F393805

General Info

Members Datasets Scaffolds Average Seq Length
297 213 594 171

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0565005|Ga0436364_0565005_18614_19135
Length 173
Sequence MVALATHLQMMAAYNGWANRRLYGAAAALPDPAWRQPAGVFFGSLHGTLNHLLATDRIWLRRLTGEGEAPSRLDAILFEERDALRAAREAEDARLCGYVAGLSDTDLAASFEYATTRGQPQRQPRWQALVHLFNHQTHHRGQAHACLTRLGVAEPASLDLLVMQREQASQRAP

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
102 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
103 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
117 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
118 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
126 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
139 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
140 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
163 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
170 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
171 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
172 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
177 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
178 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
179 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
180 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
181 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
182 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
183 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
184 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
185 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
186 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
187 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
188 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
190 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
191 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
192 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
193 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
194 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
195 2512875024
196 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
197 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
198 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
199 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
200 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
201 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
202 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
203 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
204 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
205 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
206 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
207 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
208 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
209 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
210 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
211 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
212 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
213 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.6
Metatranscriptomes 0
Isolates 6.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.85
Nodule 6.4
Rhizoplane 11.11
Rhizosphere 57.24
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0565005 3300037853 Bacteria 33260
2 Ga0070670_100909032 3300005331 Bacteria 798
3 Ga0070689_100805970 3300005340 Bacteria 826
4 Ga0070668_100780438 3300005347 Bacteria 848
5 Ga0070674_100074542 3300005356 Bacteria 2408
6 Ga0070674_100653933 3300005356 Bacteria 894
7 Ga0070659_100047798 3300005366 Bacteria 3359
8 Ga0070709_10032834 3300005434 Bacteria 3133
9 Ga0070713_100000783 3300005436 Bacteria 20312
10 Ga0070710_10002052 3300005437 Bacteria 9539
11 Ga0070710_10267169 3300005437 Bacteria 1105
12 Ga0070711_100053103 3300005439 Bacteria 2791
13 Ga0070711_100165805 3300005439 Bacteria 1679
14 Ga0070700_100800739 3300005441 Bacteria 759
15 Ga0070663_100109814 3300005455 Bacteria 2071
16 Ga0070678_100148423 3300005456 Bacteria 1885
17 Ga0070706_100074941 3300005467 Bacteria 3132
18 Ga0070686_100448158 3300005544 Bacteria 992
19 Ga0070665_100088172 3300005548 Bacteria 3108
20 Ga0070665_100439212 3300005548 Bacteria 1314
21 Ga0070665_100680563 3300005548 Bacteria 1042
22 Ga0068856_100030198 3300005614 Bacteria 5298
23 Ga0068856_100456779 3300005614 Bacteria 1298
24 Ga0068859_100489587 3300005617 Bacteria 1325
25 Ga0068858_100099908 3300005842 Bacteria 2706
26 Ga0068858_101247738 3300005842 Bacteria 731
27 Ga0068860_100245912 3300005843 Bacteria 1741
28 Ga0081455_10001785 3300005937 Bacteria 25987
29 Ga0081539_10003393 3300005985 Bacteria 19674
30 Ga0081539_10003999 3300005985 Bacteria 16991
31 Ga0070717_10200052 3300006028 Bacteria 1749
32 Ga0070717_10969762 3300006028 Bacteria 774
33 Ga0075365_10249724 3300006038 Bacteria 1247
34 Ga0075363_100197420 3300006048 Bacteria 1149
35 Ga0075363_100356486 3300006048 Bacteria 855
36 Ga0075364_10190746 3300006051 Bacteria 1388
37 Ga0075364_10212276 3300006051 Bacteria 1313
38 Ga0070715_10000304 3300006163 Bacteria 12095
39 Ga0070715_10040295 3300006163 Bacteria 1952
40 Ga0070716_100024879 3300006173 Bacteria 3188
41 Ga0070716_100356772 3300006173 Bacteria 1037
42 Ga0070712_100008208 3300006175 Bacteria 6559
43 Ga0075362_10117719 3300006177 Bacteria 1255
44 Ga0075362_10149379 3300006177 Bacteria 1120
45 Ga0075367_10176471 3300006178 Bacteria 1331
46 Ga0075367_10181388 3300006178 Bacteria 1313
47 Ga0075369_10005914 3300006186 Bacteria 4600
48 Ga0075369_10157833 3300006186 Bacteria 1039
49 Ga0075366_10319853 3300006195 Bacteria 950
50 Ga0075370_10048072 3300006353 Bacteria 2417
51 Ga0068865_100156758 3300006881 Bacteria 1732
52 Ga0097620_100489632 3300006931 Bacteria 1325
53 Ga0099795_10046333 3300007788 Bacteria 1566
54 Ga0099795_10425491 3300007788 Bacteria 607
55 Ga0105244_10447652 3300009036 Bacteria 594
56 Ga0105240_10038893 3300009093 Bacteria 6098
57 Ga0111539_10561228 3300009094 Bacteria 1330
58 Ga0105247_10236872 3300009101 Bacteria 1242
59 Ga0105241_10111539 3300009174 Bacteria 2190
60 Ga0105242_11015753 3300009176 Bacteria 838
61 Ga0105242_11168873 3300009176 Bacteria 787
62 Ga0105248_10052096 3300009177 Bacteria 4593
63 Ga0105248_11306076 3300009177 Bacteria 821
64 Ga0105237_10706642 3300009545 Bacteria 1015
65 Ga0105237_11549058 3300009545 Bacteria 670
66 Ga0105238_10415884 3300009551 Bacteria 1339
67 Ga0105238_11263515 3300009551 Unclassified 764
68 Ga0105035_115460 3300009988 Bacteria 701
69 Ga0105239_10045962 3300010375 Bacteria 4785
70 Ga0105239_10451625 3300010375 Bacteria 1458
71 Ga0105239_11061732 3300010375 Bacteria 932
72 Ga0105246_10192462 3300011119 Bacteria 1580
73 Ga0157370_10654177 3300013104 Bacteria 960
74 Ga0157374_11130271 3300013296 Bacteria 804
75 Ga0157378_11248118 3300013297 Bacteria 783
76 Ga0163162_11104519 3300013306 Bacteria 899
77 Ga0163162_11219692 3300013306 Bacteria 854
78 Ga0163163_10014391 3300014325 Bacteria 7274
79 Ga0182008_10205446 3300014497 Bacteria 1003
80 Ga0157376_10194435 3300014969 Bacteria 1862
81 Ga0157376_11279011 3300014969 Bacteria 763
82 Ga0163161_10043682 3300017792 Bacteria 3227
83 Ga0163161_10250017 3300017792 Bacteria 1382
84 Ga0163161_10534997 3300017792 Bacteria 958
85 Ga0213875_10004118 3300021388 Bacteria 8062
86 Ga0209148_1016234 3300025254 Bacteria 1286
87 Ga0209564_1000747 3300025295 Bacteria 46025
88 Ga0209758_1001618 3300025297 Bacteria 25654
89 Ga0207682_10080368 3300025893 Bacteria 1396
90 Ga0207692_10000602 3300025898 Bacteria 12738
91 Ga0207688_10178509 3300025901 Bacteria 1266
92 Ga0207685_10014665 3300025905 Bacteria 2459
93 Ga0207699_10031834 3300025906 Bacteria 2965
94 Ga0207684_10379254 3300025910 Bacteria 1216
95 Ga0207695_10164038 3300025913 Bacteria 2151
96 Ga0207693_10009646 3300025915 Bacteria 7861
97 Ga0207663_10010758 3300025916 Bacteria 4885
98 Ga0207657_10247849 3300025919 Bacteria 1421
99 Ga0207700_10047738 3300025928 Bacteria 3175
100 Ga0207664_11349794 3300025929 Bacteria 633
101 Ga0207690_10134928 3300025932 Bacteria 1811
102 Ga0207686_10155370 3300025934 Bacteria 1597
103 Ga0207686_10763703 3300025934 Bacteria 773
104 Ga0207670_10636992 3300025936 Bacteria 878
105 Ga0207669_10221431 3300025937 Bacteria 1389
106 Ga0207704_10922734 3300025938 Bacteria 735
107 Ga0207665_10000913 3300025939 Bacteria 19947
108 Ga0207691_10115524 3300025940 Bacteria 2383
109 Ga0207711_10151452 3300025941 Bacteria 2093
110 Ga0207711_10441585 3300025941 Bacteria 1211
111 Ga0207679_10756871 3300025945 Bacteria 884
112 Ga0207667_10715235 3300025949 Bacteria 1003
113 Ga0207668_10369563 3300025972 Bacteria 1204
114 Ga0207668_11403498 3300025972 Bacteria 630
115 Ga0207640_10444925 3300025981 Bacteria 1066
116 Ga0207703_10613263 3300026035 Bacteria 1030
117 Ga0207639_10276341 3300026041 Bacteria 1475
118 Ga0207678_10125111 3300026067 Bacteria 2193
119 Ga0207708_11189715 3300026075 Bacteria 666
120 Ga0207702_10394109 3300026078 Bacteria 1334
121 Ga0207641_10276717 3300026088 Bacteria 1577
122 Ga0207683_10273786 3300026121 Bacteria 1542
123 Ga0209588_1064957 3300027671 Bacteria 1179
124 Ga0268266_10061647 3300028379 Bacteria 3235
125 Ga0268266_10862598 3300028379 Bacteria 875
126 Ga0307515_10494880 3300028794 Bacteria 834
127 Ga0265340_10008947 3300031247 Bacteria 5395
128 Ga0265339_10096318 3300031249 Bacteria 1545
129 Ga0265316_10127533 3300031344 Bacteria 1918
130 Ga0307508_10026412 3300031616 Bacteria 5263
131 Ga0307405_10087782 3300031731 Bacteria 2051
132 Ga0307510_10007834 3300033180 Bacteria 12735
133 Ga0373930_0005846 3300034816 Bacteria 2060
134 Ga0373938_0077343 3300034957 Bacteria 805
135 Ga0373936_0196654 3300035113 Bacteria 889
136 Ga0373946_0030362 3300035171 Bacteria 2157
137 Ga0373931_0002773 3300035691 Bacteria 7796
138 Ga0373931_0230515 3300035691 Bacteria 1119
139 Ga0373935_0055204 3300035692 Bacteria 2531
140 Ga0373927_0011602 3300035695 Bacteria 5868
141 Ga0373927_0106329 3300035695 Bacteria 1827
142 Ga0373927_0196620 3300035695 Bacteria 1323
143 Ga0373947_0031471 3300035725 Bacteria 3123
144 Ga0373947_0556427 3300035725 Bacteria 781
145 Ga0373947_0659142 3300035725 Bacteria 714
146 Ga0373925_0289891 3300037068 Bacteria 1320
147 Ga0373925_0385436 3300037068 Bacteria 1142
148 Ga0395899_0015025 3300037312 Bacteria 5903
149 Ga0395899_0041913 3300037312 Bacteria 3419
150 Ga0395900_0037963 3300037418 Bacteria 4966
151 Ga0395898_0011930 3300037466 Bacteria 9001
152 Ga0395901_0000593 3300038443 Bacteria 42246
153 Ga0395901_0035828 3300038443 Bacteria 5127
154 Ga0436361_0385696 3300039447 Bacteria 997
155 Ga0439465_0061652 3300041413 Bacteria 1244
156 Ga0439465_0063489 3300041413 Bacteria 1227
157 Ga0451843_0538096 3300041509 Bacteria 1206
158 Ga0439452_089082 3300042010 Bacteria 668
159 Ga0495592_0034614 3300046454 Bacteria 3807
160 Ga0495603_0217068 3300046455 Bacteria 1104
161 Ga0495638_0278049 3300046460 Bacteria 911
162 Ga0495651_0572494 3300046462 Bacteria 715
163 Ga0495580_0177641 3300046472 Bacteria 1471
164 Ga0495582_0052731 3300046473 Bacteria 2243
165 Ga0495620_0243273 3300046515 Bacteria 686
166 Ga0495644_0387121 3300046523 Bacteria 553
167 Ga0495648_0397322 3300046524 Bacteria 617
168 Ga0495665_0136944 3300046531 Bacteria 1281
169 Ga0495621_0062587 3300046539 Bacteria 1354
170 Ga0495621_0334540 3300046539 Bacteria 633
171 Ga0495645_0015535 3300046543 Bacteria 5415
172 Ga0495625_0515892 3300046660 Bacteria 729
173 Ga0495661_0284324 3300046665 Bacteria 833
174 Ga0495599_0202564 3300046678 Bacteria 1219
175 Ga0495613_0044028 3300046689 Bacteria 3303
176 Ga0495613_0173806 3300046689 Bacteria 1528
177 Ga0495600_0167236 3300046809 Bacteria 1420
178 Ga0495600_0587132 3300046809 Bacteria 678
179 Ga0495604_0661434 3300047317 Bacteria 666
180 Ga0495680_0267058 3300047322 Bacteria 1209
181 Ga0495683_0250330 3300047323 Bacteria 778
182 Ga0495673_0202187 3300047469 Bacteria 742
183 Ga0495681_0251269 3300047470 Bacteria 698
184 Ga0495684_0438273 3300047471 Bacteria 910
185 Ga0495686_0081673 3300047472 Bacteria 1973
186 Ga0495626_0076650 3300048091 Bacteria 1492
187 Ga0496100_0132672 3300048903 Bacteria 1756
188 Ga0496100_0247752 3300048903 Bacteria 1317
189 Ga0496101_0055049 3300048904 Bacteria 2872
190 Ga0496101_0062517 3300048904 Bacteria 2707
191 Ga0496102_0033502 3300048905 Bacteria 4617
192 Ga0496102_0583112 3300048905 Bacteria 1041
193 Ga0496103_0012371 3300048906 Bacteria 5062
194 Ga0496103_0078249 3300048906 Bacteria 2077
195 Ga0496104_0004005 3300048907 Bacteria 12766
196 Ga0496104_0168942 3300048907 Bacteria 2097
197 Ga0496105_0032534 3300048908 Bacteria 4280
198 Ga0496105_0058243 3300048908 Bacteria 3189
199 Ga0496106_0025248 3300048909 Bacteria 4421
200 Ga0496106_0056750 3300048909 Bacteria 2960
201 Ga0496106_0438668 3300048909 Bacteria 1049
202 Ga0496107_0050672 3300048910 Bacteria 2993
203 Ga0496108_0006244 3300048911 Bacteria 9649
204 Ga0496108_0139404 3300048911 Bacteria 2089
205 Ga0496108_0586745 3300048911 Bacteria 971
206 Ga0496109_0148486 3300048912 Bacteria 2194
207 Ga0496110_0084761 3300048913 Bacteria 2828
208 Ga0496110_0103159 3300048913 Bacteria 2558
209 Ga0496111_0103692 3300048914 Bacteria 2092
210 Ga0496112_0056895 3300048915 Bacteria 3850
211 Ga0496112_0150606 3300048915 Bacteria 2293
212 Ga0496113_0002928 3300048916 Bacteria 10075
213 Ga0496113_0034478 3300048916 Bacteria 3693
214 Ga0496114_0032370 3300048917 Bacteria 4303
215 Ga0496114_0056698 3300048917 Bacteria 3270
216 Ga0496114_0199508 3300048917 Bacteria 1752
217 Ga0496115_0012554 3300048918 Bacteria 6382
218 Ga0496115_0016822 3300048918 Bacteria 5576
219 Ga0496115_0041482 3300048918 Bacteria 3663
220 Ga0496117_0148036 3300048920 Bacteria 1394
221 Ga0496117_0194885 3300048920 Bacteria 1150
222 Ga0496118_0041522 3300048921 Bacteria 3641
223 Ga0496118_0247464 3300048921 Bacteria 1015
224 Ga0496119_0046387 3300048922 Bacteria 2714
225 Ga0496119_0201994 3300048922 Bacteria 1028
226 Ga0496119_0279932 3300048922 Bacteria 830
227 Ga0496120_0190835 3300048923 Bacteria 999
228 Ga0496121_0003208 3300048924 Bacteria 23541
229 Ga0496121_0020513 3300048924 Bacteria 6535
230 Ga0496121_0068153 3300048924 Bacteria 2880
231 Ga0496121_0377564 3300048924 Bacteria 936
232 Ga0496125_0000048 3300048928 Bacteria 290651
233 Ga0496125_0003042 3300048928 Bacteria 20965
234 Ga0496126_0116305 3300048929 Bacteria 2324
235 Ga0496126_0264493 3300048929 Bacteria 1429
236 Ga0495682_0144008 3300049460 Bacteria 851
237 Ga0501034_0001733 3300049571 Bacteria 28047
238 Ga0501034_0138275 3300049571 Bacteria 2416
239 Ga0501238_015029 3300049671 Bacteria 1065
240 Ga0501252_007159 3300049682 Bacteria 1257
241 Ga0501269_008103 3300049766 Bacteria 1271
242 nmdc:mga03683_14572_c1 3300050489 Bacteria 2912
243 nmdc:mga03683_165670_c1 3300050489 Bacteria 1003
244 nmdc:mga03n38_245120_c1 3300050490 Bacteria 944
245 nmdc:mga0yw44_113534_c1 3300050492 Bacteria 1738
246 nmdc:mga0k408_245949_c1 3300050493 Bacteria 1068
247 nmdc:mga0k408_26303_c1 3300050493 Bacteria 3298
248 nmdc:mga0k408_310987_c1 3300050493 Bacteria 940
249 nmdc:mga04h51_143909_c1 3300050495 Bacteria 906
250 nmdc:mga07m45_308977_c1 3300050496 Bacteria 919
251 nmdc:mga07m45_424367_c1 3300050496 Bacteria 771
252 nmdc:mga07m45_46503_c1 3300050496 Bacteria 2438
253 nmdc:mga07m45_53390_c1 3300050496 Bacteria 2283
254 nmdc:mga0sz30_18876_c1 3300050516 Bacteria 2764
255 Ga0500578_0508837 3300053086 Bacteria 676
256 Ga0500578_0545203 3300053086 Bacteria 646
257 Ga0500583_0029854 3300053092 Bacteria 2382
258 Ga0500651_0005442 3300053093 Bacteria 7269
259 Ga0500651_0060224 3300053093 Bacteria 2373
260 Ga0500651_0189291 3300053093 Bacteria 1219
261 Ga0500594_0018602 3300053118 Bacteria 1713
262 Ga0500595_003386 3300053119 Bacteria 7466
263 Ga0500595_015514 3300053119 Bacteria 2857
264 Ga0500595_031603 3300053119 Bacteria 1774
265 Ga0500607_049980 3300053121 Bacteria 2230
266 Ga0500642_0003442 3300053130 Bacteria 4788
267 Ga0500577_0002414 3300053142 Bacteria 4775
268 Ga0500586_004932 3300053145 Bacteria 3330
269 Ga0500604_0045019 3300053151 Bacteria 1345
270 Ga0500616_0032792 3300053153 Bacteria 2838
271 Ga0500627_0007084 3300053158 Bacteria 3875
272 Ga0500627_0029254 3300053158 Bacteria 2296
273 Ga0500627_0262954 3300053158 Bacteria 761
274 Ga0500638_194302 3300053162 Bacteria 864
275 Ga0500636_0029007 3300053177 Bacteria 3267
276 Ga0500611_016443 3300053727 Bacteria 1329
277 Ga0500611_096522 3300053727 Bacteria 760
278 Ga0500609_001614 3300053731 Bacteria 3283
279 2512964638 2512875024 Bacteria 7195110
280 2512972203 2512875026 Bacteria 6861065
281 2513603282 2513237089 Bacteria 6553624
282 2802717775 2802428858 Bacteria 6636079
283 2802723296 2802428859 Bacteria 6667919
284 2802743531 2802428862 Bacteria 6633353
285 2802750756 2802428863 Bacteria 6410669
286 2921251036 2921250672 Bacteria 6677771
287 2937029784 2937029754 Bacteria 6424026
288 2937036810 2937036028 Bacteria 6846469
289 2937082890 2937078374 Bacteria 6610289
290 2937090506 2937084907 Bacteria 6618516
291 2957438790 2957437181 Bacteria 6568994
292 2960595655 2960591022 Bacteria 6622873
293 2960696772 2960693952 Bacteria 6749742
294 2967734652 2967728569 Bacteria 6641507
295 2970144455 2970143518 Bacteria 6446480
296 2977531981 2977530762 Bacteria 6951399
297 8004000265 8003999396 Bacteria 7063185
298 Ga0436364_0565005
299 Ga0070670_100909032
300 Ga0070689_100805970
301 Ga0070668_100780438
302 Ga0070674_100074542
303 Ga0070674_100653933
304 Ga0070659_100047798
305 Ga0070709_10032834
306 Ga0070713_100000783
307 Ga0070710_10002052
308 Ga0070710_10267169
309 Ga0070711_100053103
310 Ga0070711_100165805
311 Ga0070700_100800739
312 Ga0070663_100109814
313 Ga0070678_100148423
314 Ga0070706_100074941
315 Ga0070686_100448158
316 Ga0070665_100088172
317 Ga0070665_100439212
318 Ga0070665_100680563
319 Ga0068856_100030198
320 Ga0068856_100456779
321 Ga0068859_100489587
322 Ga0068858_100099908
323 Ga0068858_101247738
324 Ga0068860_100245912
325 Ga0081455_10001785
326 Ga0081539_10003393
327 Ga0081539_10003999
328 Ga0070717_10200052
329 Ga0070717_10969762
330 Ga0075365_10249724
331 Ga0075363_100197420
332 Ga0075363_100356486
333 Ga0075364_10190746
334 Ga0075364_10212276
335 Ga0070715_10000304
336 Ga0070715_10040295
337 Ga0070716_100024879
338 Ga0070716_100356772
339 Ga0070712_100008208
340 Ga0075362_10117719
341 Ga0075362_10149379
342 Ga0075367_10176471
343 Ga0075367_10181388
344 Ga0075369_10005914
345 Ga0075369_10157833
346 Ga0075366_10319853
347 Ga0075370_10048072
348 Ga0068865_100156758
349 Ga0097620_100489632
350 Ga0099795_10046333
351 Ga0099795_10425491
352 Ga0105244_10447652
353 Ga0105240_10038893
354 Ga0111539_10561228
355 Ga0105247_10236872
356 Ga0105241_10111539
357 Ga0105242_11015753
358 Ga0105242_11168873
359 Ga0105248_10052096
360 Ga0105248_11306076
361 Ga0105237_10706642
362 Ga0105237_11549058
363 Ga0105238_10415884
364 Ga0105238_11263515
365 Ga0105035_115460
366 Ga0105239_10045962
367 Ga0105239_10451625
368 Ga0105239_11061732
369 Ga0105246_10192462
370 Ga0157370_10654177
371 Ga0157374_11130271
372 Ga0157378_11248118
373 Ga0163162_11104519
374 Ga0163162_11219692
375 Ga0163163_10014391
376 Ga0182008_10205446
377 Ga0157376_10194435
378 Ga0157376_11279011
379 Ga0163161_10043682
380 Ga0163161_10250017
381 Ga0163161_10534997
382 Ga0213875_10004118
383 Ga0209148_1016234
384 Ga0209564_1000747
385 Ga0209758_1001618
386 Ga0207682_10080368
387 Ga0207692_10000602
388 Ga0207688_10178509
389 Ga0207685_10014665
390 Ga0207699_10031834
391 Ga0207684_10379254
392 Ga0207695_10164038
393 Ga0207693_10009646
394 Ga0207663_10010758
395 Ga0207657_10247849
396 Ga0207700_10047738
397 Ga0207664_11349794
398 Ga0207690_10134928
399 Ga0207686_10155370
400 Ga0207686_10763703
401 Ga0207670_10636992
402 Ga0207669_10221431
403 Ga0207704_10922734
404 Ga0207665_10000913
405 Ga0207691_10115524
406 Ga0207711_10151452
407 Ga0207711_10441585
408 Ga0207679_10756871
409 Ga0207667_10715235
410 Ga0207668_10369563
411 Ga0207668_11403498
412 Ga0207640_10444925
413 Ga0207703_10613263
414 Ga0207639_10276341
415 Ga0207678_10125111
416 Ga0207708_11189715
417 Ga0207702_10394109
418 Ga0207641_10276717
419 Ga0207683_10273786
420 Ga0209588_1064957
421 Ga0268266_10061647
422 Ga0268266_10862598
423 Ga0307515_10494880
424 Ga0265340_10008947
425 Ga0265339_10096318
426 Ga0265316_10127533
427 Ga0307508_10026412
428 Ga0307405_10087782
429 Ga0307510_10007834
430 Ga0373930_0005846
431 Ga0373938_0077343
432 Ga0373936_0196654
433 Ga0373946_0030362
434 Ga0373931_0002773
435 Ga0373931_0230515
436 Ga0373935_0055204
437 Ga0373927_0011602
438 Ga0373927_0106329
439 Ga0373927_0196620
440 Ga0373947_0031471
441 Ga0373947_0556427
442 Ga0373947_0659142
443 Ga0373925_0289891
444 Ga0373925_0385436
445 Ga0395899_0015025
446 Ga0395899_0041913
447 Ga0395900_0037963
448 Ga0395898_0011930
449 Ga0395901_0000593
450 Ga0395901_0035828
451 Ga0436361_0385696
452 Ga0439465_0061652
453 Ga0439465_0063489
454 Ga0451843_0538096
455 Ga0439452_089082
456 Ga0495592_0034614
457 Ga0495603_0217068
458 Ga0495638_0278049
459 Ga0495651_0572494
460 Ga0495580_0177641
461 Ga0495582_0052731
462 Ga0495620_0243273
463 Ga0495644_0387121
464 Ga0495648_0397322
465 Ga0495665_0136944
466 Ga0495621_0062587
467 Ga0495621_0334540
468 Ga0495645_0015535
469 Ga0495625_0515892
470 Ga0495661_0284324
471 Ga0495599_0202564
472 Ga0495613_0044028
473 Ga0495613_0173806
474 Ga0495600_0167236
475 Ga0495600_0587132
476 Ga0495604_0661434
477 Ga0495680_0267058
478 Ga0495683_0250330
479 Ga0495673_0202187
480 Ga0495681_0251269
481 Ga0495684_0438273
482 Ga0495686_0081673
483 Ga0495626_0076650
484 Ga0496100_0132672
485 Ga0496100_0247752
486 Ga0496101_0055049
487 Ga0496101_0062517
488 Ga0496102_0033502
489 Ga0496102_0583112
490 Ga0496103_0012371
491 Ga0496103_0078249
492 Ga0496104_0004005
493 Ga0496104_0168942
494 Ga0496105_0032534
495 Ga0496105_0058243
496 Ga0496106_0025248
497 Ga0496106_0056750
498 Ga0496106_0438668
499 Ga0496107_0050672
500 Ga0496108_0006244
501 Ga0496108_0139404
502 Ga0496108_0586745
503 Ga0496109_0148486
504 Ga0496110_0084761
505 Ga0496110_0103159
506 Ga0496111_0103692
507 Ga0496112_0056895
508 Ga0496112_0150606
509 Ga0496113_0002928
510 Ga0496113_0034478
511 Ga0496114_0032370
512 Ga0496114_0056698
513 Ga0496114_0199508
514 Ga0496115_0012554
515 Ga0496115_0016822
516 Ga0496115_0041482
517 Ga0496117_0148036
518 Ga0496117_0194885
519 Ga0496118_0041522
520 Ga0496118_0247464
521 Ga0496119_0046387
522 Ga0496119_0201994
523 Ga0496119_0279932
524 Ga0496120_0190835
525 Ga0496121_0003208
526 Ga0496121_0020513
527 Ga0496121_0068153
528 Ga0496121_0377564
529 Ga0496125_0000048
530 Ga0496125_0003042
531 Ga0496126_0116305
532 Ga0496126_0264493
533 Ga0495682_0144008
534 Ga0501034_0001733
535 Ga0501034_0138275
536 Ga0501238_015029
537 Ga0501252_007159
538 Ga0501269_008103
539 nmdc:mga03683_14572_c1
540 nmdc:mga03683_165670_c1
541 nmdc:mga03n38_245120_c1
542 nmdc:mga0yw44_113534_c1
543 nmdc:mga0k408_245949_c1
544 nmdc:mga0k408_26303_c1
545 nmdc:mga0k408_310987_c1
546 nmdc:mga04h51_143909_c1
547 nmdc:mga07m45_308977_c1
548 nmdc:mga07m45_424367_c1
549 nmdc:mga07m45_46503_c1
550 nmdc:mga07m45_53390_c1
551 nmdc:mga0sz30_18876_c1
552 Ga0500578_0508837
553 Ga0500578_0545203
554 Ga0500583_0029854
555 Ga0500651_0005442
556 Ga0500651_0060224
557 Ga0500651_0189291
558 Ga0500594_0018602
559 Ga0500595_003386
560 Ga0500595_015514
561 Ga0500595_031603
562 Ga0500607_049980
563 Ga0500642_0003442
564 Ga0500577_0002414
565 Ga0500586_004932
566 Ga0500604_0045019
567 Ga0500616_0032792
568 Ga0500627_0007084
569 Ga0500627_0029254
570 Ga0500627_0262954
571 Ga0500638_194302
572 Ga0500636_0029007
573 Ga0500611_016443
574 Ga0500611_096522
575 Ga0500609_001614
576 2512964638
577 2512972203
578 2513603282
579 2802717775
580 2802723296
581 2802743531
582 2802750756
583 2921251036
584 2937029784
585 2937036810
586 2937082890
587 2937090506
588 2957438790
589 2960595655
590 2960696772
591 2967734652
592 2970144455
593 2977531981
594 8004000265

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

16

143

0.93

PF05163

DinB

DinB family

4

171

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qe9-assembly1.cif.gz_B crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution 0.8135 4 159
2qe9-assembly1.cif.gz_B crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution 0.7589 4 159
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.7455 10 156
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.7416 5 147
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.7413 8 158
ID Description Score Start End Superfamily
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8035 10 159 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7731 13 147 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7577 13 147 1.20.120.450
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7479 10 159 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7273 10 156 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A5J6MGT6-F1-model_v4 Damage-inducible protein DinB 0.9905 3 167
AF-A0A4R2YHX7-F1-model_v4 deleted 0.9901 3 164
AF-A0A503ASG0-F1-model_v4 Damage-inducible protein DinB 0.99 5 97
AF-A0A4Q0MKK2-F1-model_v4 Damage-inducible protein DinB 0.9878 7 169
AF-A0A380WPT6-F1-model_v4 DinB family 0.9834 3 164

Map