F394272

General Info

Members Datasets Scaffolds Average Seq Length
298 188 596 145

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_11723485|Ga0157374_117234851
Length 169
Sequence MRAKSHDTSSASMSEIAWSRVDRMALKRMDNVGIVVEDLEATIEFFRELGLELEGRAMVEGEWAGRVTGLGDQQVEIAMMRMPDGHGRLELSRFLAPPVVADHRRAPVNALGYLRVMFAVDDIDETLARLSKHGAELVSSEVVQYEDMYRLCYVRGPGGVLIGLGQELG

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
121 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
122 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
123 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
124 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
125 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
126 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
154 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
171 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
172 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 1.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 9.06
Rhizosphere 82.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_11723485 3300013296 Bacteria 651
2 JGI25406J46586_10027185 3300003203 Bacteria 2197
3 Ga0070658_10019201 3300005327 Bacteria 5476
4 Ga0070658_10083727 3300005327 Bacteria 2622
5 Ga0070683_100043320 3300005329 Bacteria 4148
6 Ga0070683_100808785 3300005329 Bacteria 899
7 Ga0070683_100916717 3300005329 Bacteria 841
8 Ga0070682_100041453 3300005337 Bacteria 2838
9 Ga0068868_100164087 3300005338 Bacteria 1836
10 Ga0068868_101085772 3300005338 Bacteria 736
11 Ga0070660_100189983 3300005339 Bacteria 1663
12 Ga0070660_100193327 3300005339 Bacteria 1649
13 Ga0070689_100182140 3300005340 Bacteria 1707
14 Ga0070661_100130823 3300005344 Bacteria 1885
15 Ga0070661_101318378 3300005344 Bacteria 606
16 Ga0070692_10337031 3300005345 Bacteria 933
17 Ga0070688_100767730 3300005365 Bacteria 752
18 Ga0070659_100069916 3300005366 Bacteria 2787
19 Ga0070703_10068435 3300005406 Bacteria 1180
20 Ga0070714_100156345 3300005435 Bacteria 2059
21 Ga0070714_100503400 3300005435 Bacteria 1155
22 Ga0070713_100072565 3300005436 Bacteria 2911
23 Ga0070710_10111942 3300005437 Bacteria 1641
24 Ga0070710_10922185 3300005437 Bacteria 632
25 Ga0070694_100244062 3300005444 Bacteria 1356
26 Ga0070708_100426041 3300005445 Bacteria 1251
27 Ga0070678_101029677 3300005456 Bacteria 758
28 Ga0070681_10027231 3300005458 Bacteria 5748
29 Ga0070681_10078592 3300005458 Bacteria 3256
30 Ga0070681_10079527 3300005458 Bacteria 3235
31 Ga0070681_10540309 3300005458 Bacteria 1079
32 Ga0070706_100029714 3300005467 Bacteria 5035
33 Ga0070707_100243284 3300005468 Bacteria 1751
34 Ga0070707_101115837 3300005468 Bacteria 755
35 Ga0070698_100043774 3300005471 Bacteria 4588
36 Ga0070679_100093832 3300005530 Bacteria 2988
37 Ga0070679_100112540 3300005530 Bacteria 2708
38 Ga0070679_100130972 3300005530 Bacteria 2489
39 Ga0070679_100230986 3300005530 Bacteria 1809
40 Ga0070679_101576235 3300005530 Bacteria 604
41 Ga0070684_100012625 3300005535 Bacteria 6776
42 Ga0070684_100041863 3300005535 Bacteria 3951
43 Ga0070684_100053761 3300005535 Bacteria 3507
44 Ga0068853_100541885 3300005539 Bacteria 1102
45 Ga0070695_100000016 3300005545 Bacteria 66345
46 Ga0070696_100360816 3300005546 Bacteria 1128
47 Ga0070693_100028248 3300005547 Bacteria 3048
48 Ga0068857_100389156 3300005577 Bacteria 1296
49 Ga0068856_100026613 3300005614 Bacteria 5640
50 Ga0068856_100112096 3300005614 Bacteria 2725
51 Ga0070702_100284500 3300005615 Bacteria 1137
52 Ga0068859_101871827 3300005617 Bacteria 663
53 Ga0068864_100226327 3300005618 Bacteria 1728
54 Ga0068851_10260718 3300005834 Bacteria 986
55 Ga0081539_10000100 3300005985 Bacteria 199516
56 Ga0070717_10421645 3300006028 Bacteria 1200
57 Ga0075365_10386340 3300006038 Bacteria 988
58 Ga0075432_10143885 3300006058 Bacteria 912
59 Ga0070715_10135040 3300006163 Bacteria 1192
60 Ga0097621_100128325 3300006237 Bacteria 2156
61 Ga0075428_100007723 3300006844 Bacteria 11917
62 Ga0075430_100438152 3300006846 Bacteria 1079
63 Ga0075433_10763654 3300006852 Bacteria 845
64 Ga0075434_100136996 3300006871 Bacteria 2467
65 Ga0075434_100354332 3300006871 Bacteria 1488
66 Ga0075434_100436476 3300006871 Bacteria 1331
67 Ga0075429_100313278 3300006880 Bacteria 1374
68 Ga0068865_100275780 3300006881 Bacteria 1337
69 Ga0075436_100046310 3300006914 Bacteria 2999
70 Ga0097620_101871662 3300006931 Bacteria 663
71 Ga0099794_10052004 3300007265 Bacteria 1974
72 Ga0105240_10006174 3300009093 Bacteria 17661
73 Ga0111539_11166979 3300009094 Bacteria 895
74 Ga0111539_11221687 3300009094 Bacteria 873
75 Ga0111539_12081983 3300009094 Bacteria 658
76 Ga0105245_10824050 3300009098 Bacteria 967
77 Ga0114129_10005634 3300009147 Bacteria 17717
78 Ga0114129_10885168 3300009147 Bacteria 1133
79 Ga0105243_11254808 3300009148 Bacteria 756
80 Ga0105248_11421757 3300009177 Bacteria 785
81 Ga0105237_10006486 3300009545 Bacteria 12970
82 Ga0105237_10017907 3300009545 Bacteria 7341
83 Ga0105237_10128878 3300009545 Bacteria 2524
84 Ga0105238_10047714 3300009551 Bacteria 4318
85 Ga0099796_10051465 3300010159 Bacteria 1431
86 Ga0105239_10174876 3300010375 Bacteria 2401
87 Ga0105239_13612276 3300010375 Bacteria 503
88 Ga0105246_10084840 3300011119 Bacteria 2267
89 Ga0157373_10185939 3300013100 Bacteria 1463
90 Ga0157371_10334027 3300013102 Bacteria 1101
91 Ga0157371_10668541 3300013102 Bacteria 776
92 Ga0157370_10000463 3300013104 Bacteria 50658
93 Ga0157370_10659559 3300013104 Bacteria 956
94 Ga0157370_10835233 3300013104 Bacteria 837
95 Ga0157369_10048144 3300013105 Bacteria 4626
96 Ga0157369_10529706 3300013105 Bacteria 1218
97 Ga0157374_10190814 3300013296 Bacteria 2004
98 Ga0157372_10046868 3300013307 Bacteria 4800
99 Ga0157372_10508274 3300013307 Bacteria 1405
100 Ga0157372_10937488 3300013307 Bacteria 1004
101 Ga0157372_12990720 3300013307 Bacteria 540
102 Ga0157375_10296862 3300013308 Bacteria 1779
103 Ga0182008_10000043 3300014497 Bacteria 117076
104 Ga0157377_10136608 3300014745 Bacteria 1503
105 Ga0157379_10477294 3300014968 Bacteria 1154
106 Ga0157379_10845663 3300014968 Bacteria 866
107 Ga0157376_10807096 3300014969 Bacteria 951
108 Ga0182006_1000128 3300015261 Bacteria 81425
109 Ga0163161_10000807 3300017792 Bacteria 24542
110 Ga0206353_10450483 3300020082 Bacteria 679
111 Ga0154015_1184884 3300020610 Bacteria 1656
112 Ga0213873_10087343 3300021358 Bacteria 881
113 Ga0213874_10226320 3300021377 Bacteria 681
114 Ga0213876_10021450 3300021384 Bacteria 3415
115 Ga0213876_10089100 3300021384 Bacteria 1634
116 Ga0213875_10167778 3300021388 Bacteria 1030
117 Ga0213875_10295166 3300021388 Bacteria 766
118 Ga0207692_10232781 3300025898 Bacteria 1097
119 Ga0207705_10002197 3300025909 Bacteria 15093
120 Ga0207705_10083528 3300025909 Bacteria 2330
121 Ga0207705_10159279 3300025909 Bacteria 1695
122 Ga0207684_10026489 3300025910 Bacteria 4942
123 Ga0207707_10084867 3300025912 Bacteria 2766
124 Ga0207707_10155019 3300025912 Bacteria 2003
125 Ga0207707_10211409 3300025912 Bacteria 1690
126 Ga0207695_10097568 3300025913 Bacteria 2940
127 Ga0207671_10010500 3300025914 Bacteria 7634
128 Ga0207671_10024857 3300025914 Bacteria 4500
129 Ga0207671_10202689 3300025914 Bacteria 1550
130 Ga0207693_10100407 3300025915 Bacteria 2269
131 Ga0207662_10112814 3300025918 Bacteria 1697
132 Ga0207657_10000616 3300025919 Bacteria 37754
133 Ga0207657_10377770 3300025919 Bacteria 1116
134 Ga0207657_10443373 3300025919 Bacteria 1019
135 Ga0207652_10105505 3300025921 Bacteria 2493
136 Ga0207646_10544402 3300025922 Bacteria 1044
137 Ga0207687_10063447 3300025927 Bacteria 2616
138 Ga0207700_10016544 3300025928 Bacteria 4903
139 Ga0207664_10034329 3300025929 Bacteria 3906
140 Ga0207664_10226435 3300025929 Bacteria 1624
141 Ga0207664_10529236 3300025929 Bacteria 1057
142 Ga0207644_10448753 3300025931 Bacteria 1059
143 Ga0207690_10837721 3300025932 Bacteria 761
144 Ga0207709_10332916 3300025935 Bacteria 1140
145 Ga0207670_10139226 3300025936 Bacteria 1788
146 Ga0207665_10150222 3300025939 Bacteria 1668
147 Ga0207665_11003497 3300025939 Bacteria 664
148 Ga0207661_10025975 3300025944 Bacteria 4457
149 Ga0207667_10224713 3300025949 Bacteria 1923
150 Ga0207667_11055107 3300025949 Bacteria 798
151 Ga0207677_10044959 3300026023 Bacteria 2946
152 Ga0207703_11501273 3300026035 Bacteria 648
153 Ga0207678_11579723 3300026067 Bacteria 578
154 Ga0207702_10082942 3300026078 Bacteria 2788
155 Ga0207702_10110475 3300026078 Bacteria 2443
156 Ga0207674_10090305 3300026116 Bacteria 3055
157 Ga0307408_101422491 3300031548 Bacteria 653
158 Ga0307412_10644821 3300031911 Bacteria 902
159 Ga0307415_100042209 3300032126 Bacteria 3034
160 Ga0307415_101265936 3300032126 Bacteria 697
161 Ga0307415_101952562 3300032126 Bacteria 571
162 Ga0395899_0070464 3300037312 Bacteria 2559
163 Ga0395900_0013258 3300037418 Bacteria 8424
164 Ga0395898_0037444 3300037466 Bacteria 4812
165 Ga0395898_0662281 3300037466 Bacteria 986
166 Ga0395905_0317954 3300037471 Bacteria 1446
167 Ga0395905_0444968 3300037471 Bacteria 1193
168 Ga0436364_0134343 3300037853 Bacteria 1246
169 Ga0436364_0489658 3300037853 Bacteria 580
170 Ga0436364_0713316 3300037853 Bacteria 1067
171 Ga0436364_0717876 3300037853 Bacteria 4714
172 Ga0395901_0022032 3300038443 Bacteria 6530
173 Ga0395901_0480722 3300038443 Bacteria 1267
174 Ga0395901_0773485 3300038443 Bacteria 951
175 Ga0395901_0801192 3300038443 Bacteria 931
176 Ga0395901_1127561 3300038443 Bacteria 753
177 Ga0436365_0139407 3300039437 Bacteria 3625
178 Ga0436365_0726782 3300039437 Bacteria 4328
179 Ga0436365_1520746 3300039437 Bacteria 8755
180 Ga0436360_0696308 3300039438 Bacteria 1036
181 Ga0436360_1221244 3300039438 Bacteria 1008
182 Ga0436361_0355574 3300039447 Bacteria 714
183 Ga0436361_0769145 3300039447 Bacteria 555
184 Ga0436361_1032670 3300039447 Bacteria 881
185 Ga0436363_0265810 3300039450 Bacteria 1187
186 Ga0436363_0314954 3300039450 Bacteria 1764
187 Ga0436363_0857380 3300039450 Bacteria 541
188 Ga0436363_1002757 3300039450 Bacteria 641
189 Ga0436363_1102759 3300039450 Bacteria 774
190 Ga0436363_1150578 3300039450 Bacteria 1131
191 Ga0436363_1473728 3300039450 Bacteria 755
192 Ga0436363_1486061 3300039450 Bacteria 641
193 Ga0436363_1560342 3300039450 Bacteria 862
194 Ga0436362_0828419 3300039453 Bacteria 1105
195 Ga0436362_1187988 3300039453 Bacteria 1669
196 Ga0439465_0353003 3300041413 Bacteria 556
197 Ga0439433_0087282 3300041999 Bacteria 764
198 Ga0439463_096763 3300042016 Bacteria 760
199 Ga0450915_003261 3300042119 Bacteria 903
200 Ga0450903_062855 3300042138 Bacteria 538
201 Ga0439458_0006599 3300042157 Bacteria 2587
202 Ga0439444_0009712 3300042437 Bacteria 1522
203 Ga0466966_0070980 3300044684 Bacteria 2183
204 Ga0466966_0202218 3300044684 Bacteria 1202
205 Ga0466961_0152340 3300044693 Bacteria 1443
206 Ga0466963_0102108 3300044694 Bacteria 1964
207 Ga0466963_0821471 3300044694 Bacteria 655
208 Ga0466963_0823460 3300044694 Bacteria 655
209 Ga0466964_0267658 3300044706 Bacteria 849
210 Ga0466971_0119803 3300044719 Bacteria 1218
211 Ga0466968_0030655 3300044735 Bacteria 2229
212 Ga0466968_0034554 3300044735 Bacteria 2110
213 Ga0466970_0349094 3300044765 Bacteria 839
214 Ga0466960_0006249 3300044901 Bacteria 4770
215 Ga0466959_0017667 3300045049 Bacteria 5230
216 Ga0466959_0051185 3300045049 Bacteria 3031
217 Ga0466959_0104861 3300045049 Bacteria 2022
218 Ga0466959_0138603 3300045049 Bacteria 1721
219 Ga0466959_0547838 3300045049 Bacteria 780
220 Ga0466959_1010835 3300045049 Bacteria 554
221 Ga0466958_0055400 3300045836 Bacteria 2406
222 Ga0466958_0174904 3300045836 Bacteria 1361
223 Ga0466958_0468603 3300045836 Bacteria 816
224 Ga0466958_0731103 3300045836 Bacteria 645
225 Ga0495586_0039890 3300046535 Bacteria 2525
226 Ga0496100_0242496 3300048903 Bacteria 1330
227 Ga0496101_0073965 3300048904 Bacteria 2504
228 Ga0496101_0076835 3300048904 Bacteria 2460
229 Ga0496101_0255267 3300048904 Bacteria 1367
230 Ga0496102_0006933 3300048905 Bacteria 9667
231 Ga0496103_0009710 3300048906 Bacteria 5696
232 Ga0496106_0053428 3300048909 Bacteria 3051
233 Ga0496106_0606044 3300048909 Bacteria 877
234 Ga0496107_0072148 3300048910 Bacteria 2510
235 Ga0496107_0113791 3300048910 Bacteria 1990
236 Ga0496107_0476841 3300048910 Bacteria 926
237 Ga0496108_0051449 3300048911 Bacteria 3451
238 Ga0496108_0125090 3300048911 Bacteria 2207
239 Ga0496109_0017687 3300048912 Bacteria 6253
240 Ga0496109_0173017 3300048912 Bacteria 2026
241 Ga0496109_0195798 3300048912 Bacteria 1899
242 Ga0496109_1952952 3300048912 Bacteria 519
243 Ga0496110_0658445 3300048913 Bacteria 947
244 Ga0496111_0715898 3300048914 Bacteria 727
245 Ga0496112_0126142 3300048915 Bacteria 2530
246 Ga0496112_0151347 3300048915 Bacteria 2287
247 Ga0496113_0181828 3300048916 Bacteria 1667
248 Ga0496113_0427940 3300048916 Bacteria 1063
249 Ga0496113_1018374 3300048916 Bacteria 652
250 Ga0496114_0026023 3300048917 Bacteria 4787
251 Ga0496114_0141680 3300048917 Bacteria 2082
252 Ga0496115_0164253 3300048918 Bacteria 1836
253 Ga0496122_0003743 3300048925 Bacteria 19623
254 Ga0496123_0026380 3300048926 Bacteria 4352
255 Ga0501299_201659 3300049522 Bacteria 529
256 Ga0501032_0093056 3300049569 Bacteria 1999
257 Ga0501034_0151416 3300049571 Bacteria 2295
258 Ga0501036_0290488 3300049572 Bacteria 1368
259 Ga0501038_1004530 3300049574 Bacteria 612
260 Ga0501041_0580150 3300049577 Bacteria 715
261 Ga0501043_0628621 3300049579 Bacteria 790
262 Ga0501047_0083280 3300049581 Bacteria 3074
263 Ga0501067_0009610 3300049583 Bacteria 5355
264 Ga0501069_0389193 3300049585 Bacteria 824
265 Ga0501069_0612425 3300049585 Bacteria 654
266 Ga0501070_0560093 3300049586 Bacteria 914
267 Ga0501071_0675088 3300049587 Bacteria 795
268 Ga0501074_0406924 3300049590 Bacteria 965
269 Ga0501075_0067034 3300049591 Bacteria 2710
270 Ga0501075_0505873 3300049591 Bacteria 922
271 Ga0501076_0573162 3300049592 Bacteria 931
272 Ga0501076_0593841 3300049592 Bacteria 913
273 Ga0501077_1004078 3300049593 Bacteria 537
274 Ga0501223_072804 3300049663 Bacteria 681
275 Ga0501239_066565 3300049672 Bacteria 552
276 Ga0501261_129090 3300049690 Bacteria 508
277 Ga0501080_0071398 3300049742 Bacteria 3229
278 Ga0501081_0094026 3300049743 Bacteria 2111
279 Ga0501035_0796862 3300049822 Bacteria 755
280 nmdc:mga05p37_1184208_c1 3300050507 Bacteria 791
281 nmdc:mga05p37_17929_c1 3300050507 Bacteria 8546
282 nmdc:mga09592_1072418_c1 3300050508 Bacteria 671
283 nmdc:mga08y16_1931777_c1 3300050511 Bacteria 540
284 nmdc:mga0n895_4855_c1 3300050512 Bacteria 11143
285 nmdc:mga0n895_692115_c1 3300050512 Bacteria 1016
286 nmdc:mga0rr50_135940_c1 3300050513 Bacteria 1973
287 nmdc:mga0rr50_588746_c1 3300050513 Bacteria 948
288 nmdc:mga08x19_1020889_c1 3300050514 Bacteria 587
289 nmdc:mga08x19_672537_c1 3300050514 Bacteria 735
290 nmdc:mga0a205_1265080_c1 3300050515 Bacteria 586
291 Ga0501084_1355886 3300054114 Bacteria 596
292 Ga0590071_007689 3300059421 Bacteria 2548
293 Ga0590075_161291 3300059424 Bacteria 591
294 Ga0587071_124690 3300060344 Bacteria 619
295 Ga0466962_0226107 3300061719 Bacteria 917
296 Ga0466962_0371836 3300061719 Bacteria 713
297 Ga0530510_0033888 3300061734 Bacteria 3677
298 Ga0530510_0061053 3300061734 Bacteria 2729
299 Ga0157374_11723485
300 JGI25406J46586_10027185
301 Ga0070658_10019201
302 Ga0070658_10083727
303 Ga0070683_100043320
304 Ga0070683_100808785
305 Ga0070683_100916717
306 Ga0070682_100041453
307 Ga0068868_100164087
308 Ga0068868_101085772
309 Ga0070660_100189983
310 Ga0070660_100193327
311 Ga0070689_100182140
312 Ga0070661_100130823
313 Ga0070661_101318378
314 Ga0070692_10337031
315 Ga0070688_100767730
316 Ga0070659_100069916
317 Ga0070703_10068435
318 Ga0070714_100156345
319 Ga0070714_100503400
320 Ga0070713_100072565
321 Ga0070710_10111942
322 Ga0070710_10922185
323 Ga0070694_100244062
324 Ga0070708_100426041
325 Ga0070678_101029677
326 Ga0070681_10027231
327 Ga0070681_10078592
328 Ga0070681_10079527
329 Ga0070681_10540309
330 Ga0070706_100029714
331 Ga0070707_100243284
332 Ga0070707_101115837
333 Ga0070698_100043774
334 Ga0070679_100093832
335 Ga0070679_100112540
336 Ga0070679_100130972
337 Ga0070679_100230986
338 Ga0070679_101576235
339 Ga0070684_100012625
340 Ga0070684_100041863
341 Ga0070684_100053761
342 Ga0068853_100541885
343 Ga0070695_100000016
344 Ga0070696_100360816
345 Ga0070693_100028248
346 Ga0068857_100389156
347 Ga0068856_100026613
348 Ga0068856_100112096
349 Ga0070702_100284500
350 Ga0068859_101871827
351 Ga0068864_100226327
352 Ga0068851_10260718
353 Ga0081539_10000100
354 Ga0070717_10421645
355 Ga0075365_10386340
356 Ga0075432_10143885
357 Ga0070715_10135040
358 Ga0097621_100128325
359 Ga0075428_100007723
360 Ga0075430_100438152
361 Ga0075433_10763654
362 Ga0075434_100136996
363 Ga0075434_100354332
364 Ga0075434_100436476
365 Ga0075429_100313278
366 Ga0068865_100275780
367 Ga0075436_100046310
368 Ga0097620_101871662
369 Ga0099794_10052004
370 Ga0105240_10006174
371 Ga0111539_11166979
372 Ga0111539_11221687
373 Ga0111539_12081983
374 Ga0105245_10824050
375 Ga0114129_10005634
376 Ga0114129_10885168
377 Ga0105243_11254808
378 Ga0105248_11421757
379 Ga0105237_10006486
380 Ga0105237_10017907
381 Ga0105237_10128878
382 Ga0105238_10047714
383 Ga0099796_10051465
384 Ga0105239_10174876
385 Ga0105239_13612276
386 Ga0105246_10084840
387 Ga0157373_10185939
388 Ga0157371_10334027
389 Ga0157371_10668541
390 Ga0157370_10000463
391 Ga0157370_10659559
392 Ga0157370_10835233
393 Ga0157369_10048144
394 Ga0157369_10529706
395 Ga0157374_10190814
396 Ga0157372_10046868
397 Ga0157372_10508274
398 Ga0157372_10937488
399 Ga0157372_12990720
400 Ga0157375_10296862
401 Ga0182008_10000043
402 Ga0157377_10136608
403 Ga0157379_10477294
404 Ga0157379_10845663
405 Ga0157376_10807096
406 Ga0182006_1000128
407 Ga0163161_10000807
408 Ga0206353_10450483
409 Ga0154015_1184884
410 Ga0213873_10087343
411 Ga0213874_10226320
412 Ga0213876_10021450
413 Ga0213876_10089100
414 Ga0213875_10167778
415 Ga0213875_10295166
416 Ga0207692_10232781
417 Ga0207705_10002197
418 Ga0207705_10083528
419 Ga0207705_10159279
420 Ga0207684_10026489
421 Ga0207707_10084867
422 Ga0207707_10155019
423 Ga0207707_10211409
424 Ga0207695_10097568
425 Ga0207671_10010500
426 Ga0207671_10024857
427 Ga0207671_10202689
428 Ga0207693_10100407
429 Ga0207662_10112814
430 Ga0207657_10000616
431 Ga0207657_10377770
432 Ga0207657_10443373
433 Ga0207652_10105505
434 Ga0207646_10544402
435 Ga0207687_10063447
436 Ga0207700_10016544
437 Ga0207664_10034329
438 Ga0207664_10226435
439 Ga0207664_10529236
440 Ga0207644_10448753
441 Ga0207690_10837721
442 Ga0207709_10332916
443 Ga0207670_10139226
444 Ga0207665_10150222
445 Ga0207665_11003497
446 Ga0207661_10025975
447 Ga0207667_10224713
448 Ga0207667_11055107
449 Ga0207677_10044959
450 Ga0207703_11501273
451 Ga0207678_11579723
452 Ga0207702_10082942
453 Ga0207702_10110475
454 Ga0207674_10090305
455 Ga0307408_101422491
456 Ga0307412_10644821
457 Ga0307415_100042209
458 Ga0307415_101265936
459 Ga0307415_101952562
460 Ga0395899_0070464
461 Ga0395900_0013258
462 Ga0395898_0037444
463 Ga0395898_0662281
464 Ga0395905_0317954
465 Ga0395905_0444968
466 Ga0436364_0134343
467 Ga0436364_0489658
468 Ga0436364_0713316
469 Ga0436364_0717876
470 Ga0395901_0022032
471 Ga0395901_0480722
472 Ga0395901_0773485
473 Ga0395901_0801192
474 Ga0395901_1127561
475 Ga0436365_0139407
476 Ga0436365_0726782
477 Ga0436365_1520746
478 Ga0436360_0696308
479 Ga0436360_1221244
480 Ga0436361_0355574
481 Ga0436361_0769145
482 Ga0436361_1032670
483 Ga0436363_0265810
484 Ga0436363_0314954
485 Ga0436363_0857380
486 Ga0436363_1002757
487 Ga0436363_1102759
488 Ga0436363_1150578
489 Ga0436363_1473728
490 Ga0436363_1486061
491 Ga0436363_1560342
492 Ga0436362_0828419
493 Ga0436362_1187988
494 Ga0439465_0353003
495 Ga0439433_0087282
496 Ga0439463_096763
497 Ga0450915_003261
498 Ga0450903_062855
499 Ga0439458_0006599
500 Ga0439444_0009712
501 Ga0466966_0070980
502 Ga0466966_0202218
503 Ga0466961_0152340
504 Ga0466963_0102108
505 Ga0466963_0821471
506 Ga0466963_0823460
507 Ga0466964_0267658
508 Ga0466971_0119803
509 Ga0466968_0030655
510 Ga0466968_0034554
511 Ga0466970_0349094
512 Ga0466960_0006249
513 Ga0466959_0017667
514 Ga0466959_0051185
515 Ga0466959_0104861
516 Ga0466959_0138603
517 Ga0466959_0547838
518 Ga0466959_1010835
519 Ga0466958_0055400
520 Ga0466958_0174904
521 Ga0466958_0468603
522 Ga0466958_0731103
523 Ga0495586_0039890
524 Ga0496100_0242496
525 Ga0496101_0073965
526 Ga0496101_0076835
527 Ga0496101_0255267
528 Ga0496102_0006933
529 Ga0496103_0009710
530 Ga0496106_0053428
531 Ga0496106_0606044
532 Ga0496107_0072148
533 Ga0496107_0113791
534 Ga0496107_0476841
535 Ga0496108_0051449
536 Ga0496108_0125090
537 Ga0496109_0017687
538 Ga0496109_0173017
539 Ga0496109_0195798
540 Ga0496109_1952952
541 Ga0496110_0658445
542 Ga0496111_0715898
543 Ga0496112_0126142
544 Ga0496112_0151347
545 Ga0496113_0181828
546 Ga0496113_0427940
547 Ga0496113_1018374
548 Ga0496114_0026023
549 Ga0496114_0141680
550 Ga0496115_0164253
551 Ga0496122_0003743
552 Ga0496123_0026380
553 Ga0501299_201659
554 Ga0501032_0093056
555 Ga0501034_0151416
556 Ga0501036_0290488
557 Ga0501038_1004530
558 Ga0501041_0580150
559 Ga0501043_0628621
560 Ga0501047_0083280
561 Ga0501067_0009610
562 Ga0501069_0389193
563 Ga0501069_0612425
564 Ga0501070_0560093
565 Ga0501071_0675088
566 Ga0501074_0406924
567 Ga0501075_0067034
568 Ga0501075_0505873
569 Ga0501076_0573162
570 Ga0501076_0593841
571 Ga0501077_1004078
572 Ga0501223_072804
573 Ga0501239_066565
574 Ga0501261_129090
575 Ga0501080_0071398
576 Ga0501081_0094026
577 Ga0501035_0796862
578 nmdc:mga05p37_1184208_c1
579 nmdc:mga05p37_17929_c1
580 nmdc:mga09592_1072418_c1
581 nmdc:mga08y16_1931777_c1
582 nmdc:mga0n895_4855_c1
583 nmdc:mga0n895_692115_c1
584 nmdc:mga0rr50_135940_c1
585 nmdc:mga0rr50_588746_c1
586 nmdc:mga08x19_1020889_c1
587 nmdc:mga08x19_672537_c1
588 nmdc:mga0a205_1265080_c1
589 Ga0501084_1355886
590 Ga0590071_007689
591 Ga0590075_161291
592 Ga0587071_124690
593 Ga0466962_0226107
594 Ga0466962_0371836
595 Ga0530510_0033888
596 Ga0530510_0061053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

28

164

0.88

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

30

153

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.9473 1 145
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.9348 1 145
3e5d-assembly1.cif.gz_A-2 crystal structure of a putative glyoxalase i (lmof2365_0426) from listeria monocytogenes str. 4b f2365 at 2.70 a resolution 0.7808 3 141
3g12-assembly1.cif.gz_A crystal structure of a putative lactoylglutathione lyase from bdellovibrio bacteriovorus 0.78 2 140
3e5d-assembly1.cif.gz_A-2 crystal structure of a putative glyoxalase i (lmof2365_0426) from listeria monocytogenes str. 4b f2365 at 2.70 a resolution 0.77 3 141
ID Description Score Start End Superfamily
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9216 1 145 3.10.180.10
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9154 1 145 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8783 90 145 3.30.720.110
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8361 8 143 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8222 8 143 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A6J4RTX7-F1-model_v4 Glyoxalase family protein 0.9764 5 67
AF-A0A0N9HQT4-F1-model_v4 VOC domain-containing protein 0.9756 6 73
AF-A0A4Q6BND0-F1-model_v4 VOC family protein 0.9646 1 67
AF-A0A6A8VRK5-F1-model_v4 deleted 0.9645 4 86
AF-A0A346XUA4-F1-model_v4 Glyoxalase family protein 0.9585 5 145 GO:0004493
GO:0046491

Map