F393618

General Info

Members Datasets Scaffolds Average Seq Length
297 196 594 234

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100046879|Ga0068863_1000468792
Length 272
Sequence MRIGAALAGGPSTAFLLRTHSGRRGNLPALFLFCTLMQRQGMITVASYNIRKGLGTDRQRRPDRILEVLHELHADVIALQEADRRFGSRQSAIPAELIRQGEYRPVPFDIRPGGIGWHGNAILVRNPVDIRDFAPLQLPTLEPRGAVLAELHLGGRDLRVVGMHLDLSGLWRRRQVRAIIDQVRRRRKMPTVLMGDLNEWSLHGGCIRDFAADHHVAPTGRSYHSRRPVGCLDRIILTPDLHLVSCGVHASERARLASDHLPIWARLNWTNG

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
122 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
162 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
163 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
164 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
165 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
166 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
167 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
168 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
169 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
170 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
171 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
172 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
173 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
174 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
175 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
178 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
179 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
180 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
181 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
182 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
183 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
184 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
185 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
186 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
187 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
188 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
189 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
190 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
191 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
192 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
193 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
194 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
195 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
196 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.96
Metatranscriptomes 0
Isolates 4.04

Biome Distribution

Category Percentage (%)
Aerial Root 1.68
Bulb 0
Endosphere 13.47
Nodule 0
Rhizoplane 3.03
Rhizosphere 71.72
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100046879 3300005841 Bacteria 4102
2 JGI24741J21665_1001632 3300001915 Bacteria 6248
3 JGI24739J22299_10043843 3300001989 Bacteria 1477
4 JGI24737J22298_10001456 3300001990 Bacteria 8439
5 JGI24737J22298_10002234 3300001990 Bacteria 6905
6 JGI24749J21850_1000017 3300002076 Bacteria 32536
7 JGI24742J22300_10029868 3300002244 Bacteria 950
8 JGI24751J29686_10000309 3300002459 Bacteria 18389
9 JGI25153J46596_10000006 3300003215 Bacteria 447760
10 Ga0055525_1000051 3300003759 Bacteria 240942
11 Ga0055542_1000020 3300003762 Bacteria 335745
12 Ga0055529_1000016 3300003763 Bacteria 364775
13 Ga0065707_10087976 3300005295 Bacteria 4822
14 Ga0070658_10001831 3300005327 Bacteria 17897
15 Ga0070658_10207113 3300005327 Bacteria 1656
16 Ga0070670_100000033 3300005331 Bacteria 158509
17 Ga0070670_100483960 3300005331 Bacteria 1099
18 Ga0070666_10160485 3300005335 Bacteria 1571
19 Ga0070660_100048706 3300005339 Bacteria 3255
20 Ga0070660_100371749 3300005339 Bacteria 1179
21 Ga0070661_100007084 3300005344 Bacteria 7736
22 Ga0070668_100270247 3300005347 Bacteria 1417
23 Ga0070668_100644513 3300005347 Bacteria 930
24 Ga0070669_100000005 3300005353 Bacteria 309134
25 Ga0070674_100000284 3300005356 Bacteria 24799
26 Ga0070674_100029988 3300005356 Bacteria 3591
27 Ga0070673_100207591 3300005364 Bacteria 1690
28 Ga0070659_100024137 3300005366 Bacteria 4660
29 Ga0070667_100000197 3300005367 Bacteria 71585
30 Ga0070667_100486734 3300005367 Bacteria 1130
31 Ga0070678_100000043 3300005456 Bacteria 43023
32 Ga0070678_100166329 3300005456 Bacteria 1792
33 Ga0070662_100172211 3300005457 Bacteria 1701
34 Ga0070662_100761588 3300005457 Bacteria 821
35 Ga0070681_10506866 3300005458 Bacteria 1120
36 Ga0068867_100214860 3300005459 Bacteria 1547
37 Ga0070672_100130544 3300005543 Bacteria 2064
38 Ga0070686_100160392 3300005544 Bacteria 1583
39 Ga0070665_100000535 3300005548 Bacteria 53560
40 Ga0068855_100018849 3300005563 Bacteria 8295
41 Ga0068855_100230255 3300005563 Bacteria 2075
42 Ga0068855_100543694 3300005563 Bacteria 1258
43 Ga0070664_100052795 3300005564 Bacteria 3444
44 Ga0068857_100267795 3300005577 Bacteria 1570
45 Ga0068859_100001647 3300005617 Bacteria 22792
46 Ga0068859_100020730 3300005617 Bacteria 6596
47 Ga0068859_100895222 3300005617 Bacteria 972
48 Ga0068864_100000042 3300005618 Bacteria 162930
49 Ga0068863_100015132 3300005841 Bacteria 7410
50 Ga0068863_100067994 3300005841 Bacteria 3370
51 Ga0068860_100000290 3300005843 Bacteria 71562
52 Ga0068860_100011754 3300005843 Bacteria 8627
53 Ga0068862_100000005 3300005844 Bacteria 350713
54 Ga0068862_100000347 3300005844 Bacteria 50091
55 Ga0068862_100985563 3300005844 Bacteria 833
56 Ga0075366_10055768 3300006195 Bacteria 2347
57 Ga0075366_10085744 3300006195 Bacteria 1884
58 Ga0097620_100001647 3300006931 Bacteria 22792
59 Ga0097620_100020730 3300006931 Bacteria 6596
60 Ga0097620_100895495 3300006931 Bacteria 972
61 Ga0105240_10011587 3300009093 Bacteria 12269
62 Ga0105240_10042111 3300009093 Bacteria 5822
63 Ga0105240_10164016 3300009093 Bacteria 2637
64 Ga0105240_11085068 3300009093 Bacteria 852
65 Ga0105245_10183527 3300009098 Bacteria 2000
66 Ga0105247_10020391 3300009101 Bacteria 3985
67 Ga0105243_10000038 3300009148 Bacteria 174351
68 Ga0105241_10002622 3300009174 Bacteria 13468
69 Ga0105248_10000171 3300009177 Bacteria 75565
70 Ga0105248_10015332 3300009177 Bacteria 8451
71 Ga0105248_10090762 3300009177 Bacteria 3440
72 Ga0105237_10003390 3300009545 Bacteria 18951
73 Ga0105237_10678046 3300009545 Bacteria 1037
74 Ga0105238_10185220 3300009551 Bacteria 2058
75 Ga0105249_10000072 3300009553 Bacteria 146435
76 Ga0105249_10396807 3300009553 Bacteria 1409
77 Ga0105239_10000061 3300010375 Bacteria 154661
78 Ga0157326_1002868 3300012513 Bacteria 1819
79 Ga0157373_10025781 3300013100 Bacteria 4250
80 Ga0157371_10000316 3300013102 Bacteria 62749
81 Ga0157370_10457527 3300013104 Bacteria 1173
82 Ga0157372_10181484 3300013307 Bacteria 2436
83 Ga0157380_10000030 3300014326 Bacteria 91258
84 Ga0157380_10301717 3300014326 Bacteria 1476
85 Ga0213875_10000166 3300021388 Bacteria 68786
86 Ga0209563_100019 3300025230 Bacteria 697828
87 Ga0209148_1000017 3300025254 Bacteria 787064
88 Ga0209455_1000005 3300025272 Bacteria 1416756
89 Ga0209758_1000001 3300025297 Bacteria 1981790
90 Ga0207710_10009925 3300025900 Bacteria 4003
91 Ga0207710_10344269 3300025900 Bacteria 758
92 Ga0207688_10107648 3300025901 Bacteria 1616
93 Ga0207705_10001336 3300025909 Bacteria 19754
94 Ga0207705_10180595 3300025909 Bacteria 1592
95 Ga0207695_10018558 3300025913 Bacteria 8037
96 Ga0207695_10081878 3300025913 Bacteria 3266
97 Ga0207671_10003775 3300025914 Bacteria 14885
98 Ga0207671_10014552 3300025914 Bacteria 6210
99 Ga0207693_10088297 3300025915 Bacteria 2430
100 Ga0207657_10013650 3300025919 Bacteria 7962
101 Ga0207649_10002539 3300025920 Bacteria 10163
102 Ga0207681_10000003 3300025923 Bacteria 713245
103 Ga0207694_10099833 3300025924 Bacteria 2299
104 Ga0207650_10000012 3300025925 Bacteria 437889
105 Ga0207690_10002550 3300025932 Bacteria 11008
106 Ga0207690_10153106 3300025932 Bacteria 1711
107 Ga0207706_10027873 3300025933 Bacteria 5049
108 Ga0207706_10436267 3300025933 Bacteria 1134
109 Ga0207709_10000031 3300025935 Bacteria 329046
110 Ga0207669_10000079 3300025937 Bacteria 49257
111 Ga0207669_10003256 3300025937 Bacteria 7020
112 Ga0207691_10272930 3300025940 Bacteria 1456
113 Ga0207711_10004761 3300025941 Bacteria 11518
114 Ga0207711_10016961 3300025941 Bacteria 6049
115 Ga0207711_10034488 3300025941 Bacteria 4286
116 Ga0207667_10000004 3300025949 Bacteria 737718
117 Ga0207667_10005797 3300025949 Bacteria 15070
118 Ga0207667_10771596 3300025949 Bacteria 960
119 Ga0207712_10000055 3300025961 Bacteria 146438
120 Ga0207668_10049606 3300025972 Bacteria 2887
121 Ga0207640_10002037 3300025981 Bacteria 10930
122 Ga0207658_10000157 3300025986 Bacteria 71628
123 Ga0207658_10001790 3300025986 Bacteria 16096
124 Ga0207639_10001442 3300026041 Bacteria 16018
125 Ga0207639_10154144 3300026041 Bacteria 1928
126 Ga0207678_10200926 3300026067 Bacteria 1704
127 Ga0207702_10059468 3300026078 Bacteria 3255
128 Ga0207702_10101989 3300026078 Bacteria 2535
129 Ga0207641_10001560 3300026088 Bacteria 22444
130 Ga0207641_10012939 3300026088 Bacteria 6846
131 Ga0207648_10058996 3300026089 Bacteria 3347
132 Ga0207676_10000009 3300026095 Bacteria 545256
133 Ga0207675_100000053 3300026118 Bacteria 82907
134 Ga0207683_10000418 3300026121 Bacteria 39246
135 Ga0207683_10212996 3300026121 Bacteria 1759
136 Ga0207698_10004764 3300026142 Bacteria 8301
137 Ga0268266_10000002 3300028379 Bacteria 3059047
138 Ga0268266_10421395 3300028379 Bacteria 1265
139 Ga0268265_10000001 3300028380 Bacteria 1230727
140 Ga0268265_10000295 3300028380 Bacteria 56143
141 Ga0268264_10000274 3300028381 Bacteria 89144
142 Ga0307517_10033528 3300028786 Bacteria 5893
143 Ga0307517_10048758 3300028786 Bacteria 4350
144 Ga0307513_10016673 3300031456 Bacteria 8845
145 Ga0307513_10124582 3300031456 Bacteria 2536
146 Ga0307412_10026113 3300031911 Bacteria 3627
147 Ga0307412_10074333 3300031911 Bacteria 2328
148 Ga0307409_100102416 3300031995 Bacteria 2379
149 Ga0307414_10086203 3300032004 Bacteria 2316
150 Ga0307414_10433129 3300032004 Bacteria 1149
151 Ga0307411_10140757 3300032005 Bacteria 1779
152 Ga0307510_10100364 3300033180 Bacteria 2688
153 Ga0373943_0148568 3300035170 Bacteria 1268
154 Ga0395900_0013628 3300037418 Bacteria 8301
155 Ga0395900_0108977 3300037418 Bacteria 2845
156 Ga0395900_0115425 3300037418 Bacteria 2755
157 Ga0395898_0078770 3300037466 Bacteria 3179
158 Ga0395898_0101746 3300037466 Bacteria 2759
159 Ga0395905_0001943 3300037471 Bacteria 23692
160 Ga0395905_0012740 3300037471 Bacteria 8088
161 Ga0395905_0014169 3300037471 Bacteria 7619
162 Ga0395905_0030743 3300037471 Bacteria 5057
163 Ga0395905_0564651 3300037471 Bacteria 1039
164 Ga0436364_0545952 3300037853 Bacteria 79385
165 Ga0395901_0006202 3300038443 Bacteria 12114
166 Ga0395901_0032044 3300038443 Bacteria 5423
167 Ga0395901_0037950 3300038443 Bacteria 4982
168 Ga0395901_0043532 3300038443 Bacteria 4657
169 Ga0395901_0151639 3300038443 Bacteria 2436
170 Ga0436365_1744454 3300039437 Bacteria 907
171 Ga0451839_0908353 3300041496 Bacteria 993
172 Ga0466966_0098411 3300044684 Bacteria 1811
173 Ga0466961_0131194 3300044693 Bacteria 1570
174 Ga0495638_0009442 3300046460 Bacteria 6846
175 Ga0495650_0000370 3300046471 Bacteria 78408
176 Ga0495584_0053947 3300046491 Bacteria 2023
177 Ga0495584_0077880 3300046491 Bacteria 1668
178 Ga0495585_0013651 3300046492 Bacteria 4750
179 Ga0495583_0000342 3300046506 Bacteria 73457
180 Ga0495583_0000599 3300046506 Bacteria 49004
181 Ga0495583_0007821 3300046506 Bacteria 6641
182 Ga0495583_0046371 3300046506 Bacteria 2004
183 Ga0495583_0069703 3300046506 Bacteria 1548
184 Ga0495606_0000486 3300046507 Bacteria 64993
185 Ga0495606_0001390 3300046507 Bacteria 32713
186 Ga0495606_0045617 3300046507 Bacteria 2903
187 Ga0495631_0012845 3300046518 Bacteria 4078
188 Ga0495643_0001143 3300046522 Bacteria 26034
189 Ga0495643_0002456 3300046522 Bacteria 14664
190 Ga0495643_0053133 3300046522 Bacteria 2173
191 Ga0495643_0093189 3300046522 Bacteria 1551
192 Ga0495648_0000430 3300046524 Bacteria 45832
193 Ga0495663_0042506 3300046525 Bacteria 1385
194 Ga0495642_0004826 3300046528 Bacteria 5210
195 Ga0495642_0218504 3300046528 Bacteria 832
196 Ga0495633_0005491 3300046558 Bacteria 7720
197 Ga0495633_0014185 3300046558 Bacteria 4176
198 Ga0495668_0000007 3300046616 Bacteria 552902
199 Ga0495668_0065525 3300046616 Bacteria 1999
200 Ga0495611_0128055 3300046648 Bacteria 1184
201 Ga0495625_0000167 3300046660 Bacteria 102783
202 Ga0495625_0090431 3300046660 Bacteria 2117
203 Ga0495625_0112127 3300046660 Bacteria 1863
204 Ga0495625_0295673 3300046660 Bacteria 1037
205 Ga0495669_0000220 3300046684 Bacteria 34224
206 Ga0495669_0051567 3300046684 Bacteria 1847
207 Ga0495670_0025463 3300046691 Bacteria 2927
208 Ga0495670_0087952 3300046691 Bacteria 1588
209 Ga0495600_0000810 3300046809 Bacteria 16604
210 Ga0495660_0143828 3300046810 Bacteria 1184
211 Ga0495676_0391239 3300047321 Bacteria 924
212 Ga0495683_0010954 3300047323 Bacteria 4783
213 Ga0495683_0022258 3300047323 Bacteria 3259
214 Ga0495687_000045 3300047443 Bacteria 211968
215 Ga0495687_000211 3300047443 Bacteria 83788
216 Ga0495677_0006941 3300047445 Bacteria 4253
217 Ga0495681_0006506 3300047470 Bacteria 7665
218 Ga0495681_0045491 3300047470 Bacteria 2100
219 Ga0495686_0000103 3300047472 Bacteria 176842
220 Ga0495686_0000120 3300047472 Bacteria 164638
221 Ga0495686_0000371 3300047472 Bacteria 72714
222 Ga0495686_0002929 3300047472 Bacteria 15294
223 Ga0495615_0025744 3300048090 Bacteria 1368
224 Ga0496102_0001508 3300048905 Bacteria 20566
225 Ga0496103_0000444 3300048906 Bacteria 35622
226 Ga0496105_0001368 3300048908 Bacteria 17163
227 Ga0496109_0607115 3300048912 Bacteria 1030
228 Ga0496110_0023022 3300048913 Bacteria 5297
229 Ga0496112_0562675 3300048915 Bacteria 1074
230 Ga0496114_0019595 3300048917 Bacteria 5482
231 Ga0496115_0001329 3300048918 Bacteria 17630
232 Ga0496116_0005155 3300048919 Bacteria 12270
233 Ga0496117_0000424 3300048920 Bacteria 71078
234 Ga0496117_0110523 3300048920 Bacteria 1713
235 Ga0496118_0001459 3300048921 Bacteria 35548
236 Ga0496118_0123936 3300048921 Bacteria 1677
237 Ga0496119_0015178 3300048922 Bacteria 5960
238 Ga0496119_0022774 3300048922 Bacteria 4470
239 Ga0496120_0014446 3300048923 Bacteria 5261
240 Ga0496120_0230592 3300048923 Unclassified 880
241 Ga0496121_0000173 3300048924 Bacteria 143397
242 Ga0496121_0000176 3300048924 Bacteria 142585
243 Ga0496121_0000597 3300048924 Bacteria 67845
244 Ga0496121_0005170 3300048924 Bacteria 16930
245 Ga0496124_0000082 3300048927 Bacteria 208248
246 Ga0496125_0002086 3300048928 Bacteria 26931
247 Ga0496125_0014775 3300048928 Bacteria 7584
248 Ga0496126_0002406 3300048929 Bacteria 25404
249 Ga0496126_0017895 3300048929 Bacteria 7051
250 Ga0496126_0295376 3300048929 Bacteria 1339
251 Ga0501032_0063339 3300049569 Bacteria 2476
252 Ga0501033_0097242 3300049570 Bacteria 2151
253 Ga0501043_0088886 3300049579 Bacteria 2428
254 Ga0501047_0000746 3300049581 Bacteria 33915
255 Ga0501044_0174921 3300049823 Bacteria 2116
256 nmdc:mga0k408_6971_c1 3300050493 Bacteria 6028
257 Ga0500610_0000323 3300053079 Bacteria 14391
258 Ga0500643_010267 3300053087 Bacteria 3499
259 Ga0500643_025607 3300053087 Bacteria 1858
260 Ga0500647_0033439 3300053091 Bacteria 2452
261 Ga0500583_0133265 3300053092 Bacteria 1233
262 Ga0500651_0003298 3300053093 Bacteria 8789
263 Ga0500566_0101102 3300053094 Bacteria 1580
264 Ga0500555_000276 3300053103 Bacteria 22233
265 Ga0500556_0016263 3300053104 Bacteria 2311
266 Ga0500562_025952 3300053108 Bacteria 1535
267 Ga0500595_003686 3300053119 Bacteria 7076
268 Ga0500614_002391 3300053123 Bacteria 4195
269 Ga0500618_003722 3300053125 Bacteria 5115
270 Ga0500618_008251 3300053125 Bacteria 2922
271 Ga0500642_0000539 3300053130 Bacteria 11491
272 Ga0500642_0001064 3300053130 Bacteria 7920
273 Ga0500655_000089 3300053133 Bacteria 24204
274 Ga0500559_0280112 3300053136 Bacteria 784
275 Ga0500616_0007338 3300053153 Bacteria 7027
276 Ga0500619_019747 3300053154 Bacteria 1914
277 Ga0500624_000208 3300053157 Bacteria 22150
278 Ga0500639_038947 3300053163 Bacteria 2504
279 Ga0500636_0020324 3300053177 Bacteria 3932
280 Ga0500636_0024145 3300053177 Bacteria 3593
281 Ga0500637_0016240 3300053178 Bacteria 3965
282 Ga0500570_000072 3300053724 Bacteria 26562
283 Ga0500645_000011 3300053730 Bacteria 169616
284 Ga0500645_001039 3300053730 Bacteria 15509
285 Ga0500596_000137 3300053735 Bacteria 10887
286 2585264132 2582581305 Bacteria 4895574
287 2600202592 2599185354 Bacteria 4398675
288 2644040545 2643221605 Bacteria 4772303
289 2830076730 2830075706 Bacteria 3855215
290 2840882636 2840878972 Bacteria 5483153
291 2928027385 2928027323 Bacteria 4382488
292 2984558313 2984555340 Bacteria 4247089
293 2984567307 2984564862 Bacteria 4339992
294 2990269175 2990265787 Bacteria 3943888
295 2993358373 2993356040 Bacteria 4247105
296 2993694880 2993693658 Bacteria 4040749
297 8057103460 8057101203 Bacteria 5034064
298 Ga0068863_100046879
299 JGI24741J21665_1001632
300 JGI24739J22299_10043843
301 JGI24737J22298_10001456
302 JGI24737J22298_10002234
303 JGI24749J21850_1000017
304 JGI24742J22300_10029868
305 JGI24751J29686_10000309
306 JGI25153J46596_10000006
307 Ga0055525_1000051
308 Ga0055542_1000020
309 Ga0055529_1000016
310 Ga0065707_10087976
311 Ga0070658_10001831
312 Ga0070658_10207113
313 Ga0070670_100000033
314 Ga0070670_100483960
315 Ga0070666_10160485
316 Ga0070660_100048706
317 Ga0070660_100371749
318 Ga0070661_100007084
319 Ga0070668_100270247
320 Ga0070668_100644513
321 Ga0070669_100000005
322 Ga0070674_100000284
323 Ga0070674_100029988
324 Ga0070673_100207591
325 Ga0070659_100024137
326 Ga0070667_100000197
327 Ga0070667_100486734
328 Ga0070678_100000043
329 Ga0070678_100166329
330 Ga0070662_100172211
331 Ga0070662_100761588
332 Ga0070681_10506866
333 Ga0068867_100214860
334 Ga0070672_100130544
335 Ga0070686_100160392
336 Ga0070665_100000535
337 Ga0068855_100018849
338 Ga0068855_100230255
339 Ga0068855_100543694
340 Ga0070664_100052795
341 Ga0068857_100267795
342 Ga0068859_100001647
343 Ga0068859_100020730
344 Ga0068859_100895222
345 Ga0068864_100000042
346 Ga0068863_100015132
347 Ga0068863_100067994
348 Ga0068860_100000290
349 Ga0068860_100011754
350 Ga0068862_100000005
351 Ga0068862_100000347
352 Ga0068862_100985563
353 Ga0075366_10055768
354 Ga0075366_10085744
355 Ga0097620_100001647
356 Ga0097620_100020730
357 Ga0097620_100895495
358 Ga0105240_10011587
359 Ga0105240_10042111
360 Ga0105240_10164016
361 Ga0105240_11085068
362 Ga0105245_10183527
363 Ga0105247_10020391
364 Ga0105243_10000038
365 Ga0105241_10002622
366 Ga0105248_10000171
367 Ga0105248_10015332
368 Ga0105248_10090762
369 Ga0105237_10003390
370 Ga0105237_10678046
371 Ga0105238_10185220
372 Ga0105249_10000072
373 Ga0105249_10396807
374 Ga0105239_10000061
375 Ga0157326_1002868
376 Ga0157373_10025781
377 Ga0157371_10000316
378 Ga0157370_10457527
379 Ga0157372_10181484
380 Ga0157380_10000030
381 Ga0157380_10301717
382 Ga0213875_10000166
383 Ga0209563_100019
384 Ga0209148_1000017
385 Ga0209455_1000005
386 Ga0209758_1000001
387 Ga0207710_10009925
388 Ga0207710_10344269
389 Ga0207688_10107648
390 Ga0207705_10001336
391 Ga0207705_10180595
392 Ga0207695_10018558
393 Ga0207695_10081878
394 Ga0207671_10003775
395 Ga0207671_10014552
396 Ga0207693_10088297
397 Ga0207657_10013650
398 Ga0207649_10002539
399 Ga0207681_10000003
400 Ga0207694_10099833
401 Ga0207650_10000012
402 Ga0207690_10002550
403 Ga0207690_10153106
404 Ga0207706_10027873
405 Ga0207706_10436267
406 Ga0207709_10000031
407 Ga0207669_10000079
408 Ga0207669_10003256
409 Ga0207691_10272930
410 Ga0207711_10004761
411 Ga0207711_10016961
412 Ga0207711_10034488
413 Ga0207667_10000004
414 Ga0207667_10005797
415 Ga0207667_10771596
416 Ga0207712_10000055
417 Ga0207668_10049606
418 Ga0207640_10002037
419 Ga0207658_10000157
420 Ga0207658_10001790
421 Ga0207639_10001442
422 Ga0207639_10154144
423 Ga0207678_10200926
424 Ga0207702_10059468
425 Ga0207702_10101989
426 Ga0207641_10001560
427 Ga0207641_10012939
428 Ga0207648_10058996
429 Ga0207676_10000009
430 Ga0207675_100000053
431 Ga0207683_10000418
432 Ga0207683_10212996
433 Ga0207698_10004764
434 Ga0268266_10000002
435 Ga0268266_10421395
436 Ga0268265_10000001
437 Ga0268265_10000295
438 Ga0268264_10000274
439 Ga0307517_10033528
440 Ga0307517_10048758
441 Ga0307513_10016673
442 Ga0307513_10124582
443 Ga0307412_10026113
444 Ga0307412_10074333
445 Ga0307409_100102416
446 Ga0307414_10086203
447 Ga0307414_10433129
448 Ga0307411_10140757
449 Ga0307510_10100364
450 Ga0373943_0148568
451 Ga0395900_0013628
452 Ga0395900_0108977
453 Ga0395900_0115425
454 Ga0395898_0078770
455 Ga0395898_0101746
456 Ga0395905_0001943
457 Ga0395905_0012740
458 Ga0395905_0014169
459 Ga0395905_0030743
460 Ga0395905_0564651
461 Ga0436364_0545952
462 Ga0395901_0006202
463 Ga0395901_0032044
464 Ga0395901_0037950
465 Ga0395901_0043532
466 Ga0395901_0151639
467 Ga0436365_1744454
468 Ga0451839_0908353
469 Ga0466966_0098411
470 Ga0466961_0131194
471 Ga0495638_0009442
472 Ga0495650_0000370
473 Ga0495584_0053947
474 Ga0495584_0077880
475 Ga0495585_0013651
476 Ga0495583_0000342
477 Ga0495583_0000599
478 Ga0495583_0007821
479 Ga0495583_0046371
480 Ga0495583_0069703
481 Ga0495606_0000486
482 Ga0495606_0001390
483 Ga0495606_0045617
484 Ga0495631_0012845
485 Ga0495643_0001143
486 Ga0495643_0002456
487 Ga0495643_0053133
488 Ga0495643_0093189
489 Ga0495648_0000430
490 Ga0495663_0042506
491 Ga0495642_0004826
492 Ga0495642_0218504
493 Ga0495633_0005491
494 Ga0495633_0014185
495 Ga0495668_0000007
496 Ga0495668_0065525
497 Ga0495611_0128055
498 Ga0495625_0000167
499 Ga0495625_0090431
500 Ga0495625_0112127
501 Ga0495625_0295673
502 Ga0495669_0000220
503 Ga0495669_0051567
504 Ga0495670_0025463
505 Ga0495670_0087952
506 Ga0495600_0000810
507 Ga0495660_0143828
508 Ga0495676_0391239
509 Ga0495683_0010954
510 Ga0495683_0022258
511 Ga0495687_000045
512 Ga0495687_000211
513 Ga0495677_0006941
514 Ga0495681_0006506
515 Ga0495681_0045491
516 Ga0495686_0000103
517 Ga0495686_0000120
518 Ga0495686_0000371
519 Ga0495686_0002929
520 Ga0495615_0025744
521 Ga0496102_0001508
522 Ga0496103_0000444
523 Ga0496105_0001368
524 Ga0496109_0607115
525 Ga0496110_0023022
526 Ga0496112_0562675
527 Ga0496114_0019595
528 Ga0496115_0001329
529 Ga0496116_0005155
530 Ga0496117_0000424
531 Ga0496117_0110523
532 Ga0496118_0001459
533 Ga0496118_0123936
534 Ga0496119_0015178
535 Ga0496119_0022774
536 Ga0496120_0014446
537 Ga0496120_0230592
538 Ga0496121_0000173
539 Ga0496121_0000176
540 Ga0496121_0000597
541 Ga0496121_0005170
542 Ga0496124_0000082
543 Ga0496125_0002086
544 Ga0496125_0014775
545 Ga0496126_0002406
546 Ga0496126_0017895
547 Ga0496126_0295376
548 Ga0501032_0063339
549 Ga0501033_0097242
550 Ga0501043_0088886
551 Ga0501047_0000746
552 Ga0501044_0174921
553 nmdc:mga0k408_6971_c1
554 Ga0500610_0000323
555 Ga0500643_010267
556 Ga0500643_025607
557 Ga0500647_0033439
558 Ga0500583_0133265
559 Ga0500651_0003298
560 Ga0500566_0101102
561 Ga0500555_000276
562 Ga0500556_0016263
563 Ga0500562_025952
564 Ga0500595_003686
565 Ga0500614_002391
566 Ga0500618_003722
567 Ga0500618_008251
568 Ga0500642_0000539
569 Ga0500642_0001064
570 Ga0500655_000089
571 Ga0500559_0280112
572 Ga0500616_0007338
573 Ga0500619_019747
574 Ga0500624_000208
575 Ga0500639_038947
576 Ga0500636_0020324
577 Ga0500636_0024145
578 Ga0500637_0016240
579 Ga0500570_000072
580 Ga0500645_000011
581 Ga0500645_001039
582 Ga0500596_000137
583 2585264132
584 2600202592
585 2644040545
586 2830076730
587 2840882636
588 2928027385
589 2984558313
590 2984567307
591 2990269175
592 2993358373
593 2993694880
594 8057103460

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

46

260

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g6s-assembly1.cif.gz_A crystal structure of the endonuclease/exonuclease/phosphatase (bvu_0621) from bacteroides vulgatus. northeast structural genomics consortium target bvr56d 0.8184 2 231
3g6s-assembly1.cif.gz_A crystal structure of the endonuclease/exonuclease/phosphatase (bvu_0621) from bacteroides vulgatus. northeast structural genomics consortium target bvr56d 0.8119 2 231
3mpr-assembly2.cif.gz_C crystal structure of endonuclease/exonuclease/phosphatase family protein from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr318a 0.8046 2 228
3l1w-assembly2.cif.gz_D the crystal structure of a functionally unknown conserved protein from enterococcus faecalis v583 0.8019 2 231
3l1w-assembly2.cif.gz_D the crystal structure of a functionally unknown conserved protein from enterococcus faecalis v583 0.7956 2 231
ID Description Score Start End Superfamily
af_I1JGP9_3_300_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8098 2 231 3.60.10.10
af_Q9HDZ2_710_875_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8065 7 160 3.60.10.10
af_I1JGP9_3_300_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8034 2 231 3.60.10.10
3l1wA00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.7923 4 231 3.60.10.10
3g6sA00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.7882 2 231 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A520HMX9-F1-model_v4 Endonuclease 0.9872 103 231 GO:0004519
AF-A0A840ZCU1-F1-model_v4 Endonuclease/exonuclease/phosphatase family metal-dependent hydrolase 0.9868 2 231 GO:0004519
GO:0004527
GO:0006506
GO:0016020
AF-A0A494TNB1-F1-model_v4 Endonuclease 0.9851 1 231 GO:0004519
GO:0006506
GO:0016020
AF-A0A4Q3BXR2-F1-model_v4 Endonuclease 0.9846 84 231 GO:0004519
AF-A0A4Y8ZM72-F1-model_v4 Endonuclease 0.9835 1 231 GO:0004519
GO:0006506
GO:0016020

Map