
402 Ga0207688_10708878
403 Ga0207647_10340885
404 Ga0207695_10743888
405 Ga0207662_10154902
406 Ga0207652_10298972
407 Ga0207652_10617339
408 Ga0207646_10285756
409 Ga0207686_10276631
410 Ga0207709_10169711
411 Ga0207670_10384464
412 Ga0207669_10126476
413 Ga0207691_10379334
414 Ga0207691_11121156
415 Ga0207711_10645193
416 Ga0207661_10115287
417 Ga0207661_10165069
418 Ga0207667_11492029
419 Ga0207651_10443432
420 Ga0207712_10628046
421 Ga0207639_11900823
422 Ga0207708_10928568
423 Ga0207648_10012326
424 Ga0207674_10713687
425 Ga0207675_100374343
426 Ga0207675_100385815
427 Ga0207683_10416960
428 Ga0207683_10613316
429 Ga0307517_10152404
430 Ga0307408_100033361
431 Ga0307408_101893332
432 Ga0307405_10394503
433 Ga0307413_10047704
434 Ga0307413_10536325
435 Ga0307410_10042724
436 Ga0326468_10000005
437 Ga0307406_10058748
438 Ga0307406_10095655
439 Ga0307407_10069113
440 Ga0307412_10336660
441 Ga0307409_100156484
442 Ga0307416_100146949
443 Ga0307414_11495204
444 Ga0307414_11751597
445 Ga0307415_100007143
446 Ga0307415_102173268
447 Ga0373925_0002448
448 Ga0395898_0733427
449 Ga0395901_0164876
450 Ga0439436_0223821
451 Ga0439466_0040307
452 Ga0451793_1908416
453 Ga0451807_0539318
454 Ga0451807_2319512
455 Ga0451841_0690728
456 Ga0439442_100239
457 Ga0439454_085562
458 Ga0439455_0102235
459 Ga0439463_189759
460 Ga0439459_0083912
461 Ga0466966_0028097
462 Ga0466961_0088091
463 Ga0466961_0325090
464 Ga0466963_0499671
465 Ga0466964_0149412
466 Ga0466968_0238601
467 Ga0466970_0111727
468 Ga0466957_0024635
469 Ga0466960_0000037
470 Ga0466960_0292527
471 Ga0466960_0624931
472 Ga0466960_0756965
473 Ga0466959_0097786
474 Ga0466958_0208206
475 Ga0466967_0022661
476 Ga0466967_0086998
477 Ga0466967_0174609
478 Ga0466967_1854046
479 Ga0466967_2362738
480 Ga0495592_0095470
481 Ga0495603_0800317
482 Ga0495641_0531383
483 Ga0495653_0046428
484 Ga0495580_0061237
485 Ga0495582_0146479
486 Ga0495662_0058266
487 Ga0495664_0025707
488 Ga0495608_0008514
489 Ga0495628_0222416
490 Ga0495630_0534994
491 Ga0495666_0002032
492 Ga0495665_0014615
493 Ga0495640_0007945
494 Ga0495587_0067664
495 Ga0495645_0048106
496 Ga0495667_0033400
497 Ga0495634_0041799
498 Ga0495635_0027796
499 Ga0495588_0033267
500 Ga0495657_0024267
501 Ga0495599_0033534
502 Ga0495623_0069349
503 Ga0495613_0095386
504 Ga0495600_0054708
505 Ga0495581_0120291
506 Ga0495604_0044122
507 Ga0495675_0027095
508 Ga0495685_125510
509 Ga0495684_0032544
510 Ga0495593_0065545
511 Ga0495602_0015454
512 Ga0496100_0076953
513 Ga0496101_0369808
514 Ga0496102_0108380
515 Ga0496103_0682360
516 Ga0496104_0113125
517 Ga0496105_0061614
518 Ga0496105_0079546
519 Ga0496105_0420831
520 Ga0496106_0018243
521 Ga0496107_0093936
522 Ga0496108_0093282
523 Ga0496108_0754191
524 Ga0496108_1526990
525 Ga0496109_0319664
526 Ga0496109_1377924
527 Ga0496110_0042394
528 Ga0496110_0409522
529 Ga0496110_0886697
530 Ga0496111_0092784
531 Ga0496111_0126210
532 Ga0496111_0910518
533 Ga0496113_0590295
534 Ga0496114_0029730
535 Ga0496114_0050906
536 Ga0496114_0071180
537 Ga0496114_0275009
538 Ga0496114_0375966
539 Ga0496114_0416528
540 Ga0496114_0466789
541 Ga0496114_0980105
542 Ga0496115_0052555
543 Ga0496115_0186916
544 Ga0496119_0566984
545 Ga0501033_0915252
546 Ga0501034_0005460
547 Ga0501034_0080155
548 Ga0501036_1141095
549 Ga0501036_1292324
550 Ga0501038_0337733
551 Ga0501039_0274707
552 Ga0501039_0413157
553 Ga0501068_0143620
554 Ga0501069_0023754
555 Ga0501069_0183726
556 Ga0501070_0378711
557 Ga0501070_1048884
558 Ga0501071_0689520
559 Ga0501071_0747344
560 Ga0501074_0058846
561 Ga0501075_0355757
562 Ga0501075_0812077
563 Ga0501079_0290126
564 Ga0501079_0423847
565 Ga0501080_0013135
566 Ga0501081_0690177
567 Ga0501044_0469760
568 nmdc:mga03n38_782398_c1
569 nmdc:mga00v17_502537_c1
570 nmdc:mga0yw44_810967_c1
571 nmdc:mga07m45_247474_c1
572 nmdc:mga05p37_284719_c1
573 nmdc:mga05p37_579979_c1
574 nmdc:mga09592_911098_c1
575 nmdc:mga0qj67_1034412_c1
576 nmdc:mga0qj67_116442_c1
577 nmdc:mga0qj67_16301_c1
578 nmdc:mga06r32_1726493_c1
579 nmdc:mga06r32_453662_c1
580 nmdc:mga0n895_943542_c1
581 nmdc:mga08x19_637144_c1
582 Ga0495601_0022729
583 Ga0495612_0270444
584 Ga0495655_0020967
585 Ga0495655_0257437
586 Ga0495595_0299562
587 Ga0495619_0364855
588 Ga0495619_0578835
589 Ga0500568_0061283
590 Ga0500616_0000157
591 Ga0530510_0692242
592 2515495335
593 2515759387
594 2644000986
595 2891397561
596 8054916426
597 8054917570
598 8055418763

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

11

61

0.97

PF12802

MarR_2

MarR family

13

66

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9727 18 73
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9485 19 73
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9369 18 73
7wqu-assembly1.cif.gz_B feoc from klebsiella pneumoniae 0.9317 18 74
3f6v-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulator for arsenical resistance 0.9286 11 88
ID Description Score Start End Superfamily
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9727 18 73 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9692 15 72 1.10.10.10
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9618 18 73 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9485 19 73 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9369 18 73 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3D2F0D1-F1-model_v4 ArsR family transcriptional regulator 0.9868 3 73 GO:0003700
AF-A0A1N0XCH0-F1-model_v4 deleted 0.9837 7 78
AF-A0A1G2IVA2-F1-model_v4 HTH arsR-type domain-containing protein 0.9807 5 76 GO:0003700
AF-A0A831TG98-F1-model_v4 ArsR family transcriptional regulator 0.9763 4 82 GO:0003677
GO:0003700
AF-A0A7X2DWR4-F1-model_v4 deleted 0.976 8 73

Map