F394105

General Info

Members Datasets Scaffolds Average Seq Length
298 237 596 148

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10000761|Ga0070710_100007612
Length 152
Sequence MKLILTADVSGLGAPGDIVEVKDGYGRNYLLPRGFAIVATRGAQKQIQVIQRAQDTRRVRDLDHAKELKAKLEGLGGVTLTAKAAAGSNKLFGSITTADVAAAVKKSTGGLVLDKRAIELPGHIKTTGKHSVTVRLHPEVTVALPLVVTAGE

Samples

Sample ID Description Type Environment
1 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
60 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
69 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
108 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
109 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
110 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
111 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
112 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
113 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
114 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
129 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
203 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
204 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
205 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
206 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
214 2582580736 Prauserella sp. Am3 Isolate Unclassified
215 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
216 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
217 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
218 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
219 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
220 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
221 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
222 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
223 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
224 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
225 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
226 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
227 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
228 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
229 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
230 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
231 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
232 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
233 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
234 2922554459 Rhodococcus sp. 66b Isolate Unclassified
235 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
236 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
237 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.58
Metatranscriptomes 4.03
Isolates 8.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.7
Nodule 0
Rhizoplane 7.72
Rhizosphere 71.81
Stem 0
Stem Tuber 0.34
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070710_10000761 3300005437 Bacteria 15364
2 JGI25406J46586_10004860 3300003203 Bacteria 6248
3 rootH2_10109987 3300003320 Bacteria 1221
4 JGI25405J52794_10028061 3300003911 Bacteria 1161
5 Ga0070658_10572895 3300005327 Bacteria 978
6 Ga0070676_10340129 3300005328 Bacteria 1029
7 Ga0070677_10350859 3300005333 Bacteria 764
8 Ga0070682_100315307 3300005337 Bacteria 1153
9 Ga0070682_101743229 3300005337 Bacteria 542
10 Ga0068868_100120359 3300005338 Bacteria 2141
11 Ga0068868_100238946 3300005338 Bacteria 1525
12 Ga0070660_100301544 3300005339 Bacteria 1313
13 Ga0070668_100001222 3300005347 Bacteria 18256
14 Ga0070675_100617826 3300005354 Bacteria 984
15 Ga0070688_100113188 3300005365 Bacteria 1807
16 Ga0070667_100295691 3300005367 Bacteria 1457
17 Ga0070714_100013157 3300005435 Bacteria 6626
18 Ga0070714_100185665 3300005435 Bacteria 1894
19 Ga0070714_100206366 3300005435 Bacteria 1799
20 Ga0070713_100211982 3300005436 Bacteria 1754
21 Ga0070713_101358898 3300005436 Bacteria 689
22 Ga0070705_100723255 3300005440 Unclassified 784
23 Ga0070700_100267727 3300005441 Bacteria 1233
24 Ga0070700_101762500 3300005441 Bacteria 533
25 Ga0070708_100047318 3300005445 Bacteria 3799
26 Ga0070663_100011949 3300005455 Bacteria 5476
27 Ga0070678_100895981 3300005456 Bacteria 811
28 Ga0070662_100347453 3300005457 Bacteria 1215
29 Ga0070685_10511011 3300005466 Bacteria 852
30 Ga0070685_10570242 3300005466 Bacteria 811
31 Ga0070706_100007701 3300005467 Bacteria 10069
32 Ga0070707_100002536 3300005468 Bacteria 17362
33 Ga0070699_100016853 3300005518 Bacteria 6272
34 Ga0068853_101890572 3300005539 Bacteria 579
35 Ga0070665_100142079 3300005548 Bacteria 2404
36 Ga0070665_100301655 3300005548 Bacteria 1605
37 Ga0068855_100780725 3300005563 Bacteria 1016
38 Ga0068857_100527310 3300005577 Bacteria 1111
39 Ga0068852_100262279 3300005616 Bacteria 1659
40 Ga0068859_102014111 3300005617 Bacteria 638
41 Ga0068864_100128206 3300005618 Bacteria 2276
42 Ga0068866_10256399 3300005718 Bacteria 1073
43 Ga0068861_100708238 3300005719 Bacteria 936
44 Ga0068861_100834629 3300005719 Bacteria 868
45 Ga0068851_10232586 3300005834 Bacteria 1039
46 Ga0068851_10290062 3300005834 Bacteria 938
47 Ga0068863_100244789 3300005841 Bacteria 1731
48 Ga0068858_100142055 3300005842 Bacteria 2254
49 Ga0068858_100601472 3300005842 Bacteria 1067
50 Ga0081455_10000300 3300005937 Bacteria 65485
51 Ga0081539_10000023 3300005985 Bacteria 356082
52 Ga0081539_10304980 3300005985 Unclassified 683
53 Ga0075363_100064719 3300006048 Bacteria 1976
54 Ga0075364_10036465 3300006051 Bacteria 3178
55 Ga0075367_10154760 3300006178 Bacteria 1424
56 Ga0075370_10012697 3300006353 Bacteria 4460
57 Ga0075428_101161232 3300006844 Bacteria 814
58 Ga0068865_100739966 3300006881 Bacteria 844
59 Ga0097620_102014136 3300006931 Bacteria 638
60 Ga0105244_10122843 3300009036 Bacteria 1256
61 Ga0111539_10391482 3300009094 Bacteria 1618
62 Ga0105245_11221250 3300009098 Bacteria 800
63 Ga0105247_10013010 3300009101 Bacteria 4990
64 Ga0105247_11420245 3300009101 Bacteria 562
65 Ga0105243_10312548 3300009148 Bacteria 1428
66 Ga0105248_11155172 3300009177 Bacteria 875
67 Ga0105237_11446216 3300009545 Bacteria 694
68 Ga0105238_10034245 3300009551 Bacteria 5168
69 Ga0105249_10697610 3300009553 Bacteria 1075
70 Ga0105249_11355188 3300009553 Bacteria 783
71 Ga0105249_12603833 3300009553 Bacteria 578
72 Ga0105029_100362 3300009984 Bacteria 2370
73 Ga0105246_10196579 3300011119 Bacteria 1565
74 Ga0157315_1026750 3300012508 Bacteria 649
75 Ga0157338_1017494 3300012515 Bacteria 803
76 Ga0157370_10759133 3300013104 Bacteria 883
77 Ga0157369_10371265 3300013105 Bacteria 1485
78 Ga0157369_10650550 3300013105 Bacteria 1087
79 Ga0157369_10892513 3300013105 Bacteria 912
80 Ga0157374_11055501 3300013296 Bacteria 832
81 Ga0157372_11548411 3300013307 Bacteria 763
82 Ga0157375_11053605 3300013308 Bacteria 951
83 Ga0163163_10554749 3300014325 Bacteria 1211
84 Ga0157379_10100464 3300014968 Bacteria 2596
85 Ga0206355_1310298 3300020076 Bacteria 1711
86 Ga0206352_10133053 3300020078 Bacteria 1780
87 Ga0213876_10000632 3300021384 Bacteria 25610
88 Ga0213876_10155667 3300021384 Bacteria 1215
89 Ga0213875_10002803 3300021388 Bacteria 10252
90 Ga0224712_10025758 3300022467 Bacteria 2071
91 Ga0207656_10294512 3300025321 Bacteria 802
92 Ga0207655_1092637 3300025728 Bacteria 1060
93 Ga0207682_10439271 3300025893 Bacteria 617
94 Ga0207692_10006888 3300025898 Bacteria 4631
95 Ga0207688_10170272 3300025901 Bacteria 1295
96 Ga0207688_10338677 3300025901 Bacteria 925
97 Ga0207680_10509359 3300025903 Bacteria 858
98 Ga0207684_10096777 3300025910 Bacteria 2519
99 Ga0207662_10090016 3300025918 Bacteria 1886
100 Ga0207646_10095161 3300025922 Bacteria 2668
101 Ga0207694_10129081 3300025924 Bacteria 2025
102 Ga0207687_10374896 3300025927 Bacteria 1164
103 Ga0207700_10168559 3300025928 Bacteria 1825
104 Ga0207664_10138232 3300025929 Bacteria 2058
105 Ga0207664_10369412 3300025929 Bacteria 1272
106 Ga0207706_10099845 3300025933 Bacteria 2554
107 Ga0207709_10132265 3300025935 Bacteria 1702
108 Ga0207709_10197409 3300025935 Bacteria 1434
109 Ga0207669_10444615 3300025937 Bacteria 1026
110 Ga0207704_10489220 3300025938 Bacteria 989
111 Ga0207711_10241917 3300025941 Bacteria 1655
112 Ga0207668_10738136 3300025972 Bacteria 868
113 Ga0207640_11540912 3300025981 Bacteria 598
114 Ga0207677_10037394 3300026023 Bacteria 3172
115 Ga0207678_10000700 3300026067 Bacteria 30569
116 Ga0207708_10508684 3300026075 Bacteria 1010
117 Ga0207708_11032704 3300026075 Bacteria 715
118 Ga0207641_10017934 3300026088 Bacteria 5799
119 Ga0207641_10374584 3300026088 Bacteria 1362
120 Ga0207676_10168197 3300026095 Bacteria 1907
121 Ga0207674_10514827 3300026116 Bacteria 1156
122 Ga0207675_100029110 3300026118 Bacteria 5148
123 Ga0207683_10128665 3300026121 Bacteria 2277
124 Ga0207683_10838684 3300026121 Bacteria 853
125 Ga0207698_10181664 3300026142 Bacteria 1864
126 Ga0207698_11874475 3300026142 Bacteria 614
127 Ga0207428_10119802 3300027907 Bacteria 2019
128 Ga0268265_10398378 3300028380 Bacteria 1272
129 Ga0268264_11007252 3300028381 Bacteria 840
130 Ga0307515_10063577 3300028794 Bacteria 5180
131 Ga0265338_10020114 3300028800 Bacteria 7038
132 Ga0307511_10004148 3300030521 Bacteria 14802
133 Ga0307512_10003647 3300030522 Bacteria 17602
134 Ga0316177_1062999 3300030731 Bacteria 2198
135 Ga0316176_1054377 3300030732 Bacteria 995
136 Ga0316176_1135283 3300030732 Bacteria 9005
137 Ga0316178_1041962 3300030735 Bacteria 917
138 Ga0316180_1082295 3300030736 Bacteria 4669
139 Ga0316183_1133436 3300030742 Bacteria 803
140 Ga0316182_1349362 3300030745 Bacteria 1172
141 Ga0265332_10195788 3300031238 Bacteria 841
142 Ga0265325_10006576 3300031241 Bacteria 7042
143 Ga0265329_10189973 3300031242 Bacteria 673
144 Ga0265340_10019280 3300031247 Bacteria 3511
145 Ga0265339_10009317 3300031249 Bacteria 6180
146 Ga0265316_10179834 3300031344 Bacteria 1575
147 Ga0307513_10090337 3300031456 Bacteria 3124
148 Ga0307509_10073242 3300031507 Bacteria 3567
149 Ga0307509_10103897 3300031507 Bacteria 2868
150 Ga0265313_10048834 3300031595 Bacteria 2040
151 Ga0307508_10223889 3300031616 Bacteria 1481
152 Ga0265342_10003391 3300031712 Bacteria 13130
153 Ga0307516_10527950 3300031730 Bacteria 834
154 Ga0307413_10001756 3300031824 Bacteria 8483
155 Ga0307413_10117506 3300031824 Bacteria 1794
156 Ga0307413_10180618 3300031824 Bacteria 1504
157 Ga0307518_10003528 3300031838 Bacteria 11257
158 Ga0326468_10002158 3300031889 Bacteria 1638
159 Ga0326468_10028637 3300031889 Bacteria 722
160 Ga0307412_11161447 3300031911 Bacteria 690
161 Ga0307409_100507994 3300031995 Bacteria 1175
162 Ga0307416_101745612 3300032002 Bacteria 727
163 Ga0307416_102289445 3300032002 Bacteria 641
164 Ga0307414_10809373 3300032004 Bacteria 855
165 Ga0307411_10013916 3300032005 Bacteria 4459
166 Ga0307411_10138547 3300032005 Bacteria 1790
167 Ga0307507_10006395 3300033179 Bacteria 18125
168 Ga0307507_10012036 3300033179 Bacteria 10781
169 Ga0307510_10079854 3300033180 Bacteria 3185
170 Ga0373939_0106921 3300035114 Bacteria 969
171 Ga0373925_0584787 3300037068 Bacteria 919
172 Ga0373925_0593826 3300037068 Bacteria 912
173 Ga0395905_0473949 3300037471 Bacteria 1151
174 Ga0436364_0454887 3300037853 Bacteria 53594
175 Ga0436365_0983552 3300039437 Bacteria 67648
176 Ga0436365_1509278 3300039437 Bacteria 3229
177 Ga0436363_1313362 3300039450 Bacteria 671
178 Ga0439449_0045718 3300042007 Bacteria 1622
179 Ga0439440_0017250 3300042993 Bacteria 1589
180 Ga0466969_0032469 3300044656 Bacteria 2653
181 Ga0466969_0133852 3300044656 Bacteria 1148
182 Ga0466972_0001536 3300044658 Bacteria 11249
183 Ga0466965_0035550 3300044683 Bacteria 2440
184 Ga0466965_0038259 3300044683 Bacteria 2356
185 Ga0466965_0059758 3300044683 Bacteria 1903
186 Ga0466966_0000619 3300044684 Bacteria 22569
187 Ga0466961_0014774 3300044693 Bacteria 5016
188 Ga0466961_0868449 3300044693 Bacteria 537
189 Ga0466963_0056284 3300044694 Bacteria 2617
190 Ga0466971_0070112 3300044719 Bacteria 1591
191 Ga0466971_0328220 3300044719 Bacteria 738
192 Ga0466968_0004081 3300044735 Bacteria 5432
193 Ga0466968_0023363 3300044735 Bacteria 2518
194 Ga0466970_0034835 3300044765 Bacteria 2666
195 Ga0466960_0014369 3300044901 Unclassified 3388
196 Ga0466960_0020670 3300044901 Bacteria 2919
197 Ga0466959_0006922 3300045049 Bacteria 7921
198 Ga0466967_0821382 3300045976 Bacteria 923
199 Ga0466967_1408951 3300045976 Bacteria 694
200 Ga0466967_2008977 3300045976 Bacteria 575
201 Ga0495641_0188652 3300046461 Bacteria 924
202 Ga0495651_0194176 3300046462 Bacteria 1426
203 Ga0495650_0022466 3300046471 Bacteria 3025
204 Ga0495652_0132355 3300046529 Bacteria 1972
205 Ga0495668_0000305 3300046616 Bacteria 67781
206 Ga0495675_0286133 3300047444 Bacteria 982
207 Ga0496100_0018498 3300048903 Bacteria 4134
208 Ga0496100_0240294 3300048903 Bacteria 1336
209 Ga0496102_0000560 3300048905 Bacteria 39736
210 Ga0496102_1788931 3300048905 Bacteria 532
211 Ga0496103_0000385 3300048906 Bacteria 39543
212 Ga0496104_0007064 3300048907 Bacteria 9902
213 Ga0496105_0256507 3300048908 Bacteria 1415
214 Ga0496106_1165589 3300048909 Bacteria 602
215 Ga0496107_0662233 3300048910 Unclassified 769
216 Ga0496108_0005311 3300048911 Bacteria 10400
217 Ga0496108_0019597 3300048911 Bacteria 5557
218 Ga0496109_0023293 3300048912 Bacteria 5494
219 Ga0496109_0179355 3300048912 Bacteria 1989
220 Ga0496110_0015122 3300048913 Bacteria 6415
221 Ga0496110_0050360 3300048913 Bacteria 3657
222 Ga0496110_0825628 3300048913 Bacteria 832
223 Ga0496110_1104630 3300048913 Bacteria 701
224 Ga0496111_0029059 3300048914 Bacteria 3922
225 Ga0496111_0057471 3300048914 Bacteria 2817
226 Ga0496112_0274481 3300048915 Bacteria 1633
227 Ga0496113_0007821 3300048916 Bacteria 6908
228 Ga0496113_0312790 3300048916 Bacteria 1258
229 Ga0496115_0601775 3300048918 Bacteria 874
230 Ga0496116_0005701 3300048919 Bacteria 11454
231 Ga0496117_0001161 3300048920 Bacteria 39578
232 Ga0496118_0001214 3300048921 Bacteria 39626
233 Ga0496119_0002169 3300048922 Bacteria 22032
234 Ga0496120_0092434 3300048923 Bacteria 1613
235 Ga0496122_0174581 3300048925 Bacteria 1290
236 Ga0496124_0012939 3300048927 Bacteria 8184
237 Ga0496125_0022645 3300048928 Bacteria 5827
238 Ga0496125_0154832 3300048928 Bacteria 1567
239 Ga0496125_0432103 3300048928 Bacteria 760
240 Ga0496126_0000007 3300048929 Bacteria 787364
241 Ga0496126_0001311 3300048929 Bacteria 39607
242 Ga0501314_005970 3300049530 Bacteria 1050
243 Ga0501315_033456 3300049531 Bacteria 751
244 Ga0501318_017651 3300049534 Bacteria 873
245 Ga0501032_0021889 3300049569 Bacteria 4439
246 Ga0501034_1244376 3300049571 Bacteria 622
247 Ga0501067_0423605 3300049583 Bacteria 743
248 Ga0501070_0050488 3300049586 Bacteria 3453
249 Ga0501070_0143418 3300049586 Bacteria 1972
250 Ga0501070_1296246 3300049586 Bacteria 556
251 Ga0501044_0016504 3300049823 Bacteria 7925
252 nmdc:mga03n38_5231_c1 3300050490 Bacteria 4397
253 nmdc:mga00v17_31041_c1 3300050491 Bacteria 3148
254 nmdc:mga06z11_193504_c1 3300050494 Bacteria 1178
255 nmdc:mga07m45_137706_c1 3300050496 Bacteria 1413
256 nmdc:mga07m45_17816_c1 3300050496 Bacteria 3822
257 nmdc:mga06r32_1277_c3 3300050510 Bacteria 11820
258 nmdc:mga08y16_2152926_c1 3300050511 Bacteria 505
259 nmdc:mga08y16_91244_c1 3300050511 Bacteria 3175
260 Ga0495612_0003703 3300053078 Bacteria 6346
261 Ga0495619_0017069 3300053085 Bacteria 4602
262 Ga0500644_0009123 3300053088 Bacteria 2643
263 Ga0500644_0063202 3300053088 Bacteria 1311
264 Ga0500559_0200764 3300053136 Bacteria 940
265 Ga0500573_0040817 3300053140 Bacteria 2680
266 Ga0500577_0027277 3300053142 Bacteria 1954
267 Ga0587066_053325 3300059490 Bacteria 803
268 Ga0587082_059675 3300059504 Bacteria 749
269 Ga0587088_033386 3300059508 Bacteria 933
270 Ga0587106_084893 3300059605 Bacteria 623
271 Ga0587128_041591 3300059630 Bacteria 806
272 Ga0587067_165213 3300059640 Bacteria 566
273 Ga0466962_0089805 3300061719 Bacteria 1472
274 2566996989 2565956761 Bacteria 6601618
275 2583152809 2582580736 Bacteria 5325865
276 2586065657 2585427649 Bacteria 9053857
277 2739205862 2738543005 Bacteria 5278128
278 2753069423 2751185734 Bacteria 8863695
279 2776371981 2775506925 Bacteria 7237746
280 2791911140 2791354901 Bacteria 8322202
281 2795780906 2795385470 Bacteria 8317180
282 2795794813 2795385472 Bacteria 6627535
283 2809594071 2808606522 Bacteria 9488490
284 2863069964 2863067949 Bacteria 8541735
285 2866554732 2866552031 Bacteria 5824618
286 2866616032 2866612099 Bacteria 7543886
287 2870728096 2870721527 Bacteria 9689237
288 2870782799 2870782633 Bacteria 9624083
289 2899359931 2899359706 Bacteria 10940472
290 2899376031 2899370129 Bacteria 6781179
291 2904536590 2904535858 Bacteria 6308016
292 2915769274 2915768154 Bacteria 8424322
293 2917744303 2917736166 Bacteria 9690793
294 2919715044 2919713450 Bacteria 7431245
295 2922556488 2922554459 Bacteria 6683962
296 8003314811 8003314358 Bacteria 10575343
297 8047719131 8047710418 Bacteria 11023148
298 8056213894 8056207758 Bacteria 8639239
299 Ga0070710_10000761
300 JGI25406J46586_10004860
301 rootH2_10109987
302 JGI25405J52794_10028061
303 Ga0070658_10572895
304 Ga0070676_10340129
305 Ga0070677_10350859
306 Ga0070682_100315307
307 Ga0070682_101743229
308 Ga0068868_100120359
309 Ga0068868_100238946
310 Ga0070660_100301544
311 Ga0070668_100001222
312 Ga0070675_100617826
313 Ga0070688_100113188
314 Ga0070667_100295691
315 Ga0070714_100013157
316 Ga0070714_100185665
317 Ga0070714_100206366
318 Ga0070713_100211982
319 Ga0070713_101358898
320 Ga0070705_100723255
321 Ga0070700_100267727
322 Ga0070700_101762500
323 Ga0070708_100047318
324 Ga0070663_100011949
325 Ga0070678_100895981
326 Ga0070662_100347453
327 Ga0070685_10511011
328 Ga0070685_10570242
329 Ga0070706_100007701
330 Ga0070707_100002536
331 Ga0070699_100016853
332 Ga0068853_101890572
333 Ga0070665_100142079
334 Ga0070665_100301655
335 Ga0068855_100780725
336 Ga0068857_100527310
337 Ga0068852_100262279
338 Ga0068859_102014111
339 Ga0068864_100128206
340 Ga0068866_10256399
341 Ga0068861_100708238
342 Ga0068861_100834629
343 Ga0068851_10232586
344 Ga0068851_10290062
345 Ga0068863_100244789
346 Ga0068858_100142055
347 Ga0068858_100601472
348 Ga0081455_10000300
349 Ga0081539_10000023
350 Ga0081539_10304980
351 Ga0075363_100064719
352 Ga0075364_10036465
353 Ga0075367_10154760
354 Ga0075370_10012697
355 Ga0075428_101161232
356 Ga0068865_100739966
357 Ga0097620_102014136
358 Ga0105244_10122843
359 Ga0111539_10391482
360 Ga0105245_11221250
361 Ga0105247_10013010
362 Ga0105247_11420245
363 Ga0105243_10312548
364 Ga0105248_11155172
365 Ga0105237_11446216
366 Ga0105238_10034245
367 Ga0105249_10697610
368 Ga0105249_11355188
369 Ga0105249_12603833
370 Ga0105029_100362
371 Ga0105246_10196579
372 Ga0157315_1026750
373 Ga0157338_1017494
374 Ga0157370_10759133
375 Ga0157369_10371265
376 Ga0157369_10650550
377 Ga0157369_10892513
378 Ga0157374_11055501
379 Ga0157372_11548411
380 Ga0157375_11053605
381 Ga0163163_10554749
382 Ga0157379_10100464
383 Ga0206355_1310298
384 Ga0206352_10133053
385 Ga0213876_10000632
386 Ga0213876_10155667
387 Ga0213875_10002803
388 Ga0224712_10025758
389 Ga0207656_10294512
390 Ga0207655_1092637
391 Ga0207682_10439271
392 Ga0207692_10006888
393 Ga0207688_10170272
394 Ga0207688_10338677
395 Ga0207680_10509359
396 Ga0207684_10096777
397 Ga0207662_10090016
398 Ga0207646_10095161
399 Ga0207694_10129081
400 Ga0207687_10374896
401 Ga0207700_10168559
402 Ga0207664_10138232
403 Ga0207664_10369412
404 Ga0207706_10099845
405 Ga0207709_10132265
406 Ga0207709_10197409
407 Ga0207669_10444615
408 Ga0207704_10489220
409 Ga0207711_10241917
410 Ga0207668_10738136
411 Ga0207640_11540912
412 Ga0207677_10037394
413 Ga0207678_10000700
414 Ga0207708_10508684
415 Ga0207708_11032704
416 Ga0207641_10017934
417 Ga0207641_10374584
418 Ga0207676_10168197
419 Ga0207674_10514827
420 Ga0207675_100029110
421 Ga0207683_10128665
422 Ga0207683_10838684
423 Ga0207698_10181664
424 Ga0207698_11874475
425 Ga0207428_10119802
426 Ga0268265_10398378
427 Ga0268264_11007252
428 Ga0307515_10063577
429 Ga0265338_10020114
430 Ga0307511_10004148
431 Ga0307512_10003647
432 Ga0316177_1062999
433 Ga0316176_1054377
434 Ga0316176_1135283
435 Ga0316178_1041962
436 Ga0316180_1082295
437 Ga0316183_1133436
438 Ga0316182_1349362
439 Ga0265332_10195788
440 Ga0265325_10006576
441 Ga0265329_10189973
442 Ga0265340_10019280
443 Ga0265339_10009317
444 Ga0265316_10179834
445 Ga0307513_10090337
446 Ga0307509_10073242
447 Ga0307509_10103897
448 Ga0265313_10048834
449 Ga0307508_10223889
450 Ga0265342_10003391
451 Ga0307516_10527950
452 Ga0307413_10001756
453 Ga0307413_10117506
454 Ga0307413_10180618
455 Ga0307518_10003528
456 Ga0326468_10002158
457 Ga0326468_10028637
458 Ga0307412_11161447
459 Ga0307409_100507994
460 Ga0307416_101745612
461 Ga0307416_102289445
462 Ga0307414_10809373
463 Ga0307411_10013916
464 Ga0307411_10138547
465 Ga0307507_10006395
466 Ga0307507_10012036
467 Ga0307510_10079854
468 Ga0373939_0106921
469 Ga0373925_0584787
470 Ga0373925_0593826
471 Ga0395905_0473949
472 Ga0436364_0454887
473 Ga0436365_0983552
474 Ga0436365_1509278
475 Ga0436363_1313362
476 Ga0439449_0045718
477 Ga0439440_0017250
478 Ga0466969_0032469
479 Ga0466969_0133852
480 Ga0466972_0001536
481 Ga0466965_0035550
482 Ga0466965_0038259
483 Ga0466965_0059758
484 Ga0466966_0000619
485 Ga0466961_0014774
486 Ga0466961_0868449
487 Ga0466963_0056284
488 Ga0466971_0070112
489 Ga0466971_0328220
490 Ga0466968_0004081
491 Ga0466968_0023363
492 Ga0466970_0034835
493 Ga0466960_0014369
494 Ga0466960_0020670
495 Ga0466959_0006922
496 Ga0466967_0821382
497 Ga0466967_1408951
498 Ga0466967_2008977
499 Ga0495641_0188652
500 Ga0495651_0194176
501 Ga0495650_0022466
502 Ga0495652_0132355
503 Ga0495668_0000305
504 Ga0495675_0286133
505 Ga0496100_0018498
506 Ga0496100_0240294
507 Ga0496102_0000560
508 Ga0496102_1788931
509 Ga0496103_0000385
510 Ga0496104_0007064
511 Ga0496105_0256507
512 Ga0496106_1165589
513 Ga0496107_0662233
514 Ga0496108_0005311
515 Ga0496108_0019597
516 Ga0496109_0023293
517 Ga0496109_0179355
518 Ga0496110_0015122
519 Ga0496110_0050360
520 Ga0496110_0825628
521 Ga0496110_1104630
522 Ga0496111_0029059
523 Ga0496111_0057471
524 Ga0496112_0274481
525 Ga0496113_0007821
526 Ga0496113_0312790
527 Ga0496115_0601775
528 Ga0496116_0005701
529 Ga0496117_0001161
530 Ga0496118_0001214
531 Ga0496119_0002169
532 Ga0496120_0092434
533 Ga0496122_0174581
534 Ga0496124_0012939
535 Ga0496125_0022645
536 Ga0496125_0154832
537 Ga0496125_0432103
538 Ga0496126_0000007
539 Ga0496126_0001311
540 Ga0501314_005970
541 Ga0501315_033456
542 Ga0501318_017651
543 Ga0501032_0021889
544 Ga0501034_1244376
545 Ga0501067_0423605
546 Ga0501070_0050488
547 Ga0501070_0143418
548 Ga0501070_1296246
549 Ga0501044_0016504
550 nmdc:mga03n38_5231_c1
551 nmdc:mga00v17_31041_c1
552 nmdc:mga06z11_193504_c1
553 nmdc:mga07m45_137706_c1
554 nmdc:mga07m45_17816_c1
555 nmdc:mga06r32_1277_c3
556 nmdc:mga08y16_2152926_c1
557 nmdc:mga08y16_91244_c1
558 Ga0495612_0003703
559 Ga0495619_0017069
560 Ga0500644_0009123
561 Ga0500644_0063202
562 Ga0500559_0200764
563 Ga0500573_0040817
564 Ga0500577_0027277
565 Ga0587066_053325
566 Ga0587082_059675
567 Ga0587088_033386
568 Ga0587106_084893
569 Ga0587128_041591
570 Ga0587067_165213
571 Ga0466962_0089805
572 2566996989
573 2583152809
574 2586065657
575 2739205862
576 2753069423
577 2776371981
578 2791911140
579 2795780906
580 2795794813
581 2809594071
582 2863069964
583 2866554732
584 2866616032
585 2870728096
586 2870782799
587 2899359931
588 2899376031
589 2904536590
590 2915769274
591 2917744303
592 2919715044
593 2922556488
594 8003314811
595 8047719131
596 8056213894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01281

Ribosomal_L9_N

Ribosomal protein L9, N-terminal domain

1

47

0.98

PF03948

Ribosomal_L9_C

Ribosomal protein L9, C-terminal domain

63

150

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8aye-assembly1.cif.gz_h e. coli 70s ribosome bound to thermorubin and fmet-trna 0.9952 1 41
8cgd-assembly1.cif.gz_h clindamycin bound to the 50s subunit 0.9933 1 41
8fto-assembly1.cif.gz_h e. coli 70s ribosome with an improved ms2 tag inserted in h98 0.9929 1 41
8cgk-assembly1.cif.gz_h lincomycin and avilamycin bound to the 50s subunit 0.9895 1 41
8ceu-assembly1.cif.gz_h retapamulin and capreomycin bound to the 50s subunit 0.987 1 41
ID Description Score Start End Superfamily
af_P9WH79_61_151_3.10.430.100 Alpha Beta;Roll;Ribosomal Protein L9; domain 2;Ribosomal protein L9, C-terminal domain 0.9873 61 150 3.10.430.100
af_A0A1D6HNM4_48_91_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9706 3 43 3.40.5.10
af_P9WH79_61_151_3.10.430.100 Alpha Beta;Roll;Ribosomal Protein L9; domain 2;Ribosomal protein L9, C-terminal domain 0.9661 61 150 3.10.430.100
af_P0A7R1_1_50_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9632 1 49 3.40.5.10
af_Q54QM2_41_88_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9478 3 48 3.40.5.10
ID Description Score Start End GO Terms
AF-A0A095YLH8-F1-model_v4 50S ribosomal protein L9 0.929 59 150 GO:0003735
GO:0005840
GO:0006412
AF-X1M0K0-F1-model_v4 Large ribosomal subunit protein bL9 C-terminal domain-containing protein 0.9183 78 150 GO:0003735
GO:0005840
GO:0006412
AF-A0A7K0SCK5-F1-model_v4 deleted 0.9049 64 150
AF-A0A653T3B7-F1-model_v4 LSU ribosomal protein L9p 0.9041 78 150 GO:0003735
GO:0005840
GO:0006412
AF-A0A0B0HK97-F1-model_v4 deleted 0.9033 78 150

Map