F393159

General Info

Members Datasets Scaffolds Average Seq Length
296 175 295 121

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_12981663|Ga0105242_129816631
Length 141
Sequence VGFALPVLFVFRFLIEERSDAMPTLIESPSIIQAAGTKPKRIEEYAGRVNSGHSGVSVARMVSPEGWVEPGQQPEFEEITIVLKGLLRVEHQGGTLDVRSGQAVISRPGEWVRYSTPEPGGAEYVAVCLPAFSMESVHRDE

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2626541554 Frankia sp. AvcI.1 Isolate Nodule
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
113 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
124 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
129 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
130 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
131 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
132 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 1.69
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.7
Nodule 0.34
Rhizoplane 7.77
Rhizosphere 88.51
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1470594 2162886006 Bacteria 816
2 rootH1_10164325 3300003316 Bacteria 2286
3 Ga0058862_12539817 3300004803 Bacteria 637
4 Ga0065714_10270213 3300005288 Bacteria 740
5 Ga0065704_10636954 3300005289 Archaea 589
6 Ga0065712_10129425 3300005290 Bacteria 1564
7 Ga0065707_10103682 3300005295 Bacteria 2735
8 Ga0070690_100008833 3300005330 Bacteria 5821
9 Ga0070670_100044319 3300005331 Bacteria 3825
10 Ga0070670_100161906 3300005331 Unclassified 1939
11 Ga0070670_100214381 3300005331 Bacteria 1674
12 Ga0070670_100228480 3300005331 Bacteria 1619
13 Ga0070670_100255810 3300005331 Bacteria 1526
14 Ga0070670_101235259 3300005331 Bacteria 683
15 Ga0070677_10152594 3300005333 Bacteria 1076
16 Ga0070666_10425818 3300005335 Bacteria 956
17 Ga0070680_100019408 3300005336 Bacteria 5387
18 Ga0070680_100436188 3300005336 Bacteria 1118
19 Ga0070689_100156494 3300005340 Bacteria 1840
20 Ga0070689_100502059 3300005340 Bacteria 1039
21 Ga0070689_100947633 3300005340 Unclassified 763
22 Ga0070689_102026290 3300005340 Bacteria 527
23 Ga0070692_10282649 3300005345 Bacteria 1006
24 Ga0070668_100227769 3300005347 Bacteria 1540
25 Ga0070669_100662309 3300005353 Unclassified 879
26 Ga0070675_100027513 3300005354 Bacteria 4569
27 Ga0070675_101144934 3300005354 Bacteria 716
28 Ga0070674_100693917 3300005356 Bacteria 869
29 Ga0070673_100215305 3300005364 Unclassified 1660
30 Ga0070673_101714325 3300005364 Bacteria 595
31 Ga0070688_101184977 3300005365 Unclassified 613
32 Ga0070667_100172045 3300005367 Bacteria 1913
33 Ga0070701_10233293 3300005438 Bacteria 1103
34 Ga0070705_100350524 3300005440 Unclassified 1076
35 Ga0070705_100725290 3300005440 Bacteria 783
36 Ga0070700_100022937 3300005441 Bacteria 3647
37 Ga0070700_100536758 3300005441 Unclassified 906
38 Ga0070694_100188764 3300005444 Unclassified 1529
39 Ga0070694_100629450 3300005444 Unclassified 867
40 Ga0070694_101098761 3300005444 Archaea 663
41 Ga0070678_100303398 3300005456 Bacteria 1358
42 Ga0070662_100067199 3300005457 Bacteria 2632
43 Ga0070662_100647755 3300005457 Bacteria 891
44 Ga0070681_10765201 3300005458 Bacteria 882
45 Ga0070681_11235495 3300005458 Bacteria 669
46 Ga0068867_100312199 3300005459 Bacteria 1300
47 Ga0070685_10001188 3300005466 Bacteria 13920
48 Ga0070685_10002525 3300005466 Bacteria 9385
49 Ga0070685_10751337 3300005466 Bacteria 715
50 Ga0070685_11546114 3300005466 Bacteria 512
51 Ga0070706_100387934 3300005467 Bacteria 1300
52 Ga0070707_100336265 3300005468 Bacteria 1467
53 Ga0070707_102177053 3300005468 Unclassified 522
54 Ga0070699_100055680 3300005518 Unclassified 3424
55 Ga0070679_100088060 3300005530 Bacteria 3092
56 Ga0070679_100495212 3300005530 Bacteria 1166
57 Ga0068853_101345968 3300005539 Unclassified 690
58 Ga0070672_100125775 3300005543 Bacteria 2102
59 Ga0070672_100793445 3300005543 Unclassified 833
60 Ga0070686_100000029 3300005544 Bacteria 123581
61 Ga0070696_100140296 3300005546 Unclassified 1766
62 Ga0070704_101262562 3300005549 Unclassified 675
63 Ga0070664_100249380 3300005564 Unclassified 1595
64 Ga0070664_100598457 3300005564 Bacteria 1022
65 Ga0070664_101339732 3300005564 Unclassified 676
66 Ga0068857_100097956 3300005577 Bacteria 2630
67 Ga0068857_102413562 3300005577 Unclassified 516
68 Ga0068859_100248869 3300005617 Bacteria 1868
69 Ga0068859_100468450 3300005617 Bacteria 1355
70 Ga0068859_101881231 3300005617 Bacteria 661
71 Ga0068859_102588070 3300005617 Unclassified 558
72 Ga0068864_100059342 3300005618 Bacteria 3310
73 Ga0068864_101072686 3300005618 Bacteria 801
74 Ga0068861_100075231 3300005719 Bacteria 2628
75 Ga0068861_100638255 3300005719 Unclassified 982
76 Ga0068861_100935575 3300005719 Bacteria 823
77 Ga0068870_10114626 3300005840 Unclassified 1544
78 Ga0068863_100191771 3300005841 Bacteria 1964
79 Ga0068863_100349610 3300005841 Unclassified 1439
80 Ga0068863_102182879 3300005841 Unclassified 564
81 Ga0068858_101391396 3300005842 Bacteria 691
82 Ga0068860_100544641 3300005843 Bacteria 1162
83 Ga0068862_101264957 3300005844 Bacteria 738
84 Ga0068862_102286813 3300005844 Unclassified 552
85 Ga0068862_102342687 3300005844 Bacteria 546
86 Ga0075368_10083451 3300006042 Bacteria 1302
87 Ga0075366_10010478 3300006195 Bacteria 5205
88 Ga0075366_10052370 3300006195 Bacteria 2425
89 Ga0075428_101444689 3300006844 Unclassified 721
90 Ga0075430_100529485 3300006846 Bacteria 972
91 Ga0075431_100017732 3300006847 Bacteria 7239
92 Ga0075431_100226191 3300006847 Bacteria 1907
93 Ga0075431_100664789 3300006847 Bacteria 1021
94 Ga0075431_101374935 3300006847 Unclassified 666
95 Ga0075433_10452842 3300006852 Bacteria 1131
96 Ga0075433_11012347 3300006852 Unclassified 724
97 Ga0075434_100173563 3300006871 Bacteria 2176
98 Ga0075434_100499606 3300006871 Bacteria 1237
99 Ga0075434_100703197 3300006871 Bacteria 1028
100 Ga0075434_102111660 3300006871 Unclassified 568
101 Ga0075429_100171515 3300006880 Unclassified 1900
102 Ga0068865_100101553 3300006881 Bacteria 2106
103 Ga0068865_100935356 3300006881 Bacteria 756
104 Ga0075436_100326889 3300006914 Unclassified 1102
105 Ga0097620_100248863 3300006931 Bacteria 1868
106 Ga0097620_100468488 3300006931 Bacteria 1355
107 Ga0097620_101880486 3300006931 Bacteria 661
108 Ga0097620_102587774 3300006931 Unclassified 558
109 Ga0075435_100043671 3300007076 Bacteria 3588
110 Ga0075435_100067890 3300007076 Bacteria 2904
111 Ga0075435_100404768 3300007076 Bacteria 1174
112 Ga0075435_101861036 3300007076 Unclassified 528
113 Ga0099794_10463625 3300007265 Bacteria 665
114 Ga0105251_10570983 3300009011 Bacteria 534
115 Ga0111539_10047502 3300009094 Bacteria 5129
116 Ga0111539_10128780 3300009094 Bacteria 2965
117 Ga0111539_10507715 3300009094 Bacteria 1404
118 Ga0111539_10539526 3300009094 Bacteria 1359
119 Ga0111539_12558650 3300009094 Bacteria 592
120 Ga0114129_10005251 3300009147 Bacteria 18259
121 Ga0114129_11001580 3300009147 Bacteria 1052
122 Ga0105242_10450027 3300009176 Bacteria 1214
123 Ga0105242_10513773 3300009176 Bacteria 1142
124 Ga0105242_11314701 3300009176 Bacteria 747
125 Ga0105242_12981663 3300009176 Unclassified 524
126 Ga0105248_11883484 3300009177 Unclassified 679
127 Ga0105238_10000093 3300009551 Bacteria 100560
128 Ga0105249_10082733 3300009553 Bacteria 2987
129 Ga0105249_10205890 3300009553 Bacteria 1928
130 Ga0105249_10478794 3300009553 Bacteria 1287
131 Ga0105249_10839159 3300009553 Bacteria 984
132 Ga0105239_10380210 3300010375 Bacteria 1596
133 Ga0105246_11103266 3300011119 Bacteria 725
134 Ga0163162_11040375 3300013306 Bacteria 926
135 Ga0157372_10408583 3300013307 Bacteria 1582
136 Ga0157375_10266526 3300013308 Bacteria 1874
137 Ga0157375_10860387 3300013308 Unclassified 1053
138 Ga0163163_10241961 3300014325 Unclassified 1854
139 Ga0163163_12278460 3300014325 Bacteria 600
140 Ga0182008_10024961 3300014497 Bacteria 3040
141 Ga0157377_10307809 3300014745 Unclassified 1048
142 Ga0206353_10944787 3300020082 Bacteria 1582
143 Ga0213876_10574207 3300021384 Unclassified 600
144 Ga0207682_10031549 3300025893 Bacteria 2127
145 Ga0207680_10177536 3300025903 Bacteria 1438
146 Ga0207684_10352551 3300025910 Bacteria 1267
147 Ga0207684_10773587 3300025910 Bacteria 813
148 Ga0207660_10089121 3300025917 Bacteria 2283
149 Ga0207662_10386105 3300025918 Bacteria 947
150 Ga0207662_10977914 3300025918 Unclassified 600
151 Ga0207652_10085806 3300025921 Bacteria 2759
152 Ga0207646_10610711 3300025922 Bacteria 979
153 Ga0207681_10199170 3300025923 Bacteria 1536
154 Ga0207681_11011380 3300025923 Bacteria 697
155 Ga0207694_10000017 3300025924 Bacteria 342100
156 Ga0207650_10142085 3300025925 Unclassified 1888
157 Ga0207650_11778675 3300025925 Unclassified 521
158 Ga0207659_11130933 3300025926 Bacteria 674
159 Ga0207706_10068284 3300025933 Bacteria 3128
160 Ga0207706_10077604 3300025933 Bacteria 2921
161 Ga0207706_11255956 3300025933 Bacteria 613
162 Ga0207686_10220367 3300025934 Bacteria 1370
163 Ga0207670_10157384 3300025936 Bacteria 1692
164 Ga0207670_10232699 3300025936 Unclassified 1416
165 Ga0207670_10431046 3300025936 Unclassified 1060
166 Ga0207704_10221779 3300025938 Bacteria 1400
167 Ga0207691_10088260 3300025940 Unclassified 2781
168 Ga0207679_10148744 3300025945 Unclassified 1903
169 Ga0207679_10366371 3300025945 Bacteria 1260
170 Ga0207651_10138998 3300025960 Bacteria 1873
171 Ga0207712_10090043 3300025961 Bacteria 2257
172 Ga0207712_10463590 3300025961 Bacteria 1077
173 Ga0207668_10226593 3300025972 Bacteria 1504
174 Ga0207668_10367019 3300025972 Bacteria 1208
175 Ga0207708_10037134 3300026075 Bacteria 3711
176 Ga0207708_10543375 3300026075 Unclassified 979
177 Ga0207708_11830421 3300026075 Bacteria 532
178 Ga0207641_10220497 3300026088 Bacteria 1758
179 Ga0207641_10596744 3300026088 Unclassified 1081
180 Ga0207676_10030731 3300026095 Bacteria 4035
181 Ga0207676_10157048 3300026095 Bacteria 1966
182 Ga0207676_10387224 3300026095 Bacteria 1303
183 Ga0207676_10946852 3300026095 Bacteria 846
184 Ga0207674_10009663 3300026116 Bacteria 10998
185 Ga0207674_10372100 3300026116 Viruses 1381
186 Ga0207674_10750157 3300026116 Bacteria 942
187 Ga0207675_100023834 3300026118 Bacteria 5692
188 Ga0207675_100653309 3300026118 Bacteria 1058
189 Ga0207675_101634659 3300026118 Bacteria 664
190 Ga0207698_11083722 3300026142 Bacteria 813
191 Ga0207428_10033458 3300027907 Bacteria 4221
192 Ga0207428_10303163 3300027907 Bacteria 1182
193 Ga0268265_10012074 3300028380 Bacteria 5849
194 Ga0268265_10556460 3300028380 Bacteria 1090
195 Ga0268265_10852920 3300028380 Bacteria 891
196 Ga0268265_11326887 3300028380 Unclassified 720
197 Ga0268264_10518578 3300028381 Bacteria 1165
198 Ga0265325_10429857 3300031241 Bacteria 576
199 Ga0307408_101212958 3300031548 Bacteria 704
200 Ga0316579_10030684 3300031691 Unclassified 2458
201 Ga0316578_10277146 3300031728 Unclassified 1004
202 Ga0307405_11053987 3300031731 Bacteria 696
203 Ga0307409_100023185 3300031995 Bacteria 4295
204 Ga0307409_100759407 3300031995 Unclassified 974
205 Ga0307409_101954295 3300031995 Unclassified 616
206 Ga0307414_11030559 3300032004 Bacteria 758
207 Ga0307411_10326067 3300032005 Bacteria 1242
208 Ga0307415_100611937 3300032126 Bacteria 971
209 Ga0316583_10046639 3300032133 Bacteria 1529
210 Ga0373936_0077601 3300035113 Bacteria 1378
211 Ga0373941_0062064 3300035115 Bacteria 1219
212 Ga0373954_0513916 3300035118 Unclassified 593
213 Ga0373960_0393420 3300035121 Bacteria 533
214 Ga0373961_0017432 3300035241 Bacteria 1863
215 Ga0373931_0008662 3300035691 Bacteria 4836
216 Ga0373931_0115611 3300035691 Bacteria 1527
217 Ga0373931_0429829 3300035691 Bacteria 841
218 Ga0373937_0059804 3300036401 Bacteria 3502
219 Ga0373937_0475613 3300036401 Bacteria 1187
220 Ga0373925_0039912 3300037068 Bacteria 3474
221 Ga0373925_0354413 3300037068 Bacteria 1192
222 Ga0451797_0780668 3300041453 Bacteria 724
223 Ga0439433_0018293 3300041999 Bacteria 1560
224 Ga0450896_011127 3300042133 Bacteria 1265
225 Ga0439444_0011988 3300042437 Bacteria 1414
226 Ga0439459_0134321 3300042438 Bacteria 635
227 Ga0466969_0310098 3300044656 Bacteria 714
228 Ga0466961_0065290 3300044693 Bacteria 2312
229 Ga0453684_0223138 3300044712 Bacteria 2181
230 Ga0453684_2044825 3300044712 Unclassified 576
231 Ga0451576_0156648 3300045051 Unclassified 2376
232 Ga0451576_0195240 3300045051 Bacteria 2114
233 Ga0451576_0458148 3300045051 Bacteria 1339
234 Ga0451576_1752255 3300045051 Bacteria 643
235 Ga0466967_0254955 3300045976 Bacteria 1677
236 Ga0466967_0550460 3300045976 Bacteria 1136
237 Ga0495582_0066059 3300046473 Bacteria 1998
238 Ga0495586_0108326 3300046535 Bacteria 1545
239 Ga0495598_0053077 3300046537 Bacteria 1227
240 Ga0495658_0153481 3300046683 Bacteria 1416
241 Ga0495613_0223457 3300046689 Bacteria 1321
242 Ga0495680_1063095 3300047322 Bacteria 513
243 Ga0495593_0292651 3300047673 Bacteria 814
244 Ga0496102_0188376 3300048905 Bacteria 1944
245 Ga0496102_0193762 3300048905 Bacteria 1915
246 Ga0496104_0004413 3300048907 Bacteria 12257
247 Ga0496104_0937373 3300048907 Bacteria 770
248 Ga0496105_0347170 3300048908 Bacteria 1186
249 Ga0496105_1202484 3300048908 Unclassified 558
250 Ga0496106_1365189 3300048909 Bacteria 548
251 Ga0496107_0265935 3300048910 Bacteria 1276
252 Ga0496108_0000437 3300048911 Bacteria 33604
253 Ga0496108_0050055 3300048911 Bacteria 3496
254 Ga0496108_0413459 3300048911 Bacteria 1178
255 Ga0496109_0001402 3300048912 Bacteria 19977
256 Ga0496109_0018312 3300048912 Bacteria 6152
257 Ga0496109_0116073 3300048912 Bacteria 2491
258 Ga0496110_0024620 3300048913 Bacteria 5133
259 Ga0496111_0014925 3300048914 Bacteria 5319
260 Ga0496112_0001565 3300048915 Bacteria 17667
261 Ga0496112_0329214 3300048915 Bacteria 1471
262 Ga0496112_0343965 3300048915 Bacteria 1435
263 Ga0496112_1205072 3300048915 Bacteria 674
264 Ga0496113_0000618 3300048916 Bacteria 17834
265 Ga0496113_0002365 3300048916 Bacteria 10929
266 Ga0501309_009813 3300049129 Unclassified 1227
267 Ga0501312_014561 3300049528 Bacteria 1107
268 Ga0501321_021307 3300049537 Bacteria 808
269 Ga0501036_0452186 3300049572 Unclassified 1070
270 Ga0501069_0537430 3300049585 Bacteria 699
271 Ga0501071_1576720 3300049587 Unclassified 507
272 Ga0501045_1050925 3300049824 Bacteria 596
273 nmdc:mga0k408_102055_c1 3300050493 Bacteria 1692
274 nmdc:mga0k408_144469_c1 3300050493 Bacteria 1416
275 nmdc:mga06z11_2244_c1 3300050494 Bacteria 7348
276 nmdc:mga07m45_55651_c1 3300050496 Bacteria 2236
277 nmdc:mga05p37_66552_c1 3300050507 Bacteria 4432
278 nmdc:mga09592_936948_c1 3300050508 Bacteria 726
279 nmdc:mga06r32_1547379_c1 3300050510 Bacteria 603
280 nmdc:mga06r32_224893_c1 3300050510 Bacteria 1865
281 nmdc:mga08y16_1079725_c1 3300050511 Bacteria 779
282 nmdc:mga08y16_1226909_c1 3300050511 Bacteria 720
283 nmdc:mga08y16_37099_c1 3300050511 Bacteria 5118
284 nmdc:mga08y16_565399_c1 3300050511 Bacteria 1149
285 nmdc:mga0n895_165758_c1 3300050512 Bacteria 2241
286 nmdc:mga0n895_1866087_c1 3300050512 Bacteria 561
287 nmdc:mga0rr50_129221_c1 3300050513 Bacteria 2020
288 nmdc:mga0rr50_318093_c1 3300050513 Bacteria 1304
289 nmdc:mga0rr50_589871_c1 3300050513 Bacteria 947
290 nmdc:mga08x19_375230_c1 3300050514 Bacteria 996
291 nmdc:mga0a205_1181326_c1 3300050515 Bacteria 613
292 nmdc:mga0a205_168610_c1 3300050515 Unclassified 2085
293 nmdc:mga0a205_391701_c1 3300050515 Bacteria 1254
294 Ga0500641_0040719 3300053096 Bacteria 1877
295 Ga0501082_1051647 3300060353 Bacteria 712

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_10513773 Ga0105242_105137732 109
2 3300005336 Ga0070680_100019408 Ga0070680_1000194086 118
3 3300005530 Ga0070679_100088060 Ga0070679_1000880602 118
4 3300013307 Ga0157372_10408583 Ga0157372_104085833 118
5 3300020082 Ga0206353_10944787 Ga0206353_109447872 118
6 3300025917 Ga0207660_10089121 Ga0207660_100891212 118
7 3300025921 Ga0207652_10085806 Ga0207652_100858062 118
8 3300041999 Ga0439433_0018293 Ga0439433_0018293_559_915 118
9 3300005458 Ga0070681_10765201 Ga0070681_107652012 119
10 3300044712 Ga0453684_0223138 Ga0453684_0223138_870_1232 119
11 3300003316 rootH1_10164325 rootH1_101643253 120
12 3300004803 Ga0058862_12539817 Ga0058862_125398172 120
13 3300005288 Ga0065714_10270213 Ga0065714_102702132 120
14 3300005289 Ga0065704_10636954 Ga0065704_106369542 120
15 3300005290 Ga0065712_10129425 Ga0065712_101294252 120
16 3300005331 Ga0070670_100214381 Ga0070670_1002143813 120
17 3300005331 Ga0070670_100255810 Ga0070670_1002558102 120
18 3300005340 Ga0070689_100156494 Ga0070689_1001564943 120
19 3300005340 Ga0070689_100502059 Ga0070689_1005020592 120
20 3300005347 Ga0070668_100227769 Ga0070668_1002277692 120
21 3300005354 Ga0070675_101144934 Ga0070675_1011449341 120
22 3300005356 Ga0070674_100693917 Ga0070674_1006939172 120
23 3300005365 Ga0070688_101184977 Ga0070688_1011849771 120
24 3300005440 Ga0070705_100350524 Ga0070705_1003505242 120
25 3300005440 Ga0070705_100725290 Ga0070705_1007252902 120
26 3300005441 Ga0070700_100022937 Ga0070700_1000229373 120
27 3300005441 Ga0070700_100536758 Ga0070700_1005367582 120
28 3300005444 Ga0070694_101098761 Ga0070694_1010987612 120
29 3300005458 Ga0070681_11235495 Ga0070681_112354951 120
30 3300005459 Ga0068867_100312199 Ga0068867_1003121991 120
31 3300005466 Ga0070685_10001188 Ga0070685_1000118814 120
32 3300005530 Ga0070679_100495212 Ga0070679_1004952122 120
33 3300005544 Ga0070686_100000029 Ga0070686_10000002925 120
34 3300005549 Ga0070704_101262562 Ga0070704_1012625622 120
35 3300005564 Ga0070664_100598457 Ga0070664_1005984572 120
36 3300005564 Ga0070664_101339732 Ga0070664_1013397322 120
37 3300005577 Ga0068857_100097956 Ga0068857_1000979561 120
38 3300005617 Ga0068859_101881231 Ga0068859_1018812312 120
39 3300005618 Ga0068864_101072686 Ga0068864_1010726862 120
40 3300005719 Ga0068861_100075231 Ga0068861_1000752313 120
41 3300005841 Ga0068863_100191771 Ga0068863_1001917712 120
42 3300005841 Ga0068863_100349610 Ga0068863_1003496102 120
43 3300005841 Ga0068863_102182879 Ga0068863_1021828791 120
44 3300005843 Ga0068860_100544641 Ga0068860_1005446413 120
45 3300006042 Ga0075368_10083451 Ga0075368_100834512 120
46 3300006195 Ga0075366_10010478 Ga0075366_100104784 120
47 3300006195 Ga0075366_10052370 Ga0075366_100523702 120
48 3300006844 Ga0075428_101444689 Ga0075428_1014446892 120
49 3300006846 Ga0075430_100529485 Ga0075430_1005294852 120
50 3300006847 Ga0075431_100226191 Ga0075431_1002261912 120
51 3300006847 Ga0075431_100664789 Ga0075431_1006647891 120
52 3300006847 Ga0075431_101374935 Ga0075431_1013749352 120
53 3300006852 Ga0075433_10452842 Ga0075433_104528421 120
54 3300006871 Ga0075434_100173563 Ga0075434_1001735633 120
55 3300006871 Ga0075434_100499606 Ga0075434_1004996061 120
56 3300006871 Ga0075434_100703197 Ga0075434_1007031972 120
57 3300006881 Ga0068865_100935356 Ga0068865_1009353562 120
58 3300006914 Ga0075436_100326889 Ga0075436_1003268891 120
59 3300006931 Ga0097620_101880486 Ga0097620_1018804862 120
60 3300007076 Ga0075435_100067890 Ga0075435_1000678905 120
61 3300007076 Ga0075435_100404768 Ga0075435_1004047682 120
62 3300007076 Ga0075435_101861036 Ga0075435_1018610361 120
63 3300007265 Ga0099794_10463625 Ga0099794_104636252 120
64 3300009011 Ga0105251_10570983 Ga0105251_105709831 120
65 3300009094 Ga0111539_10047502 Ga0111539_100475022 120
66 3300009094 Ga0111539_10128780 Ga0111539_101287802 120
67 3300009094 Ga0111539_12558650 Ga0111539_125586501 120
68 3300009147 Ga0114129_10005251 Ga0114129_100052518 120
69 3300009176 Ga0105242_10450027 Ga0105242_104500272 120
70 3300009176 Ga0105242_11314701 Ga0105242_113147011 120
71 3300009176 Ga0105242_12981663 Ga0105242_129816631 120
72 3300009551 Ga0105238_10000093 Ga0105238_1000009329 120
73 3300009553 Ga0105249_10082733 Ga0105249_100827332 120
74 3300009553 Ga0105249_10205890 Ga0105249_102058903 120
75 3300010375 Ga0105239_10380210 Ga0105239_103802101 120
76 3300011119 Ga0105246_11103266 Ga0105246_111032661 120
77 3300013306 Ga0163162_11040375 Ga0163162_110403751 120
78 3300014325 Ga0163163_12278460 Ga0163163_122784601 120
79 3300025910 Ga0207684_10773587 Ga0207684_107735871 120
80 3300025918 Ga0207662_10386105 Ga0207662_103861052 120
81 3300025923 Ga0207681_10199170 Ga0207681_101991702 120
82 3300025923 Ga0207681_11011380 Ga0207681_110113802 120
83 3300025924 Ga0207694_10000017 Ga0207694_1000001729 120
84 3300025925 Ga0207650_11778675 Ga0207650_117786751 120
85 3300025933 Ga0207706_11255956 Ga0207706_112559561 120
86 3300025934 Ga0207686_10220367 Ga0207686_102203671 120
87 3300025936 Ga0207670_10157384 Ga0207670_101573843 120
88 3300025936 Ga0207670_10232699 Ga0207670_102326991 120
89 3300025936 Ga0207670_10431046 Ga0207670_104310462 120
90 3300025938 Ga0207704_10221779 Ga0207704_102217792 120
91 3300025945 Ga0207679_10366371 Ga0207679_103663712 120
92 3300025961 Ga0207712_10090043 Ga0207712_100900432 120
93 3300025972 Ga0207668_10226593 Ga0207668_102265932 120
94 3300026075 Ga0207708_10037134 Ga0207708_100371342 120
95 3300026075 Ga0207708_11830421 Ga0207708_118304212 120
96 3300026088 Ga0207641_10220497 Ga0207641_102204972 120
97 3300026095 Ga0207676_10387224 Ga0207676_103872243 120
98 3300026095 Ga0207676_10946852 Ga0207676_109468522 120
99 3300026116 Ga0207674_10009663 Ga0207674_100096634 120
100 3300026116 Ga0207674_10750157 Ga0207674_107501572 120
101 3300026118 Ga0207675_100023834 Ga0207675_1000238346 120
102 3300026118 Ga0207675_100653309 Ga0207675_1006533091 120
103 3300026142 Ga0207698_11083722 Ga0207698_110837222 120
104 3300027907 Ga0207428_10033458 Ga0207428_100334582 120
105 3300028380 Ga0268265_10012074 Ga0268265_100120742 120
106 3300028381 Ga0268264_10518578 Ga0268264_105185781 120
107 3300032005 Ga0307411_10326067 Ga0307411_103260672 120
108 3300035115 Ga0373941_0062064 Ga0373941_0062064_695_1057 120
109 3300035118 Ga0373954_0513916 Ga0373954_0513916_150_512 120
110 3300035121 Ga0373960_0393420 Ga0373960_0393420_41_403 120
111 3300035241 Ga0373961_0017432 Ga0373961_0017432_1015_1377 120
112 3300035691 Ga0373931_0008662 Ga0373931_0008662_4266_4628 120
113 3300035691 Ga0373931_0115611 Ga0373931_0115611_606_968 120
114 3300035691 Ga0373931_0429829 Ga0373931_0429829_135_497 120
115 3300036401 Ga0373937_0059804 Ga0373937_0059804_2984_3346 120
116 3300037068 Ga0373925_0039912 Ga0373925_0039912_2766_3128 120
117 3300037068 Ga0373925_0354413 Ga0373925_0354413_739_1101 120
118 3300041453 Ga0451797_0780668 Ga0451797_0780668_279_641 120
119 3300042133 Ga0450896_011127 Ga0450896_011127_44_406 120
120 3300042437 Ga0439444_0011988 Ga0439444_0011988_12_374 120
121 3300042438 Ga0439459_0134321 Ga0439459_0134321_171_533 120
122 3300044712 Ga0453684_2044825 Ga0453684_2044825_60_422 120
123 3300045051 Ga0451576_0156648 Ga0451576_0156648_1651_2013 120
124 3300045051 Ga0451576_0195240 Ga0451576_0195240_347_709 120
125 3300045051 Ga0451576_0458148 Ga0451576_0458148_578_940 120
126 3300045051 Ga0451576_1752255 Ga0451576_1752255_65_427 120
127 3300045976 Ga0466967_0550460 Ga0466967_0550460_19_381 120
128 3300046473 Ga0495582_0066059 Ga0495582_0066059_457_819 120
129 3300046535 Ga0495586_0108326 Ga0495586_0108326_805_1167 120
130 3300046683 Ga0495658_0153481 Ga0495658_0153481_494_856 120
131 3300046689 Ga0495613_0223457 Ga0495613_0223457_150_512 120
132 3300047322 Ga0495680_1063095 Ga0495680_1063095_91_453 120
133 3300047673 Ga0495593_0292651 Ga0495593_0292651_241_603 120
134 3300048905 Ga0496102_0188376 Ga0496102_0188376_87_449 120
135 3300048905 Ga0496102_0193762 Ga0496102_0193762_937_1299 120
136 3300048907 Ga0496104_0004413 Ga0496104_0004413_8563_8925 120
137 3300048907 Ga0496104_0937373 Ga0496104_0937373_168_530 120
138 3300048908 Ga0496105_0347170 Ga0496105_0347170_667_1029 120
139 3300048908 Ga0496105_1202484 Ga0496105_1202484_60_422 120
140 3300048909 Ga0496106_1365189 Ga0496106_1365189_111_473 120
141 3300048910 Ga0496107_0265935 Ga0496107_0265935_861_1223 120
142 3300048911 Ga0496108_0000437 Ga0496108_0000437_8828_9190 120
143 3300048911 Ga0496108_0050055 Ga0496108_0050055_2077_2439 120
144 3300048911 Ga0496108_0413459 Ga0496108_0413459_181_543 120
145 3300048912 Ga0496109_0001402 Ga0496109_0001402_1815_2177 120
146 3300048912 Ga0496109_0018312 Ga0496109_0018312_5371_5733 120
147 3300048912 Ga0496109_0116073 Ga0496109_0116073_94_456 120
148 3300048913 Ga0496110_0024620 Ga0496110_0024620_4006_4368 120
149 3300048914 Ga0496111_0014925 Ga0496111_0014925_1054_1416 120
150 3300048915 Ga0496112_0001565 Ga0496112_0001565_13512_13874 120
151 3300048915 Ga0496112_0329214 Ga0496112_0329214_1069_1431 120
152 3300048915 Ga0496112_0343965 Ga0496112_0343965_483_845 120
153 3300048915 Ga0496112_1205072 Ga0496112_1205072_149_511 120
154 3300048916 Ga0496113_0000618 Ga0496113_0000618_3622_3984 120
155 3300048916 Ga0496113_0002365 Ga0496113_0002365_9515_9877 120
156 3300049129 Ga0501309_009813 Ga0501309_009813_91_453 120
157 3300049528 Ga0501312_014561 Ga0501312_014561_120_482 120
158 3300049537 Ga0501321_021307 Ga0501321_021307_106_468 120
159 3300049572 Ga0501036_0452186 Ga0501036_0452186_188_550 120
160 3300049585 Ga0501069_0537430 Ga0501069_0537430_225_587 120
161 3300049587 Ga0501071_1576720 Ga0501071_1576720_44_406 120
162 3300049824 Ga0501045_1050925 Ga0501045_1050925_191_553 120
163 3300050493 nmdc:mga0k408_102055_c1 nmdc:mga0k408_102055_c1_569_931 120
164 3300050493 nmdc:mga0k408_144469_c1 nmdc:mga0k408_144469_c1_502_864 120
165 3300050494 nmdc:mga06z11_2244_c1 nmdc:mga06z11_2244_c1_2102_2464 120
166 3300050496 nmdc:mga07m45_55651_c1 nmdc:mga07m45_55651_c1_1473_1835 120
167 3300050508 nmdc:mga09592_936948_c1 nmdc:mga09592_936948_c1_223_585 120
168 3300050510 nmdc:mga06r32_1547379_c1 nmdc:mga06r32_1547379_c1_38_400 120
169 3300050510 nmdc:mga06r32_224893_c1 nmdc:mga06r32_224893_c1_802_1164 120
170 3300050511 nmdc:mga08y16_37099_c1 nmdc:mga08y16_37099_c1_771_1133 120
171 3300050512 nmdc:mga0n895_165758_c1 nmdc:mga0n895_165758_c1_168_530 120
172 3300050513 nmdc:mga0rr50_129221_c1 nmdc:mga0rr50_129221_c1_359_721 120
173 3300050513 nmdc:mga0rr50_318093_c1 nmdc:mga0rr50_318093_c1_81_443 120
174 3300050513 nmdc:mga0rr50_589871_c1 nmdc:mga0rr50_589871_c1_94_456 120
175 3300050514 nmdc:mga08x19_375230_c1 nmdc:mga08x19_375230_c1_211_573 120
176 3300053096 Ga0500641_0040719 Ga0500641_0040719_835_1197 120
177 3300060353 Ga0501082_1051647 Ga0501082_1051647_33_395 120
178 2162886006 SwRhRL3b_contig_1470594 SwRhRL3b_0005.00001870 121
179 3300005295 Ga0065707_10103682 Ga0065707_101036823 121
180 3300005330 Ga0070690_100008833 Ga0070690_1000088333 121
181 3300005331 Ga0070670_100044319 Ga0070670_1000443191 121
182 3300005331 Ga0070670_100161906 Ga0070670_1001619061 121
183 3300005331 Ga0070670_100228480 Ga0070670_1002284802 121
184 3300005331 Ga0070670_101235259 Ga0070670_1012352592 121
185 3300005333 Ga0070677_10152594 Ga0070677_101525942 121
186 3300005335 Ga0070666_10425818 Ga0070666_104258181 121
187 3300005336 Ga0070680_100436188 Ga0070680_1004361881 121
188 3300005340 Ga0070689_100947633 Ga0070689_1009476331 121
189 3300005340 Ga0070689_102026290 Ga0070689_1020262901 121
190 3300005345 Ga0070692_10282649 Ga0070692_102826492 121
191 3300005353 Ga0070669_100662309 Ga0070669_1006623092 121
192 3300005354 Ga0070675_100027513 Ga0070675_1000275134 121
193 3300005364 Ga0070673_100215305 Ga0070673_1002153053 121
194 3300005364 Ga0070673_101714325 Ga0070673_1017143251 121
195 3300005367 Ga0070667_100172045 Ga0070667_1001720451 121
196 3300005438 Ga0070701_10233293 Ga0070701_102332931 121
197 3300005444 Ga0070694_100188764 Ga0070694_1001887642 121
198 3300005444 Ga0070694_100629450 Ga0070694_1006294501 121
199 3300005456 Ga0070678_100303398 Ga0070678_1003033982 121
200 3300005457 Ga0070662_100067199 Ga0070662_1000671994 121
201 3300005457 Ga0070662_100647755 Ga0070662_1006477551 121
202 3300005466 Ga0070685_10002525 Ga0070685_100025255 121
203 3300005466 Ga0070685_10751337 Ga0070685_107513371 121
204 3300005466 Ga0070685_11546114 Ga0070685_115461141 121
205 3300005467 Ga0070706_100387934 Ga0070706_1003879342 121
206 3300005468 Ga0070707_100336265 Ga0070707_1003362652 121
207 3300005468 Ga0070707_102177053 Ga0070707_1021770531 121
208 3300005518 Ga0070699_100055680 Ga0070699_1000556803 121
209 3300005539 Ga0068853_101345968 Ga0068853_1013459681 121
210 3300005543 Ga0070672_100125775 Ga0070672_1001257752 121
211 3300005543 Ga0070672_100793445 Ga0070672_1007934452 121
212 3300005546 Ga0070696_100140296 Ga0070696_1001402963 121
213 3300005564 Ga0070664_100249380 Ga0070664_1002493803 121
214 3300005577 Ga0068857_102413562 Ga0068857_1024135622 121
215 3300005617 Ga0068859_100248869 Ga0068859_1002488693 121
216 3300005617 Ga0068859_100468450 Ga0068859_1004684501 121
217 3300005617 Ga0068859_102588070 Ga0068859_1025880701 121
218 3300005618 Ga0068864_100059342 Ga0068864_1000593422 121
219 3300005719 Ga0068861_100638255 Ga0068861_1006382552 121
220 3300005719 Ga0068861_100935575 Ga0068861_1009355751 121
221 3300005840 Ga0068870_10114626 Ga0068870_101146262 121
222 3300005842 Ga0068858_101391396 Ga0068858_1013913962 121
223 3300005844 Ga0068862_101264957 Ga0068862_1012649572 121
224 3300005844 Ga0068862_102286813 Ga0068862_1022868131 121
225 3300005844 Ga0068862_102342687 Ga0068862_1023426871 121
226 3300006847 Ga0075431_100017732 Ga0075431_1000177323 121
227 3300006852 Ga0075433_11012347 Ga0075433_110123472 121
228 3300006871 Ga0075434_102111660 Ga0075434_1021116601 121
229 3300006880 Ga0075429_100171515 Ga0075429_1001715152 121
230 3300006881 Ga0068865_100101553 Ga0068865_1001015532 121
231 3300006931 Ga0097620_100248863 Ga0097620_1002488633 121
232 3300006931 Ga0097620_100468488 Ga0097620_1004684881 121
233 3300006931 Ga0097620_102587774 Ga0097620_1025877741 121
234 3300007076 Ga0075435_100043671 Ga0075435_1000436716 121
235 3300009094 Ga0111539_10507715 Ga0111539_105077153 121
236 3300009094 Ga0111539_10539526 Ga0111539_105395262 121
237 3300009147 Ga0114129_11001580 Ga0114129_110015801 121
238 3300009177 Ga0105248_11883484 Ga0105248_118834842 121
239 3300009553 Ga0105249_10478794 Ga0105249_104787942 121
240 3300009553 Ga0105249_10839159 Ga0105249_108391591 121
241 3300013308 Ga0157375_10266526 Ga0157375_102665262 121
242 3300013308 Ga0157375_10860387 Ga0157375_108603871 121
243 3300014325 Ga0163163_10241961 Ga0163163_102419613 121
244 3300014497 Ga0182008_10024961 Ga0182008_100249612 121
245 3300014745 Ga0157377_10307809 Ga0157377_103078091 121
246 3300021384 Ga0213876_10574207 Ga0213876_105742072 121
247 3300025893 Ga0207682_10031549 Ga0207682_100315493 121
248 3300025903 Ga0207680_10177536 Ga0207680_101775362 121
249 3300025910 Ga0207684_10352551 Ga0207684_103525512 121
250 3300025918 Ga0207662_10977914 Ga0207662_109779142 121
251 3300025922 Ga0207646_10610711 Ga0207646_106107111 121
252 3300025925 Ga0207650_10142085 Ga0207650_101420851 121
253 3300025926 Ga0207659_11130933 Ga0207659_111309332 121
254 3300025933 Ga0207706_10068284 Ga0207706_100682843 121
255 3300025933 Ga0207706_10077604 Ga0207706_100776042 121
256 3300025940 Ga0207691_10088260 Ga0207691_100882603 121
257 3300025945 Ga0207679_10148744 Ga0207679_101487441 121
258 3300025960 Ga0207651_10138998 Ga0207651_101389983 121
259 3300025961 Ga0207712_10463590 Ga0207712_104635902 121
260 3300025972 Ga0207668_10367019 Ga0207668_103670192 121
261 3300026075 Ga0207708_10543375 Ga0207708_105433751 121
262 3300026088 Ga0207641_10596744 Ga0207641_105967442 121
263 3300026095 Ga0207676_10030731 Ga0207676_100307313 121
264 3300026095 Ga0207676_10157048 Ga0207676_101570481 121
265 3300026116 Ga0207674_10372100 Ga0207674_103721003 121
266 3300026118 Ga0207675_101634659 Ga0207675_1016346592 121
267 3300027907 Ga0207428_10303163 Ga0207428_103031632 121
268 3300028380 Ga0268265_10556460 Ga0268265_105564602 121
269 3300028380 Ga0268265_10852920 Ga0268265_108529202 121
270 3300028380 Ga0268265_11326887 Ga0268265_113268871 121
271 3300031241 Ga0265325_10429857 Ga0265325_104298571 121
272 3300031548 Ga0307408_101212958 Ga0307408_1012129581 121
273 3300031691 Ga0316579_10030684 Ga0316579_100306843 121
274 3300031728 Ga0316578_10277146 Ga0316578_102771461 121
275 3300031731 Ga0307405_11053987 Ga0307405_110539871 121
276 3300031995 Ga0307409_100023185 Ga0307409_1000231854 121
277 3300031995 Ga0307409_100759407 Ga0307409_1007594072 121
278 3300031995 Ga0307409_101954295 Ga0307409_1019542951 121
279 3300032004 Ga0307414_11030559 Ga0307414_110305592 121
280 3300032126 Ga0307415_100611937 Ga0307415_1006119372 121
281 3300032133 Ga0316583_10046639 Ga0316583_100466393 121
282 3300035113 Ga0373936_0077601 Ga0373936_0077601_1001_1366 121
283 3300036401 Ga0373937_0475613 Ga0373937_0475613_13_378 121
284 3300044656 Ga0466969_0310098 Ga0466969_0310098_79_444 121
285 3300044693 Ga0466961_0065290 Ga0466961_0065290_637_1002 121
286 3300045976 Ga0466967_0254955 Ga0466967_0254955_1218_1592 121
287 3300046537 Ga0495598_0053077 Ga0495598_0053077_796_1167 121
288 3300050507 nmdc:mga05p37_66552_c1 nmdc:mga05p37_66552_c1_455_877 121
289 3300050511 nmdc:mga08y16_1079725_c1 nmdc:mga08y16_1079725_c1_229_600 121
290 3300050511 nmdc:mga08y16_1226909_c1 nmdc:mga08y16_1226909_c1_12_383 121
291 3300050511 nmdc:mga08y16_565399_c1 nmdc:mga08y16_565399_c1_101_466 121
292 3300050512 nmdc:mga0n895_1866087_c1 nmdc:mga0n895_1866087_c1_102_470 121
293 3300050515 nmdc:mga0a205_1181326_c1 nmdc:mga0a205_1181326_c1_207_572 121
294 3300050515 nmdc:mga0a205_168610_c1 nmdc:mga0a205_168610_c1_1248_1670 121
295 3300050515 nmdc:mga0a205_391701_c1 nmdc:mga0a205_391701_c1_794_1162 121
296 iso_pu_bacteria 2626541554 2626634741 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02311

AraC_binding

AraC-like ligand binding domain

63

141

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.914 19 108
6o2d-assembly1.cif.gz_B schizosaccharomyces pombe cnp3 cupin domain 0.8989 19 109
3lwc-assembly1.cif.gz_A-2 crystal structure of structural genomics, unknown function (yp_766765.1) from rhizobium leguminosarum bv. viciae 3841 at 1.40 a resolution 0.8932 19 109
6u4v-assembly1.cif.gz_A non-crosslinked wild type cysteine dioxygenase 0.8911 28 111
4axo-assembly1.cif.gz_B structure of the clostridium difficile eutq protein 0.8909 18 110
ID Description Score Start End Superfamily
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9423 34 108 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.922 35 108 2.60.120.10
4e2gD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.918 34 114 2.60.120.10
3rnsA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9143 34 109 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9023 19 108 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2U3L9B5-F1-model_v4 Cupin 2, conserved barrel domain protein 0.9983 1 120
AF-A0A3B8YZF2-F1-model_v4 Cupin 0.9976 1 121
AF-A0A7W3MY65-F1-model_v4 Mannose-6-phosphate isomerase-like protein (Cupin superfamily) 0.9973 1 120 GO:0016853
AF-A0A812XGP2-F1-model_v4 deleted 0.9965 1 118
AF-A0A7V1UML9-F1-model_v4 Cupin 0.9963 1 120

Feature Viewer

pLDDT pTM Quality
95.87 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map