F393159
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 296 | 175 | 295 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300009176|Ga0105242_12981663|Ga0105242_129816631 |
| Length | 141 |
| Sequence | VGFALPVLFVFRFLIEERSDAMPTLIESPSIIQAAGTKPKRIEEYAGRVNSGHSGVSVARMVSPEGWVEPGQQPEFEEITIVLKGLLRVEHQGGTLDVRSGQAVISRPGEWVRYSTPEPGGAEYVAVCLPAFSMESVHRDE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 52 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 53 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 54 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 64 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 81 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 111 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 112 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 113 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 114 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 116 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 117 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 118 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 119 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 120 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 121 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 122 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 123 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 124 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 125 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 126 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 129 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 130 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 131 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 132 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 133 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 134 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 135 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 136 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 137 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 138 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 147 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 148 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 149 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 150 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 153 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 154 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 155 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 156 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 157 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 164 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 165 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 166 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 175 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.97 |
| Metatranscriptomes | 1.69 |
| Isolates | 0.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.7 |
| Nodule | 0.34 |
| Rhizoplane | 7.77 |
| Rhizosphere | 88.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_1470594 | 2162886006 | Bacteria | 816 |
| 2 | rootH1_10164325 | 3300003316 | Bacteria | 2286 |
| 3 | Ga0058862_12539817 | 3300004803 | Bacteria | 637 |
| 4 | Ga0065714_10270213 | 3300005288 | Bacteria | 740 |
| 5 | Ga0065704_10636954 | 3300005289 | Archaea | 589 |
| 6 | Ga0065712_10129425 | 3300005290 | Bacteria | 1564 |
| 7 | Ga0065707_10103682 | 3300005295 | Bacteria | 2735 |
| 8 | Ga0070690_100008833 | 3300005330 | Bacteria | 5821 |
| 9 | Ga0070670_100044319 | 3300005331 | Bacteria | 3825 |
| 10 | Ga0070670_100161906 | 3300005331 | Unclassified | 1939 |
| 11 | Ga0070670_100214381 | 3300005331 | Bacteria | 1674 |
| 12 | Ga0070670_100228480 | 3300005331 | Bacteria | 1619 |
| 13 | Ga0070670_100255810 | 3300005331 | Bacteria | 1526 |
| 14 | Ga0070670_101235259 | 3300005331 | Bacteria | 683 |
| 15 | Ga0070677_10152594 | 3300005333 | Bacteria | 1076 |
| 16 | Ga0070666_10425818 | 3300005335 | Bacteria | 956 |
| 17 | Ga0070680_100019408 | 3300005336 | Bacteria | 5387 |
| 18 | Ga0070680_100436188 | 3300005336 | Bacteria | 1118 |
| 19 | Ga0070689_100156494 | 3300005340 | Bacteria | 1840 |
| 20 | Ga0070689_100502059 | 3300005340 | Bacteria | 1039 |
| 21 | Ga0070689_100947633 | 3300005340 | Unclassified | 763 |
| 22 | Ga0070689_102026290 | 3300005340 | Bacteria | 527 |
| 23 | Ga0070692_10282649 | 3300005345 | Bacteria | 1006 |
| 24 | Ga0070668_100227769 | 3300005347 | Bacteria | 1540 |
| 25 | Ga0070669_100662309 | 3300005353 | Unclassified | 879 |
| 26 | Ga0070675_100027513 | 3300005354 | Bacteria | 4569 |
| 27 | Ga0070675_101144934 | 3300005354 | Bacteria | 716 |
| 28 | Ga0070674_100693917 | 3300005356 | Bacteria | 869 |
| 29 | Ga0070673_100215305 | 3300005364 | Unclassified | 1660 |
| 30 | Ga0070673_101714325 | 3300005364 | Bacteria | 595 |
| 31 | Ga0070688_101184977 | 3300005365 | Unclassified | 613 |
| 32 | Ga0070667_100172045 | 3300005367 | Bacteria | 1913 |
| 33 | Ga0070701_10233293 | 3300005438 | Bacteria | 1103 |
| 34 | Ga0070705_100350524 | 3300005440 | Unclassified | 1076 |
| 35 | Ga0070705_100725290 | 3300005440 | Bacteria | 783 |
| 36 | Ga0070700_100022937 | 3300005441 | Bacteria | 3647 |
| 37 | Ga0070700_100536758 | 3300005441 | Unclassified | 906 |
| 38 | Ga0070694_100188764 | 3300005444 | Unclassified | 1529 |
| 39 | Ga0070694_100629450 | 3300005444 | Unclassified | 867 |
| 40 | Ga0070694_101098761 | 3300005444 | Archaea | 663 |
| 41 | Ga0070678_100303398 | 3300005456 | Bacteria | 1358 |
| 42 | Ga0070662_100067199 | 3300005457 | Bacteria | 2632 |
| 43 | Ga0070662_100647755 | 3300005457 | Bacteria | 891 |
| 44 | Ga0070681_10765201 | 3300005458 | Bacteria | 882 |
| 45 | Ga0070681_11235495 | 3300005458 | Bacteria | 669 |
| 46 | Ga0068867_100312199 | 3300005459 | Bacteria | 1300 |
| 47 | Ga0070685_10001188 | 3300005466 | Bacteria | 13920 |
| 48 | Ga0070685_10002525 | 3300005466 | Bacteria | 9385 |
| 49 | Ga0070685_10751337 | 3300005466 | Bacteria | 715 |
| 50 | Ga0070685_11546114 | 3300005466 | Bacteria | 512 |
| 51 | Ga0070706_100387934 | 3300005467 | Bacteria | 1300 |
| 52 | Ga0070707_100336265 | 3300005468 | Bacteria | 1467 |
| 53 | Ga0070707_102177053 | 3300005468 | Unclassified | 522 |
| 54 | Ga0070699_100055680 | 3300005518 | Unclassified | 3424 |
| 55 | Ga0070679_100088060 | 3300005530 | Bacteria | 3092 |
| 56 | Ga0070679_100495212 | 3300005530 | Bacteria | 1166 |
| 57 | Ga0068853_101345968 | 3300005539 | Unclassified | 690 |
| 58 | Ga0070672_100125775 | 3300005543 | Bacteria | 2102 |
| 59 | Ga0070672_100793445 | 3300005543 | Unclassified | 833 |
| 60 | Ga0070686_100000029 | 3300005544 | Bacteria | 123581 |
| 61 | Ga0070696_100140296 | 3300005546 | Unclassified | 1766 |
| 62 | Ga0070704_101262562 | 3300005549 | Unclassified | 675 |
| 63 | Ga0070664_100249380 | 3300005564 | Unclassified | 1595 |
| 64 | Ga0070664_100598457 | 3300005564 | Bacteria | 1022 |
| 65 | Ga0070664_101339732 | 3300005564 | Unclassified | 676 |
| 66 | Ga0068857_100097956 | 3300005577 | Bacteria | 2630 |
| 67 | Ga0068857_102413562 | 3300005577 | Unclassified | 516 |
| 68 | Ga0068859_100248869 | 3300005617 | Bacteria | 1868 |
| 69 | Ga0068859_100468450 | 3300005617 | Bacteria | 1355 |
| 70 | Ga0068859_101881231 | 3300005617 | Bacteria | 661 |
| 71 | Ga0068859_102588070 | 3300005617 | Unclassified | 558 |
| 72 | Ga0068864_100059342 | 3300005618 | Bacteria | 3310 |
| 73 | Ga0068864_101072686 | 3300005618 | Bacteria | 801 |
| 74 | Ga0068861_100075231 | 3300005719 | Bacteria | 2628 |
| 75 | Ga0068861_100638255 | 3300005719 | Unclassified | 982 |
| 76 | Ga0068861_100935575 | 3300005719 | Bacteria | 823 |
| 77 | Ga0068870_10114626 | 3300005840 | Unclassified | 1544 |
| 78 | Ga0068863_100191771 | 3300005841 | Bacteria | 1964 |
| 79 | Ga0068863_100349610 | 3300005841 | Unclassified | 1439 |
| 80 | Ga0068863_102182879 | 3300005841 | Unclassified | 564 |
| 81 | Ga0068858_101391396 | 3300005842 | Bacteria | 691 |
| 82 | Ga0068860_100544641 | 3300005843 | Bacteria | 1162 |
| 83 | Ga0068862_101264957 | 3300005844 | Bacteria | 738 |
| 84 | Ga0068862_102286813 | 3300005844 | Unclassified | 552 |
| 85 | Ga0068862_102342687 | 3300005844 | Bacteria | 546 |
| 86 | Ga0075368_10083451 | 3300006042 | Bacteria | 1302 |
| 87 | Ga0075366_10010478 | 3300006195 | Bacteria | 5205 |
| 88 | Ga0075366_10052370 | 3300006195 | Bacteria | 2425 |
| 89 | Ga0075428_101444689 | 3300006844 | Unclassified | 721 |
| 90 | Ga0075430_100529485 | 3300006846 | Bacteria | 972 |
| 91 | Ga0075431_100017732 | 3300006847 | Bacteria | 7239 |
| 92 | Ga0075431_100226191 | 3300006847 | Bacteria | 1907 |
| 93 | Ga0075431_100664789 | 3300006847 | Bacteria | 1021 |
| 94 | Ga0075431_101374935 | 3300006847 | Unclassified | 666 |
| 95 | Ga0075433_10452842 | 3300006852 | Bacteria | 1131 |
| 96 | Ga0075433_11012347 | 3300006852 | Unclassified | 724 |
| 97 | Ga0075434_100173563 | 3300006871 | Bacteria | 2176 |
| 98 | Ga0075434_100499606 | 3300006871 | Bacteria | 1237 |
| 99 | Ga0075434_100703197 | 3300006871 | Bacteria | 1028 |
| 100 | Ga0075434_102111660 | 3300006871 | Unclassified | 568 |
| 101 | Ga0075429_100171515 | 3300006880 | Unclassified | 1900 |
| 102 | Ga0068865_100101553 | 3300006881 | Bacteria | 2106 |
| 103 | Ga0068865_100935356 | 3300006881 | Bacteria | 756 |
| 104 | Ga0075436_100326889 | 3300006914 | Unclassified | 1102 |
| 105 | Ga0097620_100248863 | 3300006931 | Bacteria | 1868 |
| 106 | Ga0097620_100468488 | 3300006931 | Bacteria | 1355 |
| 107 | Ga0097620_101880486 | 3300006931 | Bacteria | 661 |
| 108 | Ga0097620_102587774 | 3300006931 | Unclassified | 558 |
| 109 | Ga0075435_100043671 | 3300007076 | Bacteria | 3588 |
| 110 | Ga0075435_100067890 | 3300007076 | Bacteria | 2904 |
| 111 | Ga0075435_100404768 | 3300007076 | Bacteria | 1174 |
| 112 | Ga0075435_101861036 | 3300007076 | Unclassified | 528 |
| 113 | Ga0099794_10463625 | 3300007265 | Bacteria | 665 |
| 114 | Ga0105251_10570983 | 3300009011 | Bacteria | 534 |
| 115 | Ga0111539_10047502 | 3300009094 | Bacteria | 5129 |
| 116 | Ga0111539_10128780 | 3300009094 | Bacteria | 2965 |
| 117 | Ga0111539_10507715 | 3300009094 | Bacteria | 1404 |
| 118 | Ga0111539_10539526 | 3300009094 | Bacteria | 1359 |
| 119 | Ga0111539_12558650 | 3300009094 | Bacteria | 592 |
| 120 | Ga0114129_10005251 | 3300009147 | Bacteria | 18259 |
| 121 | Ga0114129_11001580 | 3300009147 | Bacteria | 1052 |
| 122 | Ga0105242_10450027 | 3300009176 | Bacteria | 1214 |
| 123 | Ga0105242_10513773 | 3300009176 | Bacteria | 1142 |
| 124 | Ga0105242_11314701 | 3300009176 | Bacteria | 747 |
| 125 | Ga0105242_12981663 | 3300009176 | Unclassified | 524 |
| 126 | Ga0105248_11883484 | 3300009177 | Unclassified | 679 |
| 127 | Ga0105238_10000093 | 3300009551 | Bacteria | 100560 |
| 128 | Ga0105249_10082733 | 3300009553 | Bacteria | 2987 |
| 129 | Ga0105249_10205890 | 3300009553 | Bacteria | 1928 |
| 130 | Ga0105249_10478794 | 3300009553 | Bacteria | 1287 |
| 131 | Ga0105249_10839159 | 3300009553 | Bacteria | 984 |
| 132 | Ga0105239_10380210 | 3300010375 | Bacteria | 1596 |
| 133 | Ga0105246_11103266 | 3300011119 | Bacteria | 725 |
| 134 | Ga0163162_11040375 | 3300013306 | Bacteria | 926 |
| 135 | Ga0157372_10408583 | 3300013307 | Bacteria | 1582 |
| 136 | Ga0157375_10266526 | 3300013308 | Bacteria | 1874 |
| 137 | Ga0157375_10860387 | 3300013308 | Unclassified | 1053 |
| 138 | Ga0163163_10241961 | 3300014325 | Unclassified | 1854 |
| 139 | Ga0163163_12278460 | 3300014325 | Bacteria | 600 |
| 140 | Ga0182008_10024961 | 3300014497 | Bacteria | 3040 |
| 141 | Ga0157377_10307809 | 3300014745 | Unclassified | 1048 |
| 142 | Ga0206353_10944787 | 3300020082 | Bacteria | 1582 |
| 143 | Ga0213876_10574207 | 3300021384 | Unclassified | 600 |
| 144 | Ga0207682_10031549 | 3300025893 | Bacteria | 2127 |
| 145 | Ga0207680_10177536 | 3300025903 | Bacteria | 1438 |
| 146 | Ga0207684_10352551 | 3300025910 | Bacteria | 1267 |
| 147 | Ga0207684_10773587 | 3300025910 | Bacteria | 813 |
| 148 | Ga0207660_10089121 | 3300025917 | Bacteria | 2283 |
| 149 | Ga0207662_10386105 | 3300025918 | Bacteria | 947 |
| 150 | Ga0207662_10977914 | 3300025918 | Unclassified | 600 |
| 151 | Ga0207652_10085806 | 3300025921 | Bacteria | 2759 |
| 152 | Ga0207646_10610711 | 3300025922 | Bacteria | 979 |
| 153 | Ga0207681_10199170 | 3300025923 | Bacteria | 1536 |
| 154 | Ga0207681_11011380 | 3300025923 | Bacteria | 697 |
| 155 | Ga0207694_10000017 | 3300025924 | Bacteria | 342100 |
| 156 | Ga0207650_10142085 | 3300025925 | Unclassified | 1888 |
| 157 | Ga0207650_11778675 | 3300025925 | Unclassified | 521 |
| 158 | Ga0207659_11130933 | 3300025926 | Bacteria | 674 |
| 159 | Ga0207706_10068284 | 3300025933 | Bacteria | 3128 |
| 160 | Ga0207706_10077604 | 3300025933 | Bacteria | 2921 |
| 161 | Ga0207706_11255956 | 3300025933 | Bacteria | 613 |
| 162 | Ga0207686_10220367 | 3300025934 | Bacteria | 1370 |
| 163 | Ga0207670_10157384 | 3300025936 | Bacteria | 1692 |
| 164 | Ga0207670_10232699 | 3300025936 | Unclassified | 1416 |
| 165 | Ga0207670_10431046 | 3300025936 | Unclassified | 1060 |
| 166 | Ga0207704_10221779 | 3300025938 | Bacteria | 1400 |
| 167 | Ga0207691_10088260 | 3300025940 | Unclassified | 2781 |
| 168 | Ga0207679_10148744 | 3300025945 | Unclassified | 1903 |
| 169 | Ga0207679_10366371 | 3300025945 | Bacteria | 1260 |
| 170 | Ga0207651_10138998 | 3300025960 | Bacteria | 1873 |
| 171 | Ga0207712_10090043 | 3300025961 | Bacteria | 2257 |
| 172 | Ga0207712_10463590 | 3300025961 | Bacteria | 1077 |
| 173 | Ga0207668_10226593 | 3300025972 | Bacteria | 1504 |
| 174 | Ga0207668_10367019 | 3300025972 | Bacteria | 1208 |
| 175 | Ga0207708_10037134 | 3300026075 | Bacteria | 3711 |
| 176 | Ga0207708_10543375 | 3300026075 | Unclassified | 979 |
| 177 | Ga0207708_11830421 | 3300026075 | Bacteria | 532 |
| 178 | Ga0207641_10220497 | 3300026088 | Bacteria | 1758 |
| 179 | Ga0207641_10596744 | 3300026088 | Unclassified | 1081 |
| 180 | Ga0207676_10030731 | 3300026095 | Bacteria | 4035 |
| 181 | Ga0207676_10157048 | 3300026095 | Bacteria | 1966 |
| 182 | Ga0207676_10387224 | 3300026095 | Bacteria | 1303 |
| 183 | Ga0207676_10946852 | 3300026095 | Bacteria | 846 |
| 184 | Ga0207674_10009663 | 3300026116 | Bacteria | 10998 |
| 185 | Ga0207674_10372100 | 3300026116 | Viruses | 1381 |
| 186 | Ga0207674_10750157 | 3300026116 | Bacteria | 942 |
| 187 | Ga0207675_100023834 | 3300026118 | Bacteria | 5692 |
| 188 | Ga0207675_100653309 | 3300026118 | Bacteria | 1058 |
| 189 | Ga0207675_101634659 | 3300026118 | Bacteria | 664 |
| 190 | Ga0207698_11083722 | 3300026142 | Bacteria | 813 |
| 191 | Ga0207428_10033458 | 3300027907 | Bacteria | 4221 |
| 192 | Ga0207428_10303163 | 3300027907 | Bacteria | 1182 |
| 193 | Ga0268265_10012074 | 3300028380 | Bacteria | 5849 |
| 194 | Ga0268265_10556460 | 3300028380 | Bacteria | 1090 |
| 195 | Ga0268265_10852920 | 3300028380 | Bacteria | 891 |
| 196 | Ga0268265_11326887 | 3300028380 | Unclassified | 720 |
| 197 | Ga0268264_10518578 | 3300028381 | Bacteria | 1165 |
| 198 | Ga0265325_10429857 | 3300031241 | Bacteria | 576 |
| 199 | Ga0307408_101212958 | 3300031548 | Bacteria | 704 |
| 200 | Ga0316579_10030684 | 3300031691 | Unclassified | 2458 |
| 201 | Ga0316578_10277146 | 3300031728 | Unclassified | 1004 |
| 202 | Ga0307405_11053987 | 3300031731 | Bacteria | 696 |
| 203 | Ga0307409_100023185 | 3300031995 | Bacteria | 4295 |
| 204 | Ga0307409_100759407 | 3300031995 | Unclassified | 974 |
| 205 | Ga0307409_101954295 | 3300031995 | Unclassified | 616 |
| 206 | Ga0307414_11030559 | 3300032004 | Bacteria | 758 |
| 207 | Ga0307411_10326067 | 3300032005 | Bacteria | 1242 |
| 208 | Ga0307415_100611937 | 3300032126 | Bacteria | 971 |
| 209 | Ga0316583_10046639 | 3300032133 | Bacteria | 1529 |
| 210 | Ga0373936_0077601 | 3300035113 | Bacteria | 1378 |
| 211 | Ga0373941_0062064 | 3300035115 | Bacteria | 1219 |
| 212 | Ga0373954_0513916 | 3300035118 | Unclassified | 593 |
| 213 | Ga0373960_0393420 | 3300035121 | Bacteria | 533 |
| 214 | Ga0373961_0017432 | 3300035241 | Bacteria | 1863 |
| 215 | Ga0373931_0008662 | 3300035691 | Bacteria | 4836 |
| 216 | Ga0373931_0115611 | 3300035691 | Bacteria | 1527 |
| 217 | Ga0373931_0429829 | 3300035691 | Bacteria | 841 |
| 218 | Ga0373937_0059804 | 3300036401 | Bacteria | 3502 |
| 219 | Ga0373937_0475613 | 3300036401 | Bacteria | 1187 |
| 220 | Ga0373925_0039912 | 3300037068 | Bacteria | 3474 |
| 221 | Ga0373925_0354413 | 3300037068 | Bacteria | 1192 |
| 222 | Ga0451797_0780668 | 3300041453 | Bacteria | 724 |
| 223 | Ga0439433_0018293 | 3300041999 | Bacteria | 1560 |
| 224 | Ga0450896_011127 | 3300042133 | Bacteria | 1265 |
| 225 | Ga0439444_0011988 | 3300042437 | Bacteria | 1414 |
| 226 | Ga0439459_0134321 | 3300042438 | Bacteria | 635 |
| 227 | Ga0466969_0310098 | 3300044656 | Bacteria | 714 |
| 228 | Ga0466961_0065290 | 3300044693 | Bacteria | 2312 |
| 229 | Ga0453684_0223138 | 3300044712 | Bacteria | 2181 |
| 230 | Ga0453684_2044825 | 3300044712 | Unclassified | 576 |
| 231 | Ga0451576_0156648 | 3300045051 | Unclassified | 2376 |
| 232 | Ga0451576_0195240 | 3300045051 | Bacteria | 2114 |
| 233 | Ga0451576_0458148 | 3300045051 | Bacteria | 1339 |
| 234 | Ga0451576_1752255 | 3300045051 | Bacteria | 643 |
| 235 | Ga0466967_0254955 | 3300045976 | Bacteria | 1677 |
| 236 | Ga0466967_0550460 | 3300045976 | Bacteria | 1136 |
| 237 | Ga0495582_0066059 | 3300046473 | Bacteria | 1998 |
| 238 | Ga0495586_0108326 | 3300046535 | Bacteria | 1545 |
| 239 | Ga0495598_0053077 | 3300046537 | Bacteria | 1227 |
| 240 | Ga0495658_0153481 | 3300046683 | Bacteria | 1416 |
| 241 | Ga0495613_0223457 | 3300046689 | Bacteria | 1321 |
| 242 | Ga0495680_1063095 | 3300047322 | Bacteria | 513 |
| 243 | Ga0495593_0292651 | 3300047673 | Bacteria | 814 |
| 244 | Ga0496102_0188376 | 3300048905 | Bacteria | 1944 |
| 245 | Ga0496102_0193762 | 3300048905 | Bacteria | 1915 |
| 246 | Ga0496104_0004413 | 3300048907 | Bacteria | 12257 |
| 247 | Ga0496104_0937373 | 3300048907 | Bacteria | 770 |
| 248 | Ga0496105_0347170 | 3300048908 | Bacteria | 1186 |
| 249 | Ga0496105_1202484 | 3300048908 | Unclassified | 558 |
| 250 | Ga0496106_1365189 | 3300048909 | Bacteria | 548 |
| 251 | Ga0496107_0265935 | 3300048910 | Bacteria | 1276 |
| 252 | Ga0496108_0000437 | 3300048911 | Bacteria | 33604 |
| 253 | Ga0496108_0050055 | 3300048911 | Bacteria | 3496 |
| 254 | Ga0496108_0413459 | 3300048911 | Bacteria | 1178 |
| 255 | Ga0496109_0001402 | 3300048912 | Bacteria | 19977 |
| 256 | Ga0496109_0018312 | 3300048912 | Bacteria | 6152 |
| 257 | Ga0496109_0116073 | 3300048912 | Bacteria | 2491 |
| 258 | Ga0496110_0024620 | 3300048913 | Bacteria | 5133 |
| 259 | Ga0496111_0014925 | 3300048914 | Bacteria | 5319 |
| 260 | Ga0496112_0001565 | 3300048915 | Bacteria | 17667 |
| 261 | Ga0496112_0329214 | 3300048915 | Bacteria | 1471 |
| 262 | Ga0496112_0343965 | 3300048915 | Bacteria | 1435 |
| 263 | Ga0496112_1205072 | 3300048915 | Bacteria | 674 |
| 264 | Ga0496113_0000618 | 3300048916 | Bacteria | 17834 |
| 265 | Ga0496113_0002365 | 3300048916 | Bacteria | 10929 |
| 266 | Ga0501309_009813 | 3300049129 | Unclassified | 1227 |
| 267 | Ga0501312_014561 | 3300049528 | Bacteria | 1107 |
| 268 | Ga0501321_021307 | 3300049537 | Bacteria | 808 |
| 269 | Ga0501036_0452186 | 3300049572 | Unclassified | 1070 |
| 270 | Ga0501069_0537430 | 3300049585 | Bacteria | 699 |
| 271 | Ga0501071_1576720 | 3300049587 | Unclassified | 507 |
| 272 | Ga0501045_1050925 | 3300049824 | Bacteria | 596 |
| 273 | nmdc:mga0k408_102055_c1 | 3300050493 | Bacteria | 1692 |
| 274 | nmdc:mga0k408_144469_c1 | 3300050493 | Bacteria | 1416 |
| 275 | nmdc:mga06z11_2244_c1 | 3300050494 | Bacteria | 7348 |
| 276 | nmdc:mga07m45_55651_c1 | 3300050496 | Bacteria | 2236 |
| 277 | nmdc:mga05p37_66552_c1 | 3300050507 | Bacteria | 4432 |
| 278 | nmdc:mga09592_936948_c1 | 3300050508 | Bacteria | 726 |
| 279 | nmdc:mga06r32_1547379_c1 | 3300050510 | Bacteria | 603 |
| 280 | nmdc:mga06r32_224893_c1 | 3300050510 | Bacteria | 1865 |
| 281 | nmdc:mga08y16_1079725_c1 | 3300050511 | Bacteria | 779 |
| 282 | nmdc:mga08y16_1226909_c1 | 3300050511 | Bacteria | 720 |
| 283 | nmdc:mga08y16_37099_c1 | 3300050511 | Bacteria | 5118 |
| 284 | nmdc:mga08y16_565399_c1 | 3300050511 | Bacteria | 1149 |
| 285 | nmdc:mga0n895_165758_c1 | 3300050512 | Bacteria | 2241 |
| 286 | nmdc:mga0n895_1866087_c1 | 3300050512 | Bacteria | 561 |
| 287 | nmdc:mga0rr50_129221_c1 | 3300050513 | Bacteria | 2020 |
| 288 | nmdc:mga0rr50_318093_c1 | 3300050513 | Bacteria | 1304 |
| 289 | nmdc:mga0rr50_589871_c1 | 3300050513 | Bacteria | 947 |
| 290 | nmdc:mga08x19_375230_c1 | 3300050514 | Bacteria | 996 |
| 291 | nmdc:mga0a205_1181326_c1 | 3300050515 | Bacteria | 613 |
| 292 | nmdc:mga0a205_168610_c1 | 3300050515 | Unclassified | 2085 |
| 293 | nmdc:mga0a205_391701_c1 | 3300050515 | Bacteria | 1254 |
| 294 | Ga0500641_0040719 | 3300053096 | Bacteria | 1877 |
| 295 | Ga0501082_1051647 | 3300060353 | Bacteria | 712 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009176 | Ga0105242_10513773 | Ga0105242_105137732 | 109 |
| 2 | 3300005336 | Ga0070680_100019408 | Ga0070680_1000194086 | 118 |
| 3 | 3300005530 | Ga0070679_100088060 | Ga0070679_1000880602 | 118 |
| 4 | 3300013307 | Ga0157372_10408583 | Ga0157372_104085833 | 118 |
| 5 | 3300020082 | Ga0206353_10944787 | Ga0206353_109447872 | 118 |
| 6 | 3300025917 | Ga0207660_10089121 | Ga0207660_100891212 | 118 |
| 7 | 3300025921 | Ga0207652_10085806 | Ga0207652_100858062 | 118 |
| 8 | 3300041999 | Ga0439433_0018293 | Ga0439433_0018293_559_915 | 118 |
| 9 | 3300005458 | Ga0070681_10765201 | Ga0070681_107652012 | 119 |
| 10 | 3300044712 | Ga0453684_0223138 | Ga0453684_0223138_870_1232 | 119 |
| 11 | 3300003316 | rootH1_10164325 | rootH1_101643253 | 120 |
| 12 | 3300004803 | Ga0058862_12539817 | Ga0058862_125398172 | 120 |
| 13 | 3300005288 | Ga0065714_10270213 | Ga0065714_102702132 | 120 |
| 14 | 3300005289 | Ga0065704_10636954 | Ga0065704_106369542 | 120 |
| 15 | 3300005290 | Ga0065712_10129425 | Ga0065712_101294252 | 120 |
| 16 | 3300005331 | Ga0070670_100214381 | Ga0070670_1002143813 | 120 |
| 17 | 3300005331 | Ga0070670_100255810 | Ga0070670_1002558102 | 120 |
| 18 | 3300005340 | Ga0070689_100156494 | Ga0070689_1001564943 | 120 |
| 19 | 3300005340 | Ga0070689_100502059 | Ga0070689_1005020592 | 120 |
| 20 | 3300005347 | Ga0070668_100227769 | Ga0070668_1002277692 | 120 |
| 21 | 3300005354 | Ga0070675_101144934 | Ga0070675_1011449341 | 120 |
| 22 | 3300005356 | Ga0070674_100693917 | Ga0070674_1006939172 | 120 |
| 23 | 3300005365 | Ga0070688_101184977 | Ga0070688_1011849771 | 120 |
| 24 | 3300005440 | Ga0070705_100350524 | Ga0070705_1003505242 | 120 |
| 25 | 3300005440 | Ga0070705_100725290 | Ga0070705_1007252902 | 120 |
| 26 | 3300005441 | Ga0070700_100022937 | Ga0070700_1000229373 | 120 |
| 27 | 3300005441 | Ga0070700_100536758 | Ga0070700_1005367582 | 120 |
| 28 | 3300005444 | Ga0070694_101098761 | Ga0070694_1010987612 | 120 |
| 29 | 3300005458 | Ga0070681_11235495 | Ga0070681_112354951 | 120 |
| 30 | 3300005459 | Ga0068867_100312199 | Ga0068867_1003121991 | 120 |
| 31 | 3300005466 | Ga0070685_10001188 | Ga0070685_1000118814 | 120 |
| 32 | 3300005530 | Ga0070679_100495212 | Ga0070679_1004952122 | 120 |
| 33 | 3300005544 | Ga0070686_100000029 | Ga0070686_10000002925 | 120 |
| 34 | 3300005549 | Ga0070704_101262562 | Ga0070704_1012625622 | 120 |
| 35 | 3300005564 | Ga0070664_100598457 | Ga0070664_1005984572 | 120 |
| 36 | 3300005564 | Ga0070664_101339732 | Ga0070664_1013397322 | 120 |
| 37 | 3300005577 | Ga0068857_100097956 | Ga0068857_1000979561 | 120 |
| 38 | 3300005617 | Ga0068859_101881231 | Ga0068859_1018812312 | 120 |
| 39 | 3300005618 | Ga0068864_101072686 | Ga0068864_1010726862 | 120 |
| 40 | 3300005719 | Ga0068861_100075231 | Ga0068861_1000752313 | 120 |
| 41 | 3300005841 | Ga0068863_100191771 | Ga0068863_1001917712 | 120 |
| 42 | 3300005841 | Ga0068863_100349610 | Ga0068863_1003496102 | 120 |
| 43 | 3300005841 | Ga0068863_102182879 | Ga0068863_1021828791 | 120 |
| 44 | 3300005843 | Ga0068860_100544641 | Ga0068860_1005446413 | 120 |
| 45 | 3300006042 | Ga0075368_10083451 | Ga0075368_100834512 | 120 |
| 46 | 3300006195 | Ga0075366_10010478 | Ga0075366_100104784 | 120 |
| 47 | 3300006195 | Ga0075366_10052370 | Ga0075366_100523702 | 120 |
| 48 | 3300006844 | Ga0075428_101444689 | Ga0075428_1014446892 | 120 |
| 49 | 3300006846 | Ga0075430_100529485 | Ga0075430_1005294852 | 120 |
| 50 | 3300006847 | Ga0075431_100226191 | Ga0075431_1002261912 | 120 |
| 51 | 3300006847 | Ga0075431_100664789 | Ga0075431_1006647891 | 120 |
| 52 | 3300006847 | Ga0075431_101374935 | Ga0075431_1013749352 | 120 |
| 53 | 3300006852 | Ga0075433_10452842 | Ga0075433_104528421 | 120 |
| 54 | 3300006871 | Ga0075434_100173563 | Ga0075434_1001735633 | 120 |
| 55 | 3300006871 | Ga0075434_100499606 | Ga0075434_1004996061 | 120 |
| 56 | 3300006871 | Ga0075434_100703197 | Ga0075434_1007031972 | 120 |
| 57 | 3300006881 | Ga0068865_100935356 | Ga0068865_1009353562 | 120 |
| 58 | 3300006914 | Ga0075436_100326889 | Ga0075436_1003268891 | 120 |
| 59 | 3300006931 | Ga0097620_101880486 | Ga0097620_1018804862 | 120 |
| 60 | 3300007076 | Ga0075435_100067890 | Ga0075435_1000678905 | 120 |
| 61 | 3300007076 | Ga0075435_100404768 | Ga0075435_1004047682 | 120 |
| 62 | 3300007076 | Ga0075435_101861036 | Ga0075435_1018610361 | 120 |
| 63 | 3300007265 | Ga0099794_10463625 | Ga0099794_104636252 | 120 |
| 64 | 3300009011 | Ga0105251_10570983 | Ga0105251_105709831 | 120 |
| 65 | 3300009094 | Ga0111539_10047502 | Ga0111539_100475022 | 120 |
| 66 | 3300009094 | Ga0111539_10128780 | Ga0111539_101287802 | 120 |
| 67 | 3300009094 | Ga0111539_12558650 | Ga0111539_125586501 | 120 |
| 68 | 3300009147 | Ga0114129_10005251 | Ga0114129_100052518 | 120 |
| 69 | 3300009176 | Ga0105242_10450027 | Ga0105242_104500272 | 120 |
| 70 | 3300009176 | Ga0105242_11314701 | Ga0105242_113147011 | 120 |
| 71 | 3300009176 | Ga0105242_12981663 | Ga0105242_129816631 | 120 |
| 72 | 3300009551 | Ga0105238_10000093 | Ga0105238_1000009329 | 120 |
| 73 | 3300009553 | Ga0105249_10082733 | Ga0105249_100827332 | 120 |
| 74 | 3300009553 | Ga0105249_10205890 | Ga0105249_102058903 | 120 |
| 75 | 3300010375 | Ga0105239_10380210 | Ga0105239_103802101 | 120 |
| 76 | 3300011119 | Ga0105246_11103266 | Ga0105246_111032661 | 120 |
| 77 | 3300013306 | Ga0163162_11040375 | Ga0163162_110403751 | 120 |
| 78 | 3300014325 | Ga0163163_12278460 | Ga0163163_122784601 | 120 |
| 79 | 3300025910 | Ga0207684_10773587 | Ga0207684_107735871 | 120 |
| 80 | 3300025918 | Ga0207662_10386105 | Ga0207662_103861052 | 120 |
| 81 | 3300025923 | Ga0207681_10199170 | Ga0207681_101991702 | 120 |
| 82 | 3300025923 | Ga0207681_11011380 | Ga0207681_110113802 | 120 |
| 83 | 3300025924 | Ga0207694_10000017 | Ga0207694_1000001729 | 120 |
| 84 | 3300025925 | Ga0207650_11778675 | Ga0207650_117786751 | 120 |
| 85 | 3300025933 | Ga0207706_11255956 | Ga0207706_112559561 | 120 |
| 86 | 3300025934 | Ga0207686_10220367 | Ga0207686_102203671 | 120 |
| 87 | 3300025936 | Ga0207670_10157384 | Ga0207670_101573843 | 120 |
| 88 | 3300025936 | Ga0207670_10232699 | Ga0207670_102326991 | 120 |
| 89 | 3300025936 | Ga0207670_10431046 | Ga0207670_104310462 | 120 |
| 90 | 3300025938 | Ga0207704_10221779 | Ga0207704_102217792 | 120 |
| 91 | 3300025945 | Ga0207679_10366371 | Ga0207679_103663712 | 120 |
| 92 | 3300025961 | Ga0207712_10090043 | Ga0207712_100900432 | 120 |
| 93 | 3300025972 | Ga0207668_10226593 | Ga0207668_102265932 | 120 |
| 94 | 3300026075 | Ga0207708_10037134 | Ga0207708_100371342 | 120 |
| 95 | 3300026075 | Ga0207708_11830421 | Ga0207708_118304212 | 120 |
| 96 | 3300026088 | Ga0207641_10220497 | Ga0207641_102204972 | 120 |
| 97 | 3300026095 | Ga0207676_10387224 | Ga0207676_103872243 | 120 |
| 98 | 3300026095 | Ga0207676_10946852 | Ga0207676_109468522 | 120 |
| 99 | 3300026116 | Ga0207674_10009663 | Ga0207674_100096634 | 120 |
| 100 | 3300026116 | Ga0207674_10750157 | Ga0207674_107501572 | 120 |
| 101 | 3300026118 | Ga0207675_100023834 | Ga0207675_1000238346 | 120 |
| 102 | 3300026118 | Ga0207675_100653309 | Ga0207675_1006533091 | 120 |
| 103 | 3300026142 | Ga0207698_11083722 | Ga0207698_110837222 | 120 |
| 104 | 3300027907 | Ga0207428_10033458 | Ga0207428_100334582 | 120 |
| 105 | 3300028380 | Ga0268265_10012074 | Ga0268265_100120742 | 120 |
| 106 | 3300028381 | Ga0268264_10518578 | Ga0268264_105185781 | 120 |
| 107 | 3300032005 | Ga0307411_10326067 | Ga0307411_103260672 | 120 |
| 108 | 3300035115 | Ga0373941_0062064 | Ga0373941_0062064_695_1057 | 120 |
| 109 | 3300035118 | Ga0373954_0513916 | Ga0373954_0513916_150_512 | 120 |
| 110 | 3300035121 | Ga0373960_0393420 | Ga0373960_0393420_41_403 | 120 |
| 111 | 3300035241 | Ga0373961_0017432 | Ga0373961_0017432_1015_1377 | 120 |
| 112 | 3300035691 | Ga0373931_0008662 | Ga0373931_0008662_4266_4628 | 120 |
| 113 | 3300035691 | Ga0373931_0115611 | Ga0373931_0115611_606_968 | 120 |
| 114 | 3300035691 | Ga0373931_0429829 | Ga0373931_0429829_135_497 | 120 |
| 115 | 3300036401 | Ga0373937_0059804 | Ga0373937_0059804_2984_3346 | 120 |
| 116 | 3300037068 | Ga0373925_0039912 | Ga0373925_0039912_2766_3128 | 120 |
| 117 | 3300037068 | Ga0373925_0354413 | Ga0373925_0354413_739_1101 | 120 |
| 118 | 3300041453 | Ga0451797_0780668 | Ga0451797_0780668_279_641 | 120 |
| 119 | 3300042133 | Ga0450896_011127 | Ga0450896_011127_44_406 | 120 |
| 120 | 3300042437 | Ga0439444_0011988 | Ga0439444_0011988_12_374 | 120 |
| 121 | 3300042438 | Ga0439459_0134321 | Ga0439459_0134321_171_533 | 120 |
| 122 | 3300044712 | Ga0453684_2044825 | Ga0453684_2044825_60_422 | 120 |
| 123 | 3300045051 | Ga0451576_0156648 | Ga0451576_0156648_1651_2013 | 120 |
| 124 | 3300045051 | Ga0451576_0195240 | Ga0451576_0195240_347_709 | 120 |
| 125 | 3300045051 | Ga0451576_0458148 | Ga0451576_0458148_578_940 | 120 |
| 126 | 3300045051 | Ga0451576_1752255 | Ga0451576_1752255_65_427 | 120 |
| 127 | 3300045976 | Ga0466967_0550460 | Ga0466967_0550460_19_381 | 120 |
| 128 | 3300046473 | Ga0495582_0066059 | Ga0495582_0066059_457_819 | 120 |
| 129 | 3300046535 | Ga0495586_0108326 | Ga0495586_0108326_805_1167 | 120 |
| 130 | 3300046683 | Ga0495658_0153481 | Ga0495658_0153481_494_856 | 120 |
| 131 | 3300046689 | Ga0495613_0223457 | Ga0495613_0223457_150_512 | 120 |
| 132 | 3300047322 | Ga0495680_1063095 | Ga0495680_1063095_91_453 | 120 |
| 133 | 3300047673 | Ga0495593_0292651 | Ga0495593_0292651_241_603 | 120 |
| 134 | 3300048905 | Ga0496102_0188376 | Ga0496102_0188376_87_449 | 120 |
| 135 | 3300048905 | Ga0496102_0193762 | Ga0496102_0193762_937_1299 | 120 |
| 136 | 3300048907 | Ga0496104_0004413 | Ga0496104_0004413_8563_8925 | 120 |
| 137 | 3300048907 | Ga0496104_0937373 | Ga0496104_0937373_168_530 | 120 |
| 138 | 3300048908 | Ga0496105_0347170 | Ga0496105_0347170_667_1029 | 120 |
| 139 | 3300048908 | Ga0496105_1202484 | Ga0496105_1202484_60_422 | 120 |
| 140 | 3300048909 | Ga0496106_1365189 | Ga0496106_1365189_111_473 | 120 |
| 141 | 3300048910 | Ga0496107_0265935 | Ga0496107_0265935_861_1223 | 120 |
| 142 | 3300048911 | Ga0496108_0000437 | Ga0496108_0000437_8828_9190 | 120 |
| 143 | 3300048911 | Ga0496108_0050055 | Ga0496108_0050055_2077_2439 | 120 |
| 144 | 3300048911 | Ga0496108_0413459 | Ga0496108_0413459_181_543 | 120 |
| 145 | 3300048912 | Ga0496109_0001402 | Ga0496109_0001402_1815_2177 | 120 |
| 146 | 3300048912 | Ga0496109_0018312 | Ga0496109_0018312_5371_5733 | 120 |
| 147 | 3300048912 | Ga0496109_0116073 | Ga0496109_0116073_94_456 | 120 |
| 148 | 3300048913 | Ga0496110_0024620 | Ga0496110_0024620_4006_4368 | 120 |
| 149 | 3300048914 | Ga0496111_0014925 | Ga0496111_0014925_1054_1416 | 120 |
| 150 | 3300048915 | Ga0496112_0001565 | Ga0496112_0001565_13512_13874 | 120 |
| 151 | 3300048915 | Ga0496112_0329214 | Ga0496112_0329214_1069_1431 | 120 |
| 152 | 3300048915 | Ga0496112_0343965 | Ga0496112_0343965_483_845 | 120 |
| 153 | 3300048915 | Ga0496112_1205072 | Ga0496112_1205072_149_511 | 120 |
| 154 | 3300048916 | Ga0496113_0000618 | Ga0496113_0000618_3622_3984 | 120 |
| 155 | 3300048916 | Ga0496113_0002365 | Ga0496113_0002365_9515_9877 | 120 |
| 156 | 3300049129 | Ga0501309_009813 | Ga0501309_009813_91_453 | 120 |
| 157 | 3300049528 | Ga0501312_014561 | Ga0501312_014561_120_482 | 120 |
| 158 | 3300049537 | Ga0501321_021307 | Ga0501321_021307_106_468 | 120 |
| 159 | 3300049572 | Ga0501036_0452186 | Ga0501036_0452186_188_550 | 120 |
| 160 | 3300049585 | Ga0501069_0537430 | Ga0501069_0537430_225_587 | 120 |
| 161 | 3300049587 | Ga0501071_1576720 | Ga0501071_1576720_44_406 | 120 |
| 162 | 3300049824 | Ga0501045_1050925 | Ga0501045_1050925_191_553 | 120 |
| 163 | 3300050493 | nmdc:mga0k408_102055_c1 | nmdc:mga0k408_102055_c1_569_931 | 120 |
| 164 | 3300050493 | nmdc:mga0k408_144469_c1 | nmdc:mga0k408_144469_c1_502_864 | 120 |
| 165 | 3300050494 | nmdc:mga06z11_2244_c1 | nmdc:mga06z11_2244_c1_2102_2464 | 120 |
| 166 | 3300050496 | nmdc:mga07m45_55651_c1 | nmdc:mga07m45_55651_c1_1473_1835 | 120 |
| 167 | 3300050508 | nmdc:mga09592_936948_c1 | nmdc:mga09592_936948_c1_223_585 | 120 |
| 168 | 3300050510 | nmdc:mga06r32_1547379_c1 | nmdc:mga06r32_1547379_c1_38_400 | 120 |
| 169 | 3300050510 | nmdc:mga06r32_224893_c1 | nmdc:mga06r32_224893_c1_802_1164 | 120 |
| 170 | 3300050511 | nmdc:mga08y16_37099_c1 | nmdc:mga08y16_37099_c1_771_1133 | 120 |
| 171 | 3300050512 | nmdc:mga0n895_165758_c1 | nmdc:mga0n895_165758_c1_168_530 | 120 |
| 172 | 3300050513 | nmdc:mga0rr50_129221_c1 | nmdc:mga0rr50_129221_c1_359_721 | 120 |
| 173 | 3300050513 | nmdc:mga0rr50_318093_c1 | nmdc:mga0rr50_318093_c1_81_443 | 120 |
| 174 | 3300050513 | nmdc:mga0rr50_589871_c1 | nmdc:mga0rr50_589871_c1_94_456 | 120 |
| 175 | 3300050514 | nmdc:mga08x19_375230_c1 | nmdc:mga08x19_375230_c1_211_573 | 120 |
| 176 | 3300053096 | Ga0500641_0040719 | Ga0500641_0040719_835_1197 | 120 |
| 177 | 3300060353 | Ga0501082_1051647 | Ga0501082_1051647_33_395 | 120 |
| 178 | 2162886006 | SwRhRL3b_contig_1470594 | SwRhRL3b_0005.00001870 | 121 |
| 179 | 3300005295 | Ga0065707_10103682 | Ga0065707_101036823 | 121 |
| 180 | 3300005330 | Ga0070690_100008833 | Ga0070690_1000088333 | 121 |
| 181 | 3300005331 | Ga0070670_100044319 | Ga0070670_1000443191 | 121 |
| 182 | 3300005331 | Ga0070670_100161906 | Ga0070670_1001619061 | 121 |
| 183 | 3300005331 | Ga0070670_100228480 | Ga0070670_1002284802 | 121 |
| 184 | 3300005331 | Ga0070670_101235259 | Ga0070670_1012352592 | 121 |
| 185 | 3300005333 | Ga0070677_10152594 | Ga0070677_101525942 | 121 |
| 186 | 3300005335 | Ga0070666_10425818 | Ga0070666_104258181 | 121 |
| 187 | 3300005336 | Ga0070680_100436188 | Ga0070680_1004361881 | 121 |
| 188 | 3300005340 | Ga0070689_100947633 | Ga0070689_1009476331 | 121 |
| 189 | 3300005340 | Ga0070689_102026290 | Ga0070689_1020262901 | 121 |
| 190 | 3300005345 | Ga0070692_10282649 | Ga0070692_102826492 | 121 |
| 191 | 3300005353 | Ga0070669_100662309 | Ga0070669_1006623092 | 121 |
| 192 | 3300005354 | Ga0070675_100027513 | Ga0070675_1000275134 | 121 |
| 193 | 3300005364 | Ga0070673_100215305 | Ga0070673_1002153053 | 121 |
| 194 | 3300005364 | Ga0070673_101714325 | Ga0070673_1017143251 | 121 |
| 195 | 3300005367 | Ga0070667_100172045 | Ga0070667_1001720451 | 121 |
| 196 | 3300005438 | Ga0070701_10233293 | Ga0070701_102332931 | 121 |
| 197 | 3300005444 | Ga0070694_100188764 | Ga0070694_1001887642 | 121 |
| 198 | 3300005444 | Ga0070694_100629450 | Ga0070694_1006294501 | 121 |
| 199 | 3300005456 | Ga0070678_100303398 | Ga0070678_1003033982 | 121 |
| 200 | 3300005457 | Ga0070662_100067199 | Ga0070662_1000671994 | 121 |
| 201 | 3300005457 | Ga0070662_100647755 | Ga0070662_1006477551 | 121 |
| 202 | 3300005466 | Ga0070685_10002525 | Ga0070685_100025255 | 121 |
| 203 | 3300005466 | Ga0070685_10751337 | Ga0070685_107513371 | 121 |
| 204 | 3300005466 | Ga0070685_11546114 | Ga0070685_115461141 | 121 |
| 205 | 3300005467 | Ga0070706_100387934 | Ga0070706_1003879342 | 121 |
| 206 | 3300005468 | Ga0070707_100336265 | Ga0070707_1003362652 | 121 |
| 207 | 3300005468 | Ga0070707_102177053 | Ga0070707_1021770531 | 121 |
| 208 | 3300005518 | Ga0070699_100055680 | Ga0070699_1000556803 | 121 |
| 209 | 3300005539 | Ga0068853_101345968 | Ga0068853_1013459681 | 121 |
| 210 | 3300005543 | Ga0070672_100125775 | Ga0070672_1001257752 | 121 |
| 211 | 3300005543 | Ga0070672_100793445 | Ga0070672_1007934452 | 121 |
| 212 | 3300005546 | Ga0070696_100140296 | Ga0070696_1001402963 | 121 |
| 213 | 3300005564 | Ga0070664_100249380 | Ga0070664_1002493803 | 121 |
| 214 | 3300005577 | Ga0068857_102413562 | Ga0068857_1024135622 | 121 |
| 215 | 3300005617 | Ga0068859_100248869 | Ga0068859_1002488693 | 121 |
| 216 | 3300005617 | Ga0068859_100468450 | Ga0068859_1004684501 | 121 |
| 217 | 3300005617 | Ga0068859_102588070 | Ga0068859_1025880701 | 121 |
| 218 | 3300005618 | Ga0068864_100059342 | Ga0068864_1000593422 | 121 |
| 219 | 3300005719 | Ga0068861_100638255 | Ga0068861_1006382552 | 121 |
| 220 | 3300005719 | Ga0068861_100935575 | Ga0068861_1009355751 | 121 |
| 221 | 3300005840 | Ga0068870_10114626 | Ga0068870_101146262 | 121 |
| 222 | 3300005842 | Ga0068858_101391396 | Ga0068858_1013913962 | 121 |
| 223 | 3300005844 | Ga0068862_101264957 | Ga0068862_1012649572 | 121 |
| 224 | 3300005844 | Ga0068862_102286813 | Ga0068862_1022868131 | 121 |
| 225 | 3300005844 | Ga0068862_102342687 | Ga0068862_1023426871 | 121 |
| 226 | 3300006847 | Ga0075431_100017732 | Ga0075431_1000177323 | 121 |
| 227 | 3300006852 | Ga0075433_11012347 | Ga0075433_110123472 | 121 |
| 228 | 3300006871 | Ga0075434_102111660 | Ga0075434_1021116601 | 121 |
| 229 | 3300006880 | Ga0075429_100171515 | Ga0075429_1001715152 | 121 |
| 230 | 3300006881 | Ga0068865_100101553 | Ga0068865_1001015532 | 121 |
| 231 | 3300006931 | Ga0097620_100248863 | Ga0097620_1002488633 | 121 |
| 232 | 3300006931 | Ga0097620_100468488 | Ga0097620_1004684881 | 121 |
| 233 | 3300006931 | Ga0097620_102587774 | Ga0097620_1025877741 | 121 |
| 234 | 3300007076 | Ga0075435_100043671 | Ga0075435_1000436716 | 121 |
| 235 | 3300009094 | Ga0111539_10507715 | Ga0111539_105077153 | 121 |
| 236 | 3300009094 | Ga0111539_10539526 | Ga0111539_105395262 | 121 |
| 237 | 3300009147 | Ga0114129_11001580 | Ga0114129_110015801 | 121 |
| 238 | 3300009177 | Ga0105248_11883484 | Ga0105248_118834842 | 121 |
| 239 | 3300009553 | Ga0105249_10478794 | Ga0105249_104787942 | 121 |
| 240 | 3300009553 | Ga0105249_10839159 | Ga0105249_108391591 | 121 |
| 241 | 3300013308 | Ga0157375_10266526 | Ga0157375_102665262 | 121 |
| 242 | 3300013308 | Ga0157375_10860387 | Ga0157375_108603871 | 121 |
| 243 | 3300014325 | Ga0163163_10241961 | Ga0163163_102419613 | 121 |
| 244 | 3300014497 | Ga0182008_10024961 | Ga0182008_100249612 | 121 |
| 245 | 3300014745 | Ga0157377_10307809 | Ga0157377_103078091 | 121 |
| 246 | 3300021384 | Ga0213876_10574207 | Ga0213876_105742072 | 121 |
| 247 | 3300025893 | Ga0207682_10031549 | Ga0207682_100315493 | 121 |
| 248 | 3300025903 | Ga0207680_10177536 | Ga0207680_101775362 | 121 |
| 249 | 3300025910 | Ga0207684_10352551 | Ga0207684_103525512 | 121 |
| 250 | 3300025918 | Ga0207662_10977914 | Ga0207662_109779142 | 121 |
| 251 | 3300025922 | Ga0207646_10610711 | Ga0207646_106107111 | 121 |
| 252 | 3300025925 | Ga0207650_10142085 | Ga0207650_101420851 | 121 |
| 253 | 3300025926 | Ga0207659_11130933 | Ga0207659_111309332 | 121 |
| 254 | 3300025933 | Ga0207706_10068284 | Ga0207706_100682843 | 121 |
| 255 | 3300025933 | Ga0207706_10077604 | Ga0207706_100776042 | 121 |
| 256 | 3300025940 | Ga0207691_10088260 | Ga0207691_100882603 | 121 |
| 257 | 3300025945 | Ga0207679_10148744 | Ga0207679_101487441 | 121 |
| 258 | 3300025960 | Ga0207651_10138998 | Ga0207651_101389983 | 121 |
| 259 | 3300025961 | Ga0207712_10463590 | Ga0207712_104635902 | 121 |
| 260 | 3300025972 | Ga0207668_10367019 | Ga0207668_103670192 | 121 |
| 261 | 3300026075 | Ga0207708_10543375 | Ga0207708_105433751 | 121 |
| 262 | 3300026088 | Ga0207641_10596744 | Ga0207641_105967442 | 121 |
| 263 | 3300026095 | Ga0207676_10030731 | Ga0207676_100307313 | 121 |
| 264 | 3300026095 | Ga0207676_10157048 | Ga0207676_101570481 | 121 |
| 265 | 3300026116 | Ga0207674_10372100 | Ga0207674_103721003 | 121 |
| 266 | 3300026118 | Ga0207675_101634659 | Ga0207675_1016346592 | 121 |
| 267 | 3300027907 | Ga0207428_10303163 | Ga0207428_103031632 | 121 |
| 268 | 3300028380 | Ga0268265_10556460 | Ga0268265_105564602 | 121 |
| 269 | 3300028380 | Ga0268265_10852920 | Ga0268265_108529202 | 121 |
| 270 | 3300028380 | Ga0268265_11326887 | Ga0268265_113268871 | 121 |
| 271 | 3300031241 | Ga0265325_10429857 | Ga0265325_104298571 | 121 |
| 272 | 3300031548 | Ga0307408_101212958 | Ga0307408_1012129581 | 121 |
| 273 | 3300031691 | Ga0316579_10030684 | Ga0316579_100306843 | 121 |
| 274 | 3300031728 | Ga0316578_10277146 | Ga0316578_102771461 | 121 |
| 275 | 3300031731 | Ga0307405_11053987 | Ga0307405_110539871 | 121 |
| 276 | 3300031995 | Ga0307409_100023185 | Ga0307409_1000231854 | 121 |
| 277 | 3300031995 | Ga0307409_100759407 | Ga0307409_1007594072 | 121 |
| 278 | 3300031995 | Ga0307409_101954295 | Ga0307409_1019542951 | 121 |
| 279 | 3300032004 | Ga0307414_11030559 | Ga0307414_110305592 | 121 |
| 280 | 3300032126 | Ga0307415_100611937 | Ga0307415_1006119372 | 121 |
| 281 | 3300032133 | Ga0316583_10046639 | Ga0316583_100466393 | 121 |
| 282 | 3300035113 | Ga0373936_0077601 | Ga0373936_0077601_1001_1366 | 121 |
| 283 | 3300036401 | Ga0373937_0475613 | Ga0373937_0475613_13_378 | 121 |
| 284 | 3300044656 | Ga0466969_0310098 | Ga0466969_0310098_79_444 | 121 |
| 285 | 3300044693 | Ga0466961_0065290 | Ga0466961_0065290_637_1002 | 121 |
| 286 | 3300045976 | Ga0466967_0254955 | Ga0466967_0254955_1218_1592 | 121 |
| 287 | 3300046537 | Ga0495598_0053077 | Ga0495598_0053077_796_1167 | 121 |
| 288 | 3300050507 | nmdc:mga05p37_66552_c1 | nmdc:mga05p37_66552_c1_455_877 | 121 |
| 289 | 3300050511 | nmdc:mga08y16_1079725_c1 | nmdc:mga08y16_1079725_c1_229_600 | 121 |
| 290 | 3300050511 | nmdc:mga08y16_1226909_c1 | nmdc:mga08y16_1226909_c1_12_383 | 121 |
| 291 | 3300050511 | nmdc:mga08y16_565399_c1 | nmdc:mga08y16_565399_c1_101_466 | 121 |
| 292 | 3300050512 | nmdc:mga0n895_1866087_c1 | nmdc:mga0n895_1866087_c1_102_470 | 121 |
| 293 | 3300050515 | nmdc:mga0a205_1181326_c1 | nmdc:mga0a205_1181326_c1_207_572 | 121 |
| 294 | 3300050515 | nmdc:mga0a205_168610_c1 | nmdc:mga0a205_168610_c1_1248_1670 | 121 |
| 295 | 3300050515 | nmdc:mga0a205_391701_c1 | nmdc:mga0a205_391701_c1_794_1162 | 121 |
| 296 | iso_pu_bacteria | 2626541554 | 2626634741 | 121 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rns-assembly1.cif.gz_A | cupin 2 conserved barrel domain protein from leptotrichia buccalis | 0.914 | 19 | 108 |
| 6o2d-assembly1.cif.gz_B | schizosaccharomyces pombe cnp3 cupin domain | 0.8989 | 19 | 109 |
| 3lwc-assembly1.cif.gz_A-2 | crystal structure of structural genomics, unknown function (yp_766765.1) from rhizobium leguminosarum bv. viciae 3841 at 1.40 a resolution | 0.8932 | 19 | 109 |
| 6u4v-assembly1.cif.gz_A | non-crosslinked wild type cysteine dioxygenase | 0.8911 | 28 | 111 |
| 4axo-assembly1.cif.gz_B | structure of the clostridium difficile eutq protein | 0.8909 | 18 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3fjsA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9423 | 34 | 108 | 2.60.120.10 |
| af_P17410_9_96_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.922 | 35 | 108 | 2.60.120.10 |
| 4e2gD00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.918 | 34 | 114 | 2.60.120.10 |
| 3rnsA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9143 | 34 | 109 | 2.60.120.10 |
| af_Q9USR9_537_626_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9023 | 19 | 108 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U3L9B5-F1-model_v4 | Cupin 2, conserved barrel domain protein | 0.9983 | 1 | 120 |
|
| AF-A0A3B8YZF2-F1-model_v4 | Cupin | 0.9976 | 1 | 121 |
|
| AF-A0A7W3MY65-F1-model_v4 | Mannose-6-phosphate isomerase-like protein (Cupin superfamily) | 0.9973 | 1 | 120 |
GO:0016853
|
| AF-A0A812XGP2-F1-model_v4 | deleted | 0.9965 | 1 | 118 |
|
| AF-A0A7V1UML9-F1-model_v4 | Cupin | 0.9963 | 1 | 120 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar