F393434

General Info

Members Datasets Scaffolds Average Seq Length
296 220 290 141

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_663016_c1|nmdc:mga08y16_663016_c1_551_1027
Length 158
Sequence MEKTAAPERRSVHPMMRIANAQLWVHDQDEALAFYTDKLGFEVRSDVTLPEMGDFRWLTVGPPGQEDFAVVLMAIPGAPVMDEGTGNEVRNLMSKGFAGTVFLTTDDVRGDFEELKGRGVEFTEEPEERPYGIDCGLRDPSGNSLRLTQVNEAVVNQS

Samples

Sample ID Description Type Environment
1 2643221548 Streptomyces sp. Root55 Isolate Unclassified
2 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
3 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
4 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
5 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
120 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
121 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
122 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
126 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
149 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
150 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
151 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
152 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
184 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
215 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
216 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
217 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
218 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0
Isolates 2.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.7
Nodule 0
Rhizoplane 5.74
Rhizosphere 85.14
Stem 0
Stem Tuber 0
Unclassified 6.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10124678 3300005328 Bacteria 1621
2 Ga0070683_100115905 3300005329 Bacteria 2529
3 Ga0070670_101638064 3300005331 Bacteria 592
4 Ga0070677_10132333 3300005333 Bacteria 1140
5 Ga0068868_100001849 3300005338 Bacteria 14535
6 Ga0068868_100007751 3300005338 Bacteria 7662
7 Ga0070689_100060897 3300005340 Bacteria 2935
8 Ga0070691_10020541 3300005341 Bacteria 3052
9 Ga0070691_10270563 3300005341 Bacteria 918
10 Ga0070691_10303485 3300005341 Bacteria 873
11 Ga0070661_100000035 3300005344 Bacteria 111363
12 Ga0070692_10433044 3300005345 Bacteria 838
13 Ga0070668_100016437 3300005347 Bacteria 5532
14 Ga0070668_101679106 3300005347 Bacteria 583
15 Ga0070669_100004289 3300005353 Bacteria 10305
16 Ga0070669_100650177 3300005353 Bacteria 887
17 Ga0070675_100380638 3300005354 Bacteria 1256
18 Ga0070673_100603753 3300005364 Bacteria 1001
19 Ga0070688_100003140 3300005365 Bacteria 8452
20 Ga0070710_10743193 3300005437 Bacteria 696
21 Ga0070701_10142059 3300005438 Bacteria 1374
22 Ga0070700_100000242 3300005441 Bacteria 30095
23 Ga0070700_100053543 3300005441 Bacteria 2519
24 Ga0070708_100291045 3300005445 Bacteria 1538
25 Ga0070663_100004912 3300005455 Bacteria 7893
26 Ga0070678_101087327 3300005456 Bacteria 738
27 Ga0070662_100011404 3300005457 Bacteria 5866
28 Ga0070662_100321805 3300005457 Bacteria 1261
29 Ga0070681_10671151 3300005458 Bacteria 952
30 Ga0070685_10003100 3300005466 Bacteria 8452
31 Ga0070685_10680622 3300005466 Bacteria 748
32 Ga0070707_100364470 3300005468 Bacteria 1404
33 Ga0070672_100434163 3300005543 Bacteria 1129
34 Ga0070695_100207550 3300005545 Bacteria 1404
35 Ga0070695_100459703 3300005545 Bacteria 977
36 Ga0070695_101224959 3300005545 Bacteria 618
37 Ga0070696_100028921 3300005546 Bacteria 3783
38 Ga0070704_100015676 3300005549 Bacteria 4769
39 Ga0070664_100002440 3300005564 Bacteria 14957
40 Ga0068856_100054355 3300005614 Bacteria 3949
41 Ga0070702_100030697 3300005615 Bacteria 2932
42 Ga0068852_100401223 3300005616 Bacteria 1349
43 Ga0068859_100691194 3300005617 Bacteria 1111
44 Ga0068859_102663513 3300005617 Bacteria 550
45 Ga0068864_100082861 3300005618 Bacteria 2815
46 Ga0068866_10105375 3300005718 Bacteria 1563
47 Ga0068861_101124759 3300005719 Bacteria 756
48 Ga0068863_100323168 3300005841 Bacteria 1499
49 Ga0068862_100179576 3300005844 Bacteria 1899
50 Ga0068862_100372921 3300005844 Bacteria 1329
51 Ga0081455_10026157 3300005937 Bacteria 5375
52 Ga0081539_10083904 3300005985 Bacteria 1667
53 Ga0070717_10000006 3300006028 Bacteria 353403
54 Ga0070716_100063454 3300006173 Bacteria 2145
55 Ga0070712_100016637 3300006175 Bacteria 4751
56 Ga0097621_101018948 3300006237 Bacteria 775
57 Ga0075428_100089124 3300006844 Bacteria 3365
58 Ga0075428_100474202 3300006844 Bacteria 1339
59 Ga0075431_100647024 3300006847 Bacteria 1038
60 Ga0075433_10014092 3300006852 Bacteria 6518
61 Ga0075434_100041109 3300006871 Bacteria 4579
62 Ga0075436_100133763 3300006914 Bacteria 1740
63 Ga0097620_100691346 3300006931 Bacteria 1111
64 Ga0097620_102663656 3300006931 Bacteria 550
65 Ga0075435_100002406 3300007076 Bacteria 12411
66 Ga0105251_10166148 3300009011 Bacteria 994
67 Ga0105240_10900892 3300009093 Bacteria 951
68 Ga0105240_12274483 3300009093 Bacteria 562
69 Ga0111539_10077436 3300009094 Bacteria 3914
70 Ga0111539_10894658 3300009094 Bacteria 1033
71 Ga0105245_10002391 3300009098 Bacteria 16968
72 Ga0105245_10009793 3300009098 Bacteria 8349
73 Ga0114129_10080570 3300009147 Bacteria 4525
74 Ga0114129_10243279 3300009147 Bacteria 2418
75 Ga0114129_10522098 3300009147 Bacteria 1548
76 Ga0114129_10972350 3300009147 Bacteria 1071
77 Ga0114129_12138866 3300009147 Bacteria 674
78 Ga0114129_12193837 3300009147 Bacteria 665
79 Ga0105243_10013177 3300009148 Bacteria 6251
80 Ga0105243_11075356 3300009148 Bacteria 811
81 Ga0105242_10501337 3300009176 Bacteria 1155
82 Ga0105248_10176577 3300009177 Bacteria 2407
83 Ga0105249_10010140 3300009553 Bacteria 8272
84 Ga0105249_10225575 3300009553 Bacteria 1846
85 Ga0105249_10547009 3300009553 Bacteria 1208
86 Ga0105249_11311482 3300009553 Bacteria 795
87 Ga0105249_12736043 3300009553 Bacteria 565
88 Ga0105239_10135433 3300010375 Bacteria 2742
89 Ga0105239_10189957 3300010375 Bacteria 2299
90 Ga0105239_12411511 3300010375 Bacteria 613
91 Ga0157371_10110631 3300013102 Bacteria 1950
92 Ga0157369_10389298 3300013105 Bacteria 1446
93 Ga0157374_10127716 3300013296 Bacteria 2458
94 Ga0157378_10641951 3300013297 Bacteria 1076
95 Ga0163162_10137594 3300013306 Bacteria 2554
96 Ga0157372_10029069 3300013307 Bacteria 6031
97 Ga0157375_10022914 3300013308 Bacteria 5755
98 Ga0157380_10000929 3300014326 Bacteria 18482
99 Ga0157379_10614371 3300014968 Bacteria 1015
100 Ga0163161_10000027 3300017792 Bacteria 197774
101 Ga0163161_10060470 3300017792 Bacteria 2757
102 Ga0213876_10055594 3300021384 Bacteria 2090
103 Ga0207426_1051090 3300025302 Bacteria 1229
104 Ga0207692_10000004 3300025898 Bacteria 413600
105 Ga0207692_10201986 3300025898 Bacteria 1169
106 Ga0207688_10005962 3300025901 Bacteria 6631
107 Ga0207688_10103695 3300025901 Bacteria 1645
108 Ga0207647_10292526 3300025904 Bacteria 928
109 Ga0207705_10836721 3300025909 Bacteria 714
110 Ga0207654_11244235 3300025911 Bacteria 543
111 Ga0207707_10494251 3300025912 Bacteria 1044
112 Ga0207693_10074943 3300025915 Bacteria 2650
113 Ga0207660_10591413 3300025917 Bacteria 904
114 Ga0207649_10000028 3300025920 Bacteria 161482
115 Ga0207652_10632854 3300025921 Bacteria 957
116 Ga0207646_10242629 3300025922 Bacteria 1628
117 Ga0207681_10003168 3300025923 Bacteria 10332
118 Ga0207681_10270023 3300025923 Bacteria 1335
119 Ga0207681_10917761 3300025923 Bacteria 734
120 Ga0207687_10026948 3300025927 Bacteria 3853
121 Ga0207687_10054921 3300025927 Bacteria 2789
122 Ga0207706_10000396 3300025933 Bacteria 46933
123 Ga0207706_10170608 3300025933 Bacteria 1912
124 Ga0207686_10333683 3300025934 Bacteria 1137
125 Ga0207709_10007976 3300025935 Bacteria 5864
126 Ga0207709_10119887 3300025935 Bacteria 1774
127 Ga0207670_10542149 3300025936 Bacteria 949
128 Ga0207704_10692079 3300025938 Bacteria 843
129 Ga0207704_10850259 3300025938 Bacteria 765
130 Ga0207665_10103510 3300025939 Bacteria 1991
131 Ga0207691_10131675 3300025940 Bacteria 2208
132 Ga0207661_10005189 3300025944 Bacteria 9158
133 Ga0207679_10612346 3300025945 Bacteria 982
134 Ga0207667_11780485 3300025949 Bacteria 580
135 Ga0207651_10821264 3300025960 Bacteria 825
136 Ga0207712_10003080 3300025961 Bacteria 10643
137 Ga0207712_10125964 3300025961 Bacteria 1945
138 Ga0207712_10387707 3300025961 Bacteria 1171
139 Ga0207668_10095136 3300025972 Bacteria 2198
140 Ga0207668_10350582 3300025972 Bacteria 1234
141 Ga0207677_10000324 3300026023 Bacteria 34713
142 Ga0207677_10668859 3300026023 Bacteria 918
143 Ga0207703_11225894 3300026035 Bacteria 721
144 Ga0207678_10180398 3300026067 Bacteria 1803
145 Ga0207708_10000798 3300026075 Bacteria 23722
146 Ga0207708_10034882 3300026075 Bacteria 3827
147 Ga0207641_10079667 3300026088 Bacteria 2840
148 Ga0207641_10130391 3300026088 Bacteria 2257
149 Ga0207676_10236115 3300026095 Bacteria 1637
150 Ga0207674_10362473 3300026116 Bacteria 1401
151 Ga0207675_100001219 3300026118 Bacteria 25666
152 Ga0207675_100100643 3300026118 Bacteria 2723
153 Ga0207683_10051737 3300026121 Bacteria 3599
154 Ga0207698_10425941 3300026142 Bacteria 1275
155 Ga0207698_12176381 3300026142 Bacteria 568
156 Ga0209974_10045338 3300027876 Bacteria 1468
157 Ga0268266_11102992 3300028379 Bacteria 768
158 Ga0268265_10647330 3300028380 Bacteria 1015
159 Ga0268265_10929948 3300028380 Bacteria 855
160 Ga0268264_10645525 3300028381 Bacteria 1047
161 Ga0265326_10000005 3300028558 Bacteria 257124
162 Ga0265319_1002906 3300028563 Bacteria 9143
163 Ga0265334_10000046 3300028573 Bacteria 93490
164 Ga0265336_10008197 3300028666 Bacteria 3676
165 Ga0307515_10000227 3300028794 Bacteria 139393
166 Ga0307515_10026579 3300028794 Bacteria 9949
167 Ga0307515_10037567 3300028794 Bacteria 7783
168 Ga0307515_10042069 3300028794 Bacteria 7162
169 Ga0265338_10002712 3300028800 Bacteria 25982
170 Ga0265338_10084055 3300028800 Bacteria 2659
171 Ga0265324_10002469 3300029957 Bacteria 9403
172 Ga0307512_10013778 3300030522 Bacteria 7561
173 Ga0265327_10000021 3300031251 Bacteria 417788
174 Ga0265327_10077878 3300031251 Bacteria 1643
175 Ga0307513_10212455 3300031456 Bacteria 1764
176 Ga0307509_10093912 3300031507 Bacteria 3060
177 Ga0307408_101225498 3300031548 Bacteria 701
178 Ga0307516_10035307 3300031730 Bacteria 5018
179 Ga0307516_10338916 3300031730 Bacteria 1171
180 Ga0307405_11063089 3300031731 Bacteria 694
181 Ga0307413_10100049 3300031824 Bacteria 1913
182 Ga0307410_10364925 3300031852 Bacteria 1158
183 Ga0307407_10728984 3300031903 Bacteria 749
184 Ga0307412_10247316 3300031911 Bacteria 1383
185 Ga0307409_100008542 3300031995 Bacteria 6226
186 Ga0307416_100040126 3300032002 Bacteria 3633
187 Ga0307416_100767477 3300032002 Bacteria 1058
188 Ga0307414_10378164 3300032004 Bacteria 1224
189 Ga0307411_11277272 3300032005 Bacteria 668
190 Ga0307415_100071159 3300032126 Bacteria 2445
191 Ga0307415_100094944 3300032126 Bacteria 2170
192 Ga0307415_100175235 3300032126 Bacteria 1677
193 Ga0307415_101058420 3300032126 Bacteria 757
194 Ga0307415_101858452 3300032126 Bacteria 584
195 Ga0373961_0265877 3300035241 Bacteria 625
196 Ga0395898_0003634 3300037466 Bacteria 17152
197 Ga0395898_0059678 3300037466 Bacteria 3710
198 Ga0395898_0764965 3300037466 Bacteria 907
199 Ga0395905_0331660 3300037471 Bacteria 1412
200 Ga0395905_0898170 3300037471 Bacteria 789
201 Ga0395901_0220661 3300038443 Bacteria 1982
202 Ga0395901_0351408 3300038443 Bacteria 1521
203 Ga0436365_1121510 3300039437 Bacteria 3829
204 Ga0436363_1561861 3300039450 Bacteria 810
205 Ga0451791_1748753 3300041451 Bacteria 938
206 Ga0451837_0477216 3300041494 Bacteria 1274
207 Ga0451847_0069581 3300041503 Bacteria 595
208 Ga0451851_0736375 3300041507 Bacteria 624
209 Ga0439458_0047623 3300042157 Bacteria 1052
210 Ga0466969_0002973 3300044656 Bacteria 9044
211 Ga0466969_0107119 3300044656 Bacteria 1311
212 Ga0466965_0500816 3300044683 Bacteria 681
213 Ga0466961_0397571 3300044693 Bacteria 836
214 Ga0466964_0393137 3300044706 Bacteria 723
215 Ga0466970_0129149 3300044765 Bacteria 1387
216 Ga0466959_0006717 3300045049 Bacteria 8007
217 Ga0466967_0023299 3300045976 Bacteria 5071
218 Ga0466967_0232409 3300045976 Bacteria 1756
219 Ga0466967_0587557 3300045976 Bacteria 1098
220 Ga0495592_0160230 3300046454 Bacteria 1549
221 Ga0495629_0007844 3300046459 Bacteria 7854
222 Ga0495641_0561085 3300046461 Bacteria 521
223 Ga0495605_0198970 3300046474 Bacteria 874
224 Ga0495639_0312824 3300046475 Bacteria 784
225 Ga0495616_0401345 3300046513 Bacteria 563
226 Ga0495631_0071672 3300046518 Bacteria 1497
227 Ga0495642_0239189 3300046528 Bacteria 793
228 Ga0495586_0006371 3300046535 Bacteria 6305
229 Ga0495587_0002909 3300046536 Bacteria 11460
230 Ga0495597_0279419 3300046542 Bacteria 651
231 Ga0495622_0344517 3300046557 Bacteria 645
232 Ga0495656_0368680 3300046615 Bacteria 747
233 Ga0495625_0041672 3300046660 Bacteria 3341
234 Ga0495647_0000009 3300046681 Bacteria 94874
235 Ga0495669_0429433 3300046684 Bacteria 641
236 Ga0495613_0000811 3300046689 Bacteria 24207
237 Ga0495624_0346885 3300046690 Bacteria 893
238 Ga0495671_0215857 3300046692 Bacteria 929
239 Ga0495589_0001637 3300046794 Bacteria 12834
240 Ga0495660_0272633 3300046810 Bacteria 777
241 Ga0495636_0004508 3300047318 Bacteria 5459
242 Ga0495676_0002238 3300047321 Bacteria 17172
243 Ga0495687_024131 3300047443 Bacteria 2895
244 Ga0495687_085656 3300047443 Bacteria 1221
245 Ga0495685_001336 3300047447 Bacteria 7538
246 Ga0495593_0131374 3300047673 Bacteria 1271
247 Ga0495614_0012258 3300048089 Bacteria 3766
248 Ga0496100_0015680 3300048903 Bacteria 4429
249 Ga0496101_1171867 3300048904 Bacteria 602
250 Ga0496102_0185362 3300048905 Bacteria 1961
251 Ga0496103_0090548 3300048906 Bacteria 1930
252 Ga0496103_0272756 3300048906 Bacteria 1088
253 Ga0496104_0031502 3300048907 Bacteria 4932
254 Ga0496105_0411835 3300048908 Bacteria 1071
255 Ga0496106_0007474 3300048909 Bacteria 8075
256 Ga0496107_0207604 3300048910 Bacteria 1456
257 Ga0496108_0006286 3300048911 Bacteria 9628
258 Ga0496108_0406609 3300048911 Bacteria 1189
259 Ga0496109_0217369 3300048912 Bacteria 1797
260 Ga0496110_0020597 3300048913 Bacteria 5570
261 Ga0496111_0034076 3300048914 Bacteria 3634
262 Ga0496112_0047437 3300048915 Bacteria 4214
263 Ga0496113_0098128 3300048916 Bacteria 2267
264 Ga0501044_1039165 3300049823 Bacteria 690
265 Ga0501045_0095354 3300049824 Bacteria 2201
266 nmdc:mga05p37_1065007_c1 3300050507 Bacteria 851
267 nmdc:mga05p37_108036_c1 3300050507 Bacteria 3423
268 nmdc:mga05p37_275754_c1 3300050507 Bacteria 2008
269 nmdc:mga05p37_41203_c1 3300050507 Bacteria 5670
270 nmdc:mga06r32_50272_c1 3300050510 Bacteria 3988
271 nmdc:mga06r32_712658_c1 3300050510 Bacteria 968
272 nmdc:mga08y16_139767_c1 3300050511 Bacteria 2517
273 nmdc:mga08y16_663016_c1 3300050511 Bacteria 1046
274 nmdc:mga0n895_2012179_c1 3300050512 Bacteria 535
275 nmdc:mga0n895_58204_c1 3300050512 Bacteria 3810
276 nmdc:mga0rr50_17551_c1 3300050513 Bacteria 4782
277 nmdc:mga08x19_364177_c1 3300050514 Bacteria 1011
278 nmdc:mga0a205_54477_c1 3300050515 Bacteria 3862
279 nmdc:mga0sz30_303830_c1 3300050516 Bacteria 711
280 Ga0495601_0043854 3300053077 Bacteria 2810
281 Ga0495601_0569810 3300053077 Bacteria 728
282 Ga0495595_0090500 3300053084 Bacteria 1468
283 Ga0495619_0000923 3300053085 Bacteria 19310
284 Ga0500644_0107890 3300053088 Bacteria 1068
285 Ga0500660_089940 3300053100 Bacteria 1375
286 Ga0500556_0000328 3300053104 Bacteria 35671
287 Ga0500600_0129385 3300053149 Bacteria 1288
288 Ga0500616_0004202 3300053153 Bacteria 10379
289 Ga0500616_0032556 3300053153 Bacteria 2850
290 Ga0466962_0177269 3300061719 Bacteria 1039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10362473 Ga0207674_103624732 117
2 iso_pu_bacteria 2643221548 2643762203 131
3 iso_pu_bacteria 2643221682 2644459018 131
4 iso_pu_bacteria 2818991463 2819699470 131
5 iso_pu_bacteria 2880495981 2880501599 131
6 iso_pu_bacteria 2966598605 2966599723 131
7 iso_pu_bacteria 8025530807 8025532897 131
8 3300046542 Ga0495597_0279419 Ga0495597_0279419_53_457 132
9 3300044656 Ga0466969_0002973 Ga0466969_0002973_8536_8943 133
10 3300046557 Ga0495622_0344517 Ga0495622_0344517_46_453 133
11 3300047443 Ga0495687_024131 Ga0495687_024131_1149_1556 133
12 3300049823 Ga0501044_1039165 Ga0501044_1039165_266_673 133
13 3300050516 nmdc:mga0sz30_303830_c1 nmdc:mga0sz30_303830_c1_217_624 133
14 3300053100 Ga0500660_089940 Ga0500660_089940_231_638 133
15 3300005333 Ga0070677_10132333 Ga0070677_101323332 134
16 3300005458 Ga0070681_10671151 Ga0070681_106711512 134
17 3300010375 Ga0105239_12411511 Ga0105239_124115111 134
18 3300025302 Ga0207426_1051090 Ga0207426_10510902 134
19 3300026142 Ga0207698_12176381 Ga0207698_121763811 134
20 3300028380 Ga0268265_10647330 Ga0268265_106473302 134
21 3300028794 Ga0307515_10000227 Ga0307515_1000022710 134
22 3300028794 Ga0307515_10026579 Ga0307515_100265795 134
23 3300028794 Ga0307515_10037567 Ga0307515_100375677 134
24 3300028794 Ga0307515_10042069 Ga0307515_100420696 134
25 3300030522 Ga0307512_10013778 Ga0307512_100137785 134
26 3300031456 Ga0307513_10212455 Ga0307513_102124552 134
27 3300031507 Ga0307509_10093912 Ga0307509_100939124 134
28 3300031730 Ga0307516_10035307 Ga0307516_100353074 134
29 3300031730 Ga0307516_10338916 Ga0307516_103389162 134
30 3300031731 Ga0307405_11063089 Ga0307405_110630892 134
31 3300032126 Ga0307415_100071159 Ga0307415_1000711594 134
32 3300032126 Ga0307415_101858452 Ga0307415_1018584521 134
33 3300037466 Ga0395898_0003634 Ga0395898_0003634_4826_5236 134
34 3300041451 Ga0451791_1748753 Ga0451791_1748753_305_715 134
35 3300041494 Ga0451837_0477216 Ga0451837_0477216_460_870 134
36 3300042157 Ga0439458_0047623 Ga0439458_0047623_38_454 134
37 3300044683 Ga0466965_0500816 Ga0466965_0500816_218_628 134
38 3300044765 Ga0466970_0129149 Ga0466970_0129149_922_1332 134
39 3300046459 Ga0495629_0007844 Ga0495629_0007844_5593_6009 134
40 3300046528 Ga0495642_0239189 Ga0495642_0239189_365_775 134
41 3300046660 Ga0495625_0041672 Ga0495625_0041672_1681_2097 134
42 3300046689 Ga0495613_0000811 Ga0495613_0000811_744_1160 134
43 3300046794 Ga0495589_0001637 Ga0495589_0001637_5249_5659 134
44 3300047318 Ga0495636_0004508 Ga0495636_0004508_570_980 134
45 3300047321 Ga0495676_0002238 Ga0495676_0002238_1458_1874 134
46 3300047443 Ga0495687_085656 Ga0495687_085656_735_1145 134
47 3300047447 Ga0495685_001336 Ga0495685_001336_338_748 134
48 3300047673 Ga0495593_0131374 Ga0495593_0131374_117_533 134
49 3300048089 Ga0495614_0012258 Ga0495614_0012258_1326_1742 134
50 3300048911 Ga0496108_0406609 Ga0496108_0406609_479_889 134
51 3300053088 Ga0500644_0107890 Ga0500644_0107890_91_501 134
52 3300053149 Ga0500600_0129385 Ga0500600_0129385_360_776 134
53 3300035241 Ga0373961_0265877 Ga0373961_0265877_192_605 137
54 3300009093 Ga0105240_10900892 Ga0105240_109008922 138
55 3300009093 Ga0105240_12274483 Ga0105240_122744832 138
56 3300031251 Ga0265327_10000021 Ga0265327_10000021265 138
57 3300044706 Ga0466964_0393137 Ga0466964_0393137_20_439 138
58 3300005445 Ga0070708_100291045 Ga0070708_1002910452 139
59 3300005543 Ga0070672_100434163 Ga0070672_1004341632 139
60 3300025911 Ga0207654_11244235 Ga0207654_112442351 139
61 3300041503 Ga0451847_0069581 Ga0451847_0069581_92_571 139
62 3300005329 Ga0070683_100115905 Ga0070683_1001159054 140
63 3300005338 Ga0068868_100007751 Ga0068868_1000077517 140
64 3300005340 Ga0070689_100060897 Ga0070689_1000608972 140
65 3300005341 Ga0070691_10303485 Ga0070691_103034851 140
66 3300005354 Ga0070675_100380638 Ga0070675_1003806382 140
67 3300005364 Ga0070673_100603753 Ga0070673_1006037532 140
68 3300005437 Ga0070710_10743193 Ga0070710_107431931 140
69 3300005438 Ga0070701_10142059 Ga0070701_101420592 140
70 3300005441 Ga0070700_100000242 Ga0070700_10000024231 140
71 3300005455 Ga0070663_100004912 Ga0070663_1000049122 140
72 3300005456 Ga0070678_101087327 Ga0070678_1010873272 140
73 3300005457 Ga0070662_100321805 Ga0070662_1003218051 140
74 3300005466 Ga0070685_10680622 Ga0070685_106806221 140
75 3300005545 Ga0070695_100459703 Ga0070695_1004597032 140
76 3300005549 Ga0070704_100015676 Ga0070704_1000156762 140
77 3300005564 Ga0070664_100002440 Ga0070664_10000244018 140
78 3300005614 Ga0068856_100054355 Ga0068856_1000543554 140
79 3300005615 Ga0070702_100030697 Ga0070702_1000306974 140
80 3300005616 Ga0068852_100401223 Ga0068852_1004012232 140
81 3300005617 Ga0068859_100691194 Ga0068859_1006911942 140
82 3300005617 Ga0068859_102663513 Ga0068859_1026635131 140
83 3300005618 Ga0068864_100082861 Ga0068864_1000828612 140
84 3300005718 Ga0068866_10105375 Ga0068866_101053752 140
85 3300005719 Ga0068861_101124759 Ga0068861_1011247592 140
86 3300005841 Ga0068863_100323168 Ga0068863_1003231683 140
87 3300005844 Ga0068862_100372921 Ga0068862_1003729213 140
88 3300006175 Ga0070712_100016637 Ga0070712_1000166372 140
89 3300006237 Ga0097621_101018948 Ga0097621_1010189482 140
90 3300006931 Ga0097620_100691346 Ga0097620_1006913462 140
91 3300006931 Ga0097620_102663656 Ga0097620_1026636561 140
92 3300009011 Ga0105251_10166148 Ga0105251_101661481 140
93 3300009098 Ga0105245_10002391 Ga0105245_100023912 140
94 3300009176 Ga0105242_10501337 Ga0105242_105013372 140
95 3300009177 Ga0105248_10176577 Ga0105248_101765773 140
96 3300009553 Ga0105249_10225575 Ga0105249_102255752 140
97 3300010375 Ga0105239_10135433 Ga0105239_101354334 140
98 3300013105 Ga0157369_10389298 Ga0157369_103892982 140
99 3300013296 Ga0157374_10127716 Ga0157374_101277164 140
100 3300013297 Ga0157378_10641951 Ga0157378_106419513 140
101 3300013307 Ga0157372_10029069 Ga0157372_100290692 140
102 3300013308 Ga0157375_10022914 Ga0157375_100229142 140
103 3300014968 Ga0157379_10614371 Ga0157379_106143711 140
104 3300025898 Ga0207692_10201986 Ga0207692_102019862 140
105 3300025901 Ga0207688_10005962 Ga0207688_100059622 140
106 3300025904 Ga0207647_10292526 Ga0207647_102925262 140
107 3300025909 Ga0207705_10836721 Ga0207705_108367212 140
108 3300025915 Ga0207693_10074943 Ga0207693_100749432 140
109 3300025921 Ga0207652_10632854 Ga0207652_106328542 140
110 3300025923 Ga0207681_10270023 Ga0207681_102700232 140
111 3300025927 Ga0207687_10054921 Ga0207687_100549212 140
112 3300025933 Ga0207706_10170608 Ga0207706_101706083 140
113 3300025934 Ga0207686_10333683 Ga0207686_103336832 140
114 3300025936 Ga0207670_10542149 Ga0207670_105421492 140
115 3300025938 Ga0207704_10692079 Ga0207704_106920792 140
116 3300025940 Ga0207691_10131675 Ga0207691_101316752 140
117 3300025944 Ga0207661_10005189 Ga0207661_100051892 140
118 3300025945 Ga0207679_10612346 Ga0207679_106123461 140
119 3300025960 Ga0207651_10821264 Ga0207651_108212641 140
120 3300025961 Ga0207712_10125964 Ga0207712_101259642 140
121 3300025972 Ga0207668_10350582 Ga0207668_103505822 140
122 3300026023 Ga0207677_10668859 Ga0207677_106688592 140
123 3300026035 Ga0207703_11225894 Ga0207703_112258942 140
124 3300026067 Ga0207678_10180398 Ga0207678_101803983 140
125 3300026075 Ga0207708_10000798 Ga0207708_100007988 140
126 3300026088 Ga0207641_10079667 Ga0207641_100796673 140
127 3300026088 Ga0207641_10130391 Ga0207641_101303912 140
128 3300026095 Ga0207676_10236115 Ga0207676_102361152 140
129 3300026118 Ga0207675_100100643 Ga0207675_1001006434 140
130 3300026121 Ga0207683_10051737 Ga0207683_100517372 140
131 3300026142 Ga0207698_10425941 Ga0207698_104259412 140
132 3300028379 Ga0268266_11102992 Ga0268266_111029922 140
133 3300028380 Ga0268265_10929948 Ga0268265_109299481 140
134 3300028381 Ga0268264_10645525 Ga0268264_106455253 140
135 3300048903 Ga0496100_0015680 Ga0496100_0015680_3653_4075 140
136 3300048904 Ga0496101_1171867 Ga0496101_1171867_25_447 140
137 3300048905 Ga0496102_0185362 Ga0496102_0185362_536_958 140
138 3300048906 Ga0496103_0090548 Ga0496103_0090548_1105_1527 140
139 3300048906 Ga0496103_0272756 Ga0496103_0272756_563_985 140
140 3300048907 Ga0496104_0031502 Ga0496104_0031502_4274_4696 140
141 3300048908 Ga0496105_0411835 Ga0496105_0411835_597_1019 140
142 3300048909 Ga0496106_0007474 Ga0496106_0007474_6114_6536 140
143 3300048910 Ga0496107_0207604 Ga0496107_0207604_539_961 140
144 3300048911 Ga0496108_0006286 Ga0496108_0006286_1765_2187 140
145 3300048912 Ga0496109_0217369 Ga0496109_0217369_554_976 140
146 3300048913 Ga0496110_0020597 Ga0496110_0020597_4547_4969 140
147 3300048914 Ga0496111_0034076 Ga0496111_0034076_1158_1580 140
148 3300048915 Ga0496112_0047437 Ga0496112_0047437_1782_2204 140
149 3300048916 Ga0496113_0098128 Ga0496113_0098128_1306_1728 140
150 3300050512 nmdc:mga0n895_2012179_c1 nmdc:mga0n895_2012179_c1_61_483 140
151 3300005338 Ga0068868_100001849 Ga0068868_10000184911 141
152 3300005344 Ga0070661_100000035 Ga0070661_10000003585 141
153 3300005347 Ga0070668_100016437 Ga0070668_1000164373 141
154 3300005365 Ga0070688_100003140 Ga0070688_10000314010 141
155 3300005466 Ga0070685_10003100 Ga0070685_1000310010 141
156 3300005545 Ga0070695_101224959 Ga0070695_1012249591 141
157 3300005937 Ga0081455_10026157 Ga0081455_100261576 141
158 3300009147 Ga0114129_12138866 Ga0114129_121388661 141
159 3300009148 Ga0105243_10013177 Ga0105243_100131774 141
160 3300009553 Ga0105249_11311482 Ga0105249_113114821 141
161 3300025912 Ga0207707_10494251 Ga0207707_104942512 141
162 3300025917 Ga0207660_10591413 Ga0207660_105914132 141
163 3300025920 Ga0207649_10000028 Ga0207649_1000002877 141
164 3300025935 Ga0207709_10007976 Ga0207709_100079764 141
165 3300025972 Ga0207668_10095136 Ga0207668_100951363 141
166 3300026023 Ga0207677_10000324 Ga0207677_100003245 141
167 3300037471 Ga0395905_0331660 Ga0395905_0331660_662_1087 141
168 3300038443 Ga0395901_0351408 Ga0395901_0351408_297_722 141
169 3300041507 Ga0451851_0736375 Ga0451851_0736375_86_511 141
170 3300045976 Ga0466967_0232409 Ga0466967_0232409_522_947 141
171 3300046536 Ga0495587_0002909 Ga0495587_0002909_5633_6058 141
172 3300049824 Ga0501045_0095354 Ga0501045_0095354_1753_2178 141
173 3300050507 nmdc:mga05p37_41203_c1 nmdc:mga05p37_41203_c1_4037_4462 141
174 3300005331 Ga0070670_101638064 Ga0070670_1016380641 142
175 3300005347 Ga0070668_101679106 Ga0070668_1016791061 142
176 3300005353 Ga0070669_100004289 Ga0070669_10000428917 142
177 3300005353 Ga0070669_100650177 Ga0070669_1006501772 142
178 3300005468 Ga0070707_100364470 Ga0070707_1003644701 142
179 3300006028 Ga0070717_10000006 Ga0070717_10000006260 142
180 3300006173 Ga0070716_100063454 Ga0070716_1000634543 142
181 3300006844 Ga0075428_100089124 Ga0075428_1000891242 142
182 3300006852 Ga0075433_10014092 Ga0075433_100140921 142
183 3300006871 Ga0075434_100041109 Ga0075434_1000411097 142
184 3300006914 Ga0075436_100133763 Ga0075436_1001337633 142
185 3300007076 Ga0075435_100002406 Ga0075435_1000024068 142
186 3300009094 Ga0111539_10077436 Ga0111539_100774363 142
187 3300009147 Ga0114129_10080570 Ga0114129_100805704 142
188 3300009147 Ga0114129_10972350 Ga0114129_109723502 142
189 3300009147 Ga0114129_12193837 Ga0114129_121938371 142
190 3300009553 Ga0105249_10547009 Ga0105249_105470092 142
191 3300014326 Ga0157380_10000929 Ga0157380_1000092917 142
192 3300017792 Ga0163161_10000027 Ga0163161_10000027175 142
193 3300021384 Ga0213876_10055594 Ga0213876_100555942 142
194 3300025898 Ga0207692_10000004 Ga0207692_1000000452 142
195 3300025922 Ga0207646_10242629 Ga0207646_102426292 142
196 3300025923 Ga0207681_10003168 Ga0207681_1000316817 142
197 3300025923 Ga0207681_10917761 Ga0207681_109177612 142
198 3300025935 Ga0207709_10119887 Ga0207709_101198872 142
199 3300025938 Ga0207704_10850259 Ga0207704_108502592 142
200 3300025939 Ga0207665_10103510 Ga0207665_101035104 142
201 3300025961 Ga0207712_10387707 Ga0207712_103877072 142
202 3300028558 Ga0265326_10000005 Ga0265326_10000005158 142
203 3300028563 Ga0265319_1002906 Ga0265319_10029069 142
204 3300028573 Ga0265334_10000046 Ga0265334_100000467 142
205 3300028666 Ga0265336_10008197 Ga0265336_100081973 142
206 3300028800 Ga0265338_10002712 Ga0265338_1000271214 142
207 3300028800 Ga0265338_10084055 Ga0265338_100840552 142
208 3300029957 Ga0265324_10002469 Ga0265324_100024692 142
209 3300031251 Ga0265327_10077878 Ga0265327_100778782 142
210 3300031548 Ga0307408_101225498 Ga0307408_1012254981 142
211 3300031824 Ga0307413_10100049 Ga0307413_101000491 142
212 3300031852 Ga0307410_10364925 Ga0307410_103649251 142
213 3300031903 Ga0307407_10728984 Ga0307407_107289841 142
214 3300031911 Ga0307412_10247316 Ga0307412_102473161 142
215 3300031995 Ga0307409_100008542 Ga0307409_1000085429 142
216 3300032002 Ga0307416_100040126 Ga0307416_1000401261 142
217 3300032002 Ga0307416_100767477 Ga0307416_1007674772 142
218 3300032004 Ga0307414_10378164 Ga0307414_103781642 142
219 3300032126 Ga0307415_100094944 Ga0307415_1000949442 142
220 3300037466 Ga0395898_0059678 Ga0395898_0059678_1549_1977 142
221 3300039437 Ga0436365_1121510 Ga0436365_1121510_510_938 142
222 3300039450 Ga0436363_1561861 Ga0436363_1561861_266_694 142
223 3300044656 Ga0466969_0107119 Ga0466969_0107119_508_936 142
224 3300044693 Ga0466961_0397571 Ga0466961_0397571_281_709 142
225 3300045049 Ga0466959_0006717 Ga0466959_0006717_2565_2993 142
226 3300045976 Ga0466967_0023299 Ga0466967_0023299_3899_4327 142
227 3300045976 Ga0466967_0587557 Ga0466967_0587557_129_557 142
228 3300046454 Ga0495592_0160230 Ga0495592_0160230_226_654 142
229 3300046461 Ga0495641_0561085 Ga0495641_0561085_13_447 142
230 3300046475 Ga0495639_0312824 Ga0495639_0312824_168_596 142
231 3300046535 Ga0495586_0006371 Ga0495586_0006371_5260_5688 142
232 3300046681 Ga0495647_0000009 Ga0495647_0000009_53098_53532 142
233 3300046690 Ga0495624_0346885 Ga0495624_0346885_378_806 142
234 3300050507 nmdc:mga05p37_1065007_c1 nmdc:mga05p37_1065007_c1_178_606 142
235 3300050507 nmdc:mga05p37_108036_c1 nmdc:mga05p37_108036_c1_489_917 142
236 3300050510 nmdc:mga06r32_50272_c1 nmdc:mga06r32_50272_c1_2717_3145 142
237 3300050511 nmdc:mga08y16_139767_c1 nmdc:mga08y16_139767_c1_1882_2310 142
238 3300050512 nmdc:mga0n895_58204_c1 nmdc:mga0n895_58204_c1_2715_3143 142
239 3300050513 nmdc:mga0rr50_17551_c1 nmdc:mga0rr50_17551_c1_3357_3785 142
240 3300050514 nmdc:mga08x19_364177_c1 nmdc:mga08x19_364177_c1_413_841 142
241 3300050515 nmdc:mga0a205_54477_c1 nmdc:mga0a205_54477_c1_2003_2431 142
242 3300053077 Ga0495601_0043854 Ga0495601_0043854_2172_2600 142
243 3300053077 Ga0495601_0569810 Ga0495601_0569810_24_452 142
244 3300053084 Ga0495595_0090500 Ga0495595_0090500_390_818 142
245 3300053085 Ga0495619_0000923 Ga0495619_0000923_6005_6433 142
246 3300061719 Ga0466962_0177269 Ga0466962_0177269_288_716 142
247 3300009553 Ga0105249_12736043 Ga0105249_127360431 143
248 3300027876 Ga0209974_10045338 Ga0209974_100453383 143
249 3300032005 Ga0307411_11277272 Ga0307411_112772722 143
250 3300053104 Ga0500556_0000328 Ga0500556_0000328_8588_9019 143
251 3300053153 Ga0500616_0004202 Ga0500616_0004202_1590_2021 143
252 3300053153 Ga0500616_0032556 Ga0500616_0032556_1758_2198 143
253 3300005328 Ga0070676_10124678 Ga0070676_101246781 144
254 3300005341 Ga0070691_10020541 Ga0070691_100205411 144
255 3300005341 Ga0070691_10270563 Ga0070691_102705632 144
256 3300005345 Ga0070692_10433044 Ga0070692_104330442 144
257 3300005441 Ga0070700_100053543 Ga0070700_1000535433 144
258 3300005457 Ga0070662_100011404 Ga0070662_1000114043 144
259 3300005545 Ga0070695_100207550 Ga0070695_1002075501 144
260 3300005546 Ga0070696_100028921 Ga0070696_1000289212 144
261 3300005844 Ga0068862_100179576 Ga0068862_1001795763 144
262 3300005985 Ga0081539_10083904 Ga0081539_100839043 144
263 3300006844 Ga0075428_100474202 Ga0075428_1004742022 144
264 3300006847 Ga0075431_100647024 Ga0075431_1006470242 144
265 3300009094 Ga0111539_10894658 Ga0111539_108946583 144
266 3300009098 Ga0105245_10009793 Ga0105245_100097933 144
267 3300009147 Ga0114129_10243279 Ga0114129_102432793 144
268 3300009147 Ga0114129_10522098 Ga0114129_105220983 144
269 3300009148 Ga0105243_11075356 Ga0105243_110753561 144
270 3300009553 Ga0105249_10010140 Ga0105249_100101402 144
271 3300010375 Ga0105239_10189957 Ga0105239_101899572 144
272 3300013102 Ga0157371_10110631 Ga0157371_101106313 144
273 3300013306 Ga0163162_10137594 Ga0163162_101375943 144
274 3300017792 Ga0163161_10060470 Ga0163161_100604702 144
275 3300025901 Ga0207688_10103695 Ga0207688_101036953 144
276 3300025927 Ga0207687_10026948 Ga0207687_100269483 144
277 3300025933 Ga0207706_10000396 Ga0207706_1000039646 144
278 3300025949 Ga0207667_11780485 Ga0207667_117804851 144
279 3300025961 Ga0207712_10003080 Ga0207712_100030809 144
280 3300026075 Ga0207708_10034882 Ga0207708_100348823 144
281 3300026118 Ga0207675_100001219 Ga0207675_10000121923 144
282 3300032126 Ga0307415_100175235 Ga0307415_1001752351 144
283 3300032126 Ga0307415_101058420 Ga0307415_1010584202 144
284 3300037466 Ga0395898_0764965 Ga0395898_0764965_383_817 144
285 3300037471 Ga0395905_0898170 Ga0395905_0898170_218_652 144
286 3300038443 Ga0395901_0220661 Ga0395901_0220661_1388_1822 144
287 3300046474 Ga0495605_0198970 Ga0495605_0198970_24_458 144
288 3300046513 Ga0495616_0401345 Ga0495616_0401345_11_445 144
289 3300046518 Ga0495631_0071672 Ga0495631_0071672_994_1428 144
290 3300046615 Ga0495656_0368680 Ga0495656_0368680_12_446 144
291 3300046684 Ga0495669_0429433 Ga0495669_0429433_109_543 144
292 3300046692 Ga0495671_0215857 Ga0495671_0215857_106_540 144
293 3300046810 Ga0495660_0272633 Ga0495660_0272633_106_540 144
294 3300050507 nmdc:mga05p37_275754_c1 nmdc:mga05p37_275754_c1_1027_1461 144
295 3300050510 nmdc:mga06r32_712658_c1 nmdc:mga06r32_712658_c1_185_619 144
296 3300050511 nmdc:mga08y16_663016_c1 nmdc:mga08y16_663016_c1_551_1027 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

17

147

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8588 1 137
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8491 1 137
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8448 2 136
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8437 1 135
5umq-assembly1.cif.gz_A crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 0.8394 1 135
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8974 84 135 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8818 84 135 3.30.720.110
3sk1A02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8711 85 136 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8396 84 137 3.30.720.110
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8265 3 137 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A1G7N9Q5-F1-model_v4 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein 0.9688 83 137 GO:0051213
AF-A0A1G7N9Q5-F1-model_v4 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein 0.9359 83 137 GO:0051213
AF-A0A2Z4W9C1-F1-model_v4 VOC domain-containing protein 0.9166 1 135
AF-A0A6L9J170-F1-model_v4 VOC family protein 0.9118 4 137
AF-A0A1M6S0M0-F1-model_v4 VOC domain-containing protein 0.9022 1 137

Feature Viewer

pLDDT pTM Quality
89.61 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map