F392798
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 295 | 212 | 590 | 177 |
Family's Representative Sequence
| Representative Sequence | 3300046454|Ga0495592_0159039|Ga0495592_0159039_521_1111 |
| Length | 196 |
| Sequence | MPPRAASSTDPAQPFNARIPMTTRLQYGTAAKFFHWFIVALLAVQYPIGWFMPDIHPGMTPGAGMIFHLSIGLTILALTVLRLAWRLTHPVAPESSLPAWQRLSSEAVHWLLYALVLATTVSGWLFASYRGWSVSYFYLVPLPMLTSGNAAAGRAIDGFHQAMELALLVTIGIHIAAALAHIFVYRDRVMQRMLPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 4 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 15 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 16 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 17 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 18 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 19 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 20 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 23 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 26 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 27 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 28 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 29 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 30 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 38 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 41 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 42 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 66 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 67 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 68 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 71 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 72 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 73 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 74 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 75 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 76 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 77 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 78 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 79 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 80 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 81 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 82 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 83 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 84 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 85 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 86 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 87 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 88 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 89 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 90 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 91 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 92 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 93 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 94 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 95 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 96 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 97 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 98 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 99 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 100 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 101 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 102 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 103 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 104 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 105 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 106 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 107 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 108 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 109 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 110 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 111 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 112 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 113 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 114 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 144 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 145 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 146 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 147 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 149 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 152 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 153 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 154 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 155 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 156 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 157 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 158 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 159 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 160 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 161 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 162 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 170 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 171 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 173 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 174 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 175 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 176 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 177 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 178 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 179 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 180 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 181 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 182 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 183 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 184 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 185 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 186 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 187 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 188 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 189 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 190 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 191 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 192 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 193 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 194 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 195 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 196 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 197 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 198 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 199 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 200 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 201 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 202 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 203 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 204 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 205 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 206 | 2906610324 | |||
| 207 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 208 | 2922425934 | |||
| 209 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 210 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 211 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 212 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.88 |
| Metatranscriptomes | 0 |
| Isolates | 5.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.32 |
| Nodule | 4.41 |
| Rhizoplane | 4.75 |
| Rhizosphere | 56.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495592_0159039 | 3300046454 | Bacteria | 1556 |
| 2 | rootH1_10280217 | 3300003323 | Bacteria | 1150 |
| 3 | Ga0055543_1013657 | 3300004625 | Bacteria | 1600 |
| 4 | Ga0065165_1000785 | 3300005262 | Bacteria | 42533 |
| 5 | Ga0070658_10531514 | 3300005327 | Bacteria | 1017 |
| 6 | Ga0070683_101073286 | 3300005329 | Bacteria | 773 |
| 7 | Ga0070674_100388164 | 3300005356 | Bacteria | 1138 |
| 8 | Ga0070714_100004681 | 3300005435 | Bacteria | 10339 |
| 9 | Ga0070713_100059579 | 3300005436 | Bacteria | 3189 |
| 10 | Ga0070713_100362549 | 3300005436 | Bacteria | 1347 |
| 11 | Ga0070713_101086580 | 3300005436 | Bacteria | 773 |
| 12 | Ga0070710_10003057 | 3300005437 | Bacteria | 7954 |
| 13 | Ga0070710_10334801 | 3300005437 | Bacteria | 997 |
| 14 | Ga0070711_100008535 | 3300005439 | Bacteria | 6279 |
| 15 | Ga0070707_101122988 | 3300005468 | Bacteria | 752 |
| 16 | Ga0070697_100050642 | 3300005536 | Bacteria | 3372 |
| 17 | Ga0068855_100986138 | 3300005563 | Bacteria | 886 |
| 18 | Ga0068854_100062080 | 3300005578 | Bacteria | 2708 |
| 19 | Ga0068856_100001216 | 3300005614 | Bacteria | 26989 |
| 20 | Ga0068852_100038109 | 3300005616 | Bacteria | 4037 |
| 21 | Ga0068852_100198466 | 3300005616 | Bacteria | 1898 |
| 22 | Ga0068863_100282825 | 3300005841 | Bacteria | 1607 |
| 23 | Ga0068860_100882797 | 3300005843 | Bacteria | 910 |
| 24 | Ga0070716_100007921 | 3300006173 | Bacteria | 5259 |
| 25 | Ga0070712_100018409 | 3300006175 | Bacteria | 4537 |
| 26 | Ga0075367_10197949 | 3300006178 | Bacteria | 1255 |
| 27 | Ga0097621_100530654 | 3300006237 | Bacteria | 1069 |
| 28 | Ga0097620_100262130 | 3300006931 | Bacteria | 1820 |
| 29 | Ga0099825_1030503 | 3300006941 | Bacteria | 2380 |
| 30 | Ga0099824_1003568 | 3300006942 | Bacteria | 22720 |
| 31 | Ga0099822_1020142 | 3300006943 | Bacteria | 6673 |
| 32 | Ga0099794_10043117 | 3300007265 | Bacteria | 2153 |
| 33 | Ga0099794_10127249 | 3300007265 | Bacteria | 1285 |
| 34 | Ga0099795_10015685 | 3300007788 | Bacteria | 2380 |
| 35 | Ga0099795_10056103 | 3300007788 | Bacteria | 1448 |
| 36 | Ga0105240_10036040 | 3300009093 | Bacteria | 6370 |
| 37 | Ga0105245_10600439 | 3300009098 | Bacteria | 1127 |
| 38 | Ga0105247_10012446 | 3300009101 | Bacteria | 5109 |
| 39 | Ga0105247_10064857 | 3300009101 | Bacteria | 2270 |
| 40 | Ga0105243_10116381 | 3300009148 | Bacteria | 2246 |
| 41 | Ga0105241_10069884 | 3300009174 | Bacteria | 2723 |
| 42 | Ga0105237_10009221 | 3300009545 | Bacteria | 10589 |
| 43 | Ga0105237_10036983 | 3300009545 | Bacteria | 4936 |
| 44 | Ga0105237_10046660 | 3300009545 | Bacteria | 4357 |
| 45 | Ga0105237_10162803 | 3300009545 | Bacteria | 2230 |
| 46 | Ga0105249_10144480 | 3300009553 | Bacteria | 2284 |
| 47 | Ga0099796_10011554 | 3300010159 | Bacteria | 2467 |
| 48 | Ga0099796_10227610 | 3300010159 | Bacteria | 766 |
| 49 | Ga0105239_11780180 | 3300010375 | Bacteria | 714 |
| 50 | Ga0157376_10958619 | 3300014969 | Bacteria | 876 |
| 51 | Ga0213876_10001019 | 3300021384 | Bacteria | 18168 |
| 52 | Ga0213876_10083583 | 3300021384 | Bacteria | 1689 |
| 53 | Ga0213875_10444400 | 3300021388 | Bacteria | 620 |
| 54 | Ga0209148_1001229 | 3300025254 | Bacteria | 14397 |
| 55 | Ga0209233_1002653 | 3300025261 | Bacteria | 6482 |
| 56 | Ga0209233_1003538 | 3300025261 | Bacteria | 5491 |
| 57 | Ga0209233_1038503 | 3300025261 | Bacteria | 1054 |
| 58 | Ga0209455_1001113 | 3300025272 | Bacteria | 13163 |
| 59 | Ga0209455_1003686 | 3300025272 | Bacteria | 5304 |
| 60 | Ga0209758_1006330 | 3300025297 | Bacteria | 8580 |
| 61 | Ga0207692_10002834 | 3300025898 | Bacteria | 6699 |
| 62 | Ga0207710_10016733 | 3300025900 | Bacteria | 3104 |
| 63 | Ga0207710_10066545 | 3300025900 | Bacteria | 1644 |
| 64 | Ga0207699_10002223 | 3300025906 | Bacteria | 9155 |
| 65 | Ga0207705_10390017 | 3300025909 | Bacteria | 1076 |
| 66 | Ga0207695_10000059 | 3300025913 | Bacteria | 363920 |
| 67 | Ga0207671_10006959 | 3300025914 | Bacteria | 9946 |
| 68 | Ga0207671_10064831 | 3300025914 | Bacteria | 2716 |
| 69 | Ga0207693_10053992 | 3300025915 | Bacteria | 3152 |
| 70 | Ga0207693_10206968 | 3300025915 | Bacteria | 1542 |
| 71 | Ga0207663_10012234 | 3300025916 | Bacteria | 4633 |
| 72 | Ga0207687_10402343 | 3300025927 | Bacteria | 1126 |
| 73 | Ga0207700_10041762 | 3300025928 | Bacteria | 3358 |
| 74 | Ga0207700_10180613 | 3300025928 | Bacteria | 1767 |
| 75 | Ga0207700_11330853 | 3300025928 | Bacteria | 640 |
| 76 | Ga0207664_10009480 | 3300025929 | Bacteria | 6835 |
| 77 | Ga0207664_10147528 | 3300025929 | Bacteria | 1996 |
| 78 | Ga0207665_10061911 | 3300025939 | Bacteria | 2538 |
| 79 | Ga0207665_10659013 | 3300025939 | Bacteria | 821 |
| 80 | Ga0207667_10593838 | 3300025949 | Bacteria | 1117 |
| 81 | Ga0207712_10672262 | 3300025961 | Bacteria | 902 |
| 82 | Ga0207640_10116917 | 3300025981 | Bacteria | 1902 |
| 83 | Ga0207678_10043427 | 3300026067 | Bacteria | 3890 |
| 84 | Ga0207702_10001100 | 3300026078 | Bacteria | 27642 |
| 85 | Ga0207676_10750982 | 3300026095 | Bacteria | 949 |
| 86 | Ga0207698_10041813 | 3300026142 | Bacteria | 3419 |
| 87 | Ga0209589_1000015 | 3300027357 | Bacteria | 225913 |
| 88 | Ga0209489_100015 | 3300027361 | Bacteria | 225913 |
| 89 | Ga0209700_100025 | 3300027363 | Bacteria | 225913 |
| 90 | Ga0209588_1079105 | 3300027671 | Bacteria | 1062 |
| 91 | Ga0268264_10549170 | 3300028381 | Bacteria | 1133 |
| 92 | Ga0265319_1011747 | 3300028563 | Bacteria | 3566 |
| 93 | Ga0265334_10004606 | 3300028573 | Bacteria | 6097 |
| 94 | Ga0265318_10013883 | 3300028577 | Bacteria | 3391 |
| 95 | Ga0265323_10005398 | 3300028653 | Bacteria | 5432 |
| 96 | Ga0265336_10000394 | 3300028666 | Bacteria | 27433 |
| 97 | Ga0265338_10001172 | 3300028800 | Bacteria | 43270 |
| 98 | Ga0265324_10007823 | 3300029957 | Bacteria | 4295 |
| 99 | Ga0265332_10110974 | 3300031238 | Bacteria | 1155 |
| 100 | Ga0265340_10021786 | 3300031247 | Bacteria | 3283 |
| 101 | Ga0265339_10109916 | 3300031249 | Bacteria | 1427 |
| 102 | Ga0265339_10203038 | 3300031249 | Bacteria | 977 |
| 103 | Ga0265316_10318402 | 3300031344 | Bacteria | 1130 |
| 104 | Ga0307509_10150891 | 3300031507 | Bacteria | 2239 |
| 105 | Ga0307508_10000715 | 3300031616 | Bacteria | 39415 |
| 106 | Ga0307508_10080513 | 3300031616 | Bacteria | 2838 |
| 107 | Ga0307508_10146587 | 3300031616 | Bacteria | 1964 |
| 108 | Ga0265314_10042686 | 3300031711 | Bacteria | 3232 |
| 109 | Ga0265342_10030908 | 3300031712 | Bacteria | 3315 |
| 110 | Ga0265342_10037909 | 3300031712 | Bacteria | 2937 |
| 111 | Ga0307516_10057129 | 3300031730 | Bacteria | 3802 |
| 112 | Ga0307507_10247617 | 3300033179 | Bacteria | 1156 |
| 113 | Ga0307510_10282468 | 3300033180 | Bacteria | 1130 |
| 114 | Ga0373926_0219767 | 3300035083 | Bacteria | 733 |
| 115 | Ga0373934_0072300 | 3300035086 | Bacteria | 1381 |
| 116 | Ga0373936_0191773 | 3300035113 | Bacteria | 900 |
| 117 | Ga0373945_0077689 | 3300035116 | Bacteria | 1267 |
| 118 | Ga0373943_0134614 | 3300035170 | Bacteria | 1326 |
| 119 | Ga0373946_0010087 | 3300035171 | Bacteria | 3493 |
| 120 | Ga0373935_0066751 | 3300035692 | Bacteria | 2312 |
| 121 | Ga0373935_0894755 | 3300035692 | Bacteria | 657 |
| 122 | Ga0373927_0006414 | 3300035695 | Bacteria | 8017 |
| 123 | Ga0373927_0015524 | 3300035695 | Bacteria | 5031 |
| 124 | Ga0373925_0029117 | 3300037068 | Bacteria | 4051 |
| 125 | Ga0373925_0111295 | 3300037068 | Bacteria | 2115 |
| 126 | Ga0373925_0450880 | 3300037068 | Bacteria | 1053 |
| 127 | Ga0395900_0042572 | 3300037418 | Bacteria | 4680 |
| 128 | Ga0395898_0169370 | 3300037466 | Bacteria | 2088 |
| 129 | Ga0436364_1538075 | 3300037853 | Bacteria | 669 |
| 130 | Ga0395901_0193434 | 3300038443 | Bacteria | 2133 |
| 131 | Ga0436365_0368965 | 3300039437 | Bacteria | 1621 |
| 132 | Ga0436365_1205316 | 3300039437 | Bacteria | 1711 |
| 133 | Ga0436365_1829992 | 3300039437 | Bacteria | 23552 |
| 134 | Ga0436361_0885414 | 3300039447 | Bacteria | 723 |
| 135 | Ga0436362_0286023 | 3300039453 | Bacteria | 3056 |
| 136 | Ga0451800_0067866 | 3300041459 | Bacteria | 942 |
| 137 | Ga0466969_0027293 | 3300044656 | Bacteria | 2924 |
| 138 | Ga0466966_0000563 | 3300044684 | Bacteria | 23663 |
| 139 | Ga0466961_0000087 | 3300044693 | Bacteria | 58547 |
| 140 | Ga0466963_0004010 | 3300044694 | Bacteria | 8511 |
| 141 | Ga0466964_0379267 | 3300044706 | Bacteria | 734 |
| 142 | Ga0466971_0282126 | 3300044719 | Bacteria | 795 |
| 143 | Ga0466971_0543504 | 3300044719 | Bacteria | 576 |
| 144 | Ga0466957_0053685 | 3300044842 | Bacteria | 2458 |
| 145 | Ga0466959_0000716 | 3300045049 | Bacteria | 19360 |
| 146 | Ga0466967_0279815 | 3300045976 | Bacteria | 1600 |
| 147 | Ga0466967_0320472 | 3300045976 | Bacteria | 1495 |
| 148 | Ga0466967_0993912 | 3300045976 | Bacteria | 835 |
| 149 | Ga0495603_0019984 | 3300046455 | Bacteria | 4058 |
| 150 | Ga0495641_0099744 | 3300046461 | Bacteria | 1296 |
| 151 | Ga0495651_0024752 | 3300046462 | Bacteria | 4670 |
| 152 | Ga0495651_0032987 | 3300046462 | Bacteria | 4039 |
| 153 | Ga0495651_0050310 | 3300046462 | Bacteria | 3215 |
| 154 | Ga0495653_0455369 | 3300046463 | Bacteria | 804 |
| 155 | Ga0495580_0313476 | 3300046472 | Bacteria | 1067 |
| 156 | Ga0495582_0088015 | 3300046473 | Bacteria | 1730 |
| 157 | Ga0495664_0003213 | 3300046477 | Bacteria | 8868 |
| 158 | Ga0495664_0497402 | 3300046477 | Bacteria | 728 |
| 159 | Ga0495594_0657462 | 3300046499 | Bacteria | 593 |
| 160 | Ga0495630_0693804 | 3300046517 | Bacteria | 779 |
| 161 | Ga0495652_0014184 | 3300046529 | Bacteria | 7158 |
| 162 | Ga0495652_0027349 | 3300046529 | Bacteria | 5025 |
| 163 | Ga0495652_0255339 | 3300046529 | Bacteria | 1297 |
| 164 | Ga0495622_0027379 | 3300046557 | Bacteria | 2660 |
| 165 | Ga0495622_0037526 | 3300046557 | Bacteria | 2257 |
| 166 | Ga0495667_0171161 | 3300046559 | Bacteria | 1395 |
| 167 | Ga0495634_0283410 | 3300046642 | Bacteria | 1006 |
| 168 | Ga0495635_0019804 | 3300046663 | Bacteria | 4688 |
| 169 | Ga0495635_0124286 | 3300046663 | Bacteria | 1759 |
| 170 | Ga0495657_0001266 | 3300046675 | Bacteria | 21999 |
| 171 | Ga0495599_0019821 | 3300046678 | Bacteria | 4189 |
| 172 | Ga0495599_0189883 | 3300046678 | Bacteria | 1264 |
| 173 | Ga0495623_0001494 | 3300046679 | Bacteria | 15865 |
| 174 | Ga0495646_0069453 | 3300046680 | Bacteria | 2078 |
| 175 | Ga0495646_0095404 | 3300046680 | Bacteria | 1712 |
| 176 | Ga0495669_0239048 | 3300046684 | Bacteria | 872 |
| 177 | Ga0495624_0167373 | 3300046690 | Bacteria | 1341 |
| 178 | Ga0495600_0020632 | 3300046809 | Bacteria | 4213 |
| 179 | Ga0495604_0000470 | 3300047317 | Bacteria | 35601 |
| 180 | Ga0495604_0047648 | 3300047317 | Bacteria | 3337 |
| 181 | Ga0495674_0008519 | 3300047319 | Bacteria | 9761 |
| 182 | Ga0495674_0108966 | 3300047319 | Bacteria | 2350 |
| 183 | Ga0495676_0039914 | 3300047321 | Bacteria | 3881 |
| 184 | Ga0495676_0540663 | 3300047321 | Bacteria | 762 |
| 185 | Ga0495680_0000546 | 3300047322 | Bacteria | 42342 |
| 186 | Ga0495684_0035426 | 3300047471 | Bacteria | 3828 |
| 187 | Ga0495593_0075436 | 3300047673 | Bacteria | 1748 |
| 188 | Ga0495602_0006281 | 3300048088 | Bacteria | 12466 |
| 189 | Ga0495602_0086653 | 3300048088 | Bacteria | 2614 |
| 190 | Ga0495602_0188035 | 3300048088 | Bacteria | 1586 |
| 191 | Ga0496101_0149809 | 3300048904 | Bacteria | 1784 |
| 192 | Ga0496102_0501248 | 3300048905 | Bacteria | 1136 |
| 193 | Ga0496104_0013573 | 3300048907 | Bacteria | 7342 |
| 194 | Ga0496104_0150730 | 3300048907 | Bacteria | 2232 |
| 195 | Ga0496105_0005035 | 3300048908 | Bacteria | 10006 |
| 196 | Ga0496106_0001945 | 3300048909 | Bacteria | 15500 |
| 197 | Ga0496109_0209210 | 3300048912 | Bacteria | 1834 |
| 198 | Ga0496110_0574401 | 3300048913 | Bacteria | 1024 |
| 199 | Ga0496111_0209108 | 3300048914 | Bacteria | 1449 |
| 200 | Ga0496112_0236460 | 3300048915 | Bacteria | 1780 |
| 201 | Ga0496113_0115052 | 3300048916 | Bacteria | 2098 |
| 202 | Ga0496115_0143379 | 3300048918 | Bacteria | 1971 |
| 203 | Ga0496115_0148377 | 3300048918 | Bacteria | 1936 |
| 204 | Ga0496116_0246341 | 3300048919 | Bacteria | 893 |
| 205 | Ga0496117_0070417 | 3300048920 | Bacteria | 2349 |
| 206 | Ga0496118_0003943 | 3300048921 | Bacteria | 18147 |
| 207 | Ga0496118_0031182 | 3300048921 | Bacteria | 4427 |
| 208 | Ga0496119_0102913 | 3300048922 | Bacteria | 1600 |
| 209 | Ga0496120_0011626 | 3300048923 | Bacteria | 6040 |
| 210 | Ga0496121_0003178 | 3300048924 | Bacteria | 23674 |
| 211 | Ga0496121_0081358 | 3300048924 | Bacteria | 2564 |
| 212 | Ga0496121_0183092 | 3300048924 | Bacteria | 1509 |
| 213 | Ga0496124_0002348 | 3300048927 | Bacteria | 24978 |
| 214 | Ga0496124_0044249 | 3300048927 | Bacteria | 3821 |
| 215 | Ga0496124_0509930 | 3300048927 | Bacteria | 804 |
| 216 | Ga0496125_0028745 | 3300048928 | Bacteria | 5012 |
| 217 | Ga0496125_0041231 | 3300048928 | Bacteria | 3950 |
| 218 | Ga0496125_0134383 | 3300048928 | Bacteria | 1733 |
| 219 | Ga0496126_0017275 | 3300048929 | Bacteria | 7189 |
| 220 | Ga0496126_0022316 | 3300048929 | Bacteria | 6162 |
| 221 | Ga0496126_0116401 | 3300048929 | Bacteria | 2323 |
| 222 | Ga0496126_0133366 | 3300048929 | Bacteria | 2144 |
| 223 | Ga0496126_0223347 | 3300048929 | Bacteria | 1581 |
| 224 | Ga0501032_0002419 | 3300049569 | Bacteria | 14568 |
| 225 | Ga0501034_0411046 | 3300049571 | Bacteria | 1275 |
| 226 | Ga0501038_0000519 | 3300049574 | Bacteria | 33842 |
| 227 | Ga0501039_0017792 | 3300049575 | Bacteria | 5452 |
| 228 | Ga0501043_0012980 | 3300049579 | Bacteria | 6511 |
| 229 | Ga0501047_0346015 | 3300049581 | Bacteria | 1324 |
| 230 | Ga0501044_0047933 | 3300049823 | Bacteria | 4418 |
| 231 | nmdc:mga06z11_139169_c1 | 3300050494 | Bacteria | 1370 |
| 232 | nmdc:mga06z11_531570_c1 | 3300050494 | Bacteria | 713 |
| 233 | Ga0500635_0020203 | 3300053080 | Bacteria | 2037 |
| 234 | Ga0500635_0214910 | 3300053080 | Bacteria | 749 |
| 235 | Ga0495619_0055645 | 3300053085 | Bacteria | 2621 |
| 236 | Ga0500566_0000126 | 3300053094 | Bacteria | 39286 |
| 237 | Ga0500566_0087716 | 3300053094 | Bacteria | 1723 |
| 238 | Ga0500640_068477 | 3300053095 | Bacteria | 1526 |
| 239 | Ga0500572_000014 | 3300053111 | Bacteria | 52727 |
| 240 | Ga0500572_000110 | 3300053111 | Bacteria | 27192 |
| 241 | Ga0500572_000976 | 3300053111 | Bacteria | 8666 |
| 242 | Ga0500595_064249 | 3300053119 | Bacteria | 1101 |
| 243 | Ga0500607_120722 | 3300053121 | Bacteria | 1268 |
| 244 | Ga0500608_010946 | 3300053122 | Bacteria | 3917 |
| 245 | Ga0500608_143460 | 3300053122 | Bacteria | 1056 |
| 246 | Ga0500614_000373 | 3300053123 | Bacteria | 11676 |
| 247 | Ga0500559_0000230 | 3300053136 | Bacteria | 44504 |
| 248 | Ga0500559_0000455 | 3300053136 | Bacteria | 29161 |
| 249 | Ga0500559_0002208 | 3300053136 | Bacteria | 10284 |
| 250 | Ga0500559_0011866 | 3300053136 | Bacteria | 3713 |
| 251 | Ga0500559_0015782 | 3300053136 | Bacteria | 3190 |
| 252 | Ga0500564_048416 | 3300053138 | Bacteria | 1948 |
| 253 | Ga0500573_0018252 | 3300053140 | Bacteria | 3997 |
| 254 | Ga0500585_163184 | 3300053144 | Bacteria | 769 |
| 255 | Ga0500603_002065 | 3300053150 | Bacteria | 4440 |
| 256 | Ga0500603_049713 | 3300053150 | Bacteria | 1144 |
| 257 | Ga0500619_052780 | 3300053154 | Bacteria | 1319 |
| 258 | Ga0500620_015935 | 3300053155 | Bacteria | 2136 |
| 259 | Ga0500624_022591 | 3300053157 | Bacteria | 1025 |
| 260 | Ga0500630_006930 | 3300053159 | Bacteria | 5556 |
| 261 | Ga0500638_087113 | 3300053162 | Bacteria | 1475 |
| 262 | Ga0500639_000039 | 3300053163 | Bacteria | 65182 |
| 263 | Ga0500639_165125 | 3300053163 | Bacteria | 1001 |
| 264 | Ga0500636_0000016 | 3300053177 | Bacteria | 123469 |
| 265 | Ga0500636_0019099 | 3300053177 | Bacteria | 4056 |
| 266 | Ga0500636_0051388 | 3300053177 | Bacteria | 2423 |
| 267 | Ga0500636_0146228 | 3300053177 | Bacteria | 1302 |
| 268 | Ga0500636_0250257 | 3300053177 | Bacteria | 904 |
| 269 | Ga0500636_0442319 | 3300053177 | Bacteria | 590 |
| 270 | Ga0500637_0039982 | 3300053178 | Bacteria | 2647 |
| 271 | Ga0500576_136868 | 3300053725 | Bacteria | 938 |
| 272 | Ga0500596_001190 | 3300053735 | Bacteria | 5254 |
| 273 | Ga0500596_006529 | 3300053735 | Bacteria | 1966 |
| 274 | Ga0500601_000237 | 3300053737 | Bacteria | 10803 |
| 275 | Ga0500601_008341 | 3300053737 | Bacteria | 1151 |
| 276 | Ga0500601_029467 | 3300053737 | Bacteria | 649 |
| 277 | Ga0500661_006813 | 3300055283 | Bacteria | 2124 |
| 278 | Ga0500661_057030 | 3300055283 | Bacteria | 702 |
| 279 | 2513638850 | 2513237094 | Bacteria | 8789602 |
| 280 | 2513891679 | 2513237141 | Bacteria | 8496279 |
| 281 | 2528856880 | 2528768022 | Bacteria | 10457665 |
| 282 | 2644291677 | 2643221651 | Bacteria | 4798932 |
| 283 | 2844321554 | 2844315083 | Bacteria | 8138177 |
| 284 | 2881672337 | 2881665667 | Bacteria | 8175609 |
| 285 | 2885377138 | 2885374607 | Bacteria | 8927485 |
| 286 | 2885417526 | 2885409591 | Bacteria | 9235467 |
| 287 | 2903727872 | 2903727486 | Bacteria | 8281579 |
| 288 | 2906602644 | 2906602504 | Bacteria | 8295279 |
| 289 | 2906614412 | |||
| 290 | 2908746761 | 2908739725 | Bacteria | 8628932 |
| 291 | 2922426242 | |||
| 292 | 3005717645 | 3005710791 | Bacteria | 7622528 |
| 293 | 3005724704 | 3005718088 | Bacteria | 8283608 |
| 294 | 8019561733 | 8019555841 | Bacteria | 9642137 |
| 295 | 8019571803 | 8019565922 | Bacteria | 9639779 |
| 296 | Ga0495592_0159039 | |||
| 297 | rootH1_10280217 | |||
| 298 | Ga0055543_1013657 | |||
| 299 | Ga0065165_1000785 | |||
| 300 | Ga0070658_10531514 | |||
| 301 | Ga0070683_101073286 | |||
| 302 | Ga0070674_100388164 | |||
| 303 | Ga0070714_100004681 | |||
| 304 | Ga0070713_100059579 | |||
| 305 | Ga0070713_100362549 | |||
| 306 | Ga0070713_101086580 | |||
| 307 | Ga0070710_10003057 | |||
| 308 | Ga0070710_10334801 | |||
| 309 | Ga0070711_100008535 | |||
| 310 | Ga0070707_101122988 | |||
| 311 | Ga0070697_100050642 | |||
| 312 | Ga0068855_100986138 | |||
| 313 | Ga0068854_100062080 | |||
| 314 | Ga0068856_100001216 | |||
| 315 | Ga0068852_100038109 | |||
| 316 | Ga0068852_100198466 | |||
| 317 | Ga0068863_100282825 | |||
| 318 | Ga0068860_100882797 | |||
| 319 | Ga0070716_100007921 | |||
| 320 | Ga0070712_100018409 | |||
| 321 | Ga0075367_10197949 | |||
| 322 | Ga0097621_100530654 | |||
| 323 | Ga0097620_100262130 | |||
| 324 | Ga0099825_1030503 | |||
| 325 | Ga0099824_1003568 | |||
| 326 | Ga0099822_1020142 | |||
| 327 | Ga0099794_10043117 | |||
| 328 | Ga0099794_10127249 | |||
| 329 | Ga0099795_10015685 | |||
| 330 | Ga0099795_10056103 | |||
| 331 | Ga0105240_10036040 | |||
| 332 | Ga0105245_10600439 | |||
| 333 | Ga0105247_10012446 | |||
| 334 | Ga0105247_10064857 | |||
| 335 | Ga0105243_10116381 | |||
| 336 | Ga0105241_10069884 | |||
| 337 | Ga0105237_10009221 | |||
| 338 | Ga0105237_10036983 | |||
| 339 | Ga0105237_10046660 | |||
| 340 | Ga0105237_10162803 | |||
| 341 | Ga0105249_10144480 | |||
| 342 | Ga0099796_10011554 | |||
| 343 | Ga0099796_10227610 | |||
| 344 | Ga0105239_11780180 | |||
| 345 | Ga0157376_10958619 | |||
| 346 | Ga0213876_10001019 | |||
| 347 | Ga0213876_10083583 | |||
| 348 | Ga0213875_10444400 | |||
| 349 | Ga0209148_1001229 | |||
| 350 | Ga0209233_1002653 | |||
| 351 | Ga0209233_1003538 | |||
| 352 | Ga0209233_1038503 | |||
| 353 | Ga0209455_1001113 | |||
| 354 | Ga0209455_1003686 | |||
| 355 | Ga0209758_1006330 | |||
| 356 | Ga0207692_10002834 | |||
| 357 | Ga0207710_10016733 | |||
| 358 | Ga0207710_10066545 | |||
| 359 | Ga0207699_10002223 | |||
| 360 | Ga0207705_10390017 | |||
| 361 | Ga0207695_10000059 | |||
| 362 | Ga0207671_10006959 | |||
| 363 | Ga0207671_10064831 | |||
| 364 | Ga0207693_10053992 | |||
| 365 | Ga0207693_10206968 | |||
| 366 | Ga0207663_10012234 | |||
| 367 | Ga0207687_10402343 | |||
| 368 | Ga0207700_10041762 | |||
| 369 | Ga0207700_10180613 | |||
| 370 | Ga0207700_11330853 | |||
| 371 | Ga0207664_10009480 | |||
| 372 | Ga0207664_10147528 | |||
| 373 | Ga0207665_10061911 | |||
| 374 | Ga0207665_10659013 | |||
| 375 | Ga0207667_10593838 | |||
| 376 | Ga0207712_10672262 | |||
| 377 | Ga0207640_10116917 | |||
| 378 | Ga0207678_10043427 | |||
| 379 | Ga0207702_10001100 | |||
| 380 | Ga0207676_10750982 | |||
| 381 | Ga0207698_10041813 | |||
| 382 | Ga0209589_1000015 | |||
| 383 | Ga0209489_100015 | |||
| 384 | Ga0209700_100025 | |||
| 385 | Ga0209588_1079105 | |||
| 386 | Ga0268264_10549170 | |||
| 387 | Ga0265319_1011747 | |||
| 388 | Ga0265334_10004606 | |||
| 389 | Ga0265318_10013883 | |||
| 390 | Ga0265323_10005398 | |||
| 391 | Ga0265336_10000394 | |||
| 392 | Ga0265338_10001172 | |||
| 393 | Ga0265324_10007823 | |||
| 394 | Ga0265332_10110974 | |||
| 395 | Ga0265340_10021786 | |||
| 396 | Ga0265339_10109916 | |||
| 397 | Ga0265339_10203038 | |||
| 398 | Ga0265316_10318402 | |||
| 399 | Ga0307509_10150891 | |||
| 400 | Ga0307508_10000715 | |||
| 401 | Ga0307508_10080513 | |||
| 402 | Ga0307508_10146587 | |||
| 403 | Ga0265314_10042686 | |||
| 404 | Ga0265342_10030908 | |||
| 405 | Ga0265342_10037909 | |||
| 406 | Ga0307516_10057129 | |||
| 407 | Ga0307507_10247617 | |||
| 408 | Ga0307510_10282468 | |||
| 409 | Ga0373926_0219767 | |||
| 410 | Ga0373934_0072300 | |||
| 411 | Ga0373936_0191773 | |||
| 412 | Ga0373945_0077689 | |||
| 413 | Ga0373943_0134614 | |||
| 414 | Ga0373946_0010087 | |||
| 415 | Ga0373935_0066751 | |||
| 416 | Ga0373935_0894755 | |||
| 417 | Ga0373927_0006414 | |||
| 418 | Ga0373927_0015524 | |||
| 419 | Ga0373925_0029117 | |||
| 420 | Ga0373925_0111295 | |||
| 421 | Ga0373925_0450880 | |||
| 422 | Ga0395900_0042572 | |||
| 423 | Ga0395898_0169370 | |||
| 424 | Ga0436364_1538075 | |||
| 425 | Ga0395901_0193434 | |||
| 426 | Ga0436365_0368965 | |||
| 427 | Ga0436365_1205316 | |||
| 428 | Ga0436365_1829992 | |||
| 429 | Ga0436361_0885414 | |||
| 430 | Ga0436362_0286023 | |||
| 431 | Ga0451800_0067866 | |||
| 432 | Ga0466969_0027293 | |||
| 433 | Ga0466966_0000563 | |||
| 434 | Ga0466961_0000087 | |||
| 435 | Ga0466963_0004010 | |||
| 436 | Ga0466964_0379267 | |||
| 437 | Ga0466971_0282126 | |||
| 438 | Ga0466971_0543504 | |||
| 439 | Ga0466957_0053685 | |||
| 440 | Ga0466959_0000716 | |||
| 441 | Ga0466967_0279815 | |||
| 442 | Ga0466967_0320472 | |||
| 443 | Ga0466967_0993912 | |||
| 444 | Ga0495603_0019984 | |||
| 445 | Ga0495641_0099744 | |||
| 446 | Ga0495651_0024752 | |||
| 447 | Ga0495651_0032987 | |||
| 448 | Ga0495651_0050310 | |||
| 449 | Ga0495653_0455369 | |||
| 450 | Ga0495580_0313476 | |||
| 451 | Ga0495582_0088015 | |||
| 452 | Ga0495664_0003213 | |||
| 453 | Ga0495664_0497402 | |||
| 454 | Ga0495594_0657462 | |||
| 455 | Ga0495630_0693804 | |||
| 456 | Ga0495652_0014184 | |||
| 457 | Ga0495652_0027349 | |||
| 458 | Ga0495652_0255339 | |||
| 459 | Ga0495622_0027379 | |||
| 460 | Ga0495622_0037526 | |||
| 461 | Ga0495667_0171161 | |||
| 462 | Ga0495634_0283410 | |||
| 463 | Ga0495635_0019804 | |||
| 464 | Ga0495635_0124286 | |||
| 465 | Ga0495657_0001266 | |||
| 466 | Ga0495599_0019821 | |||
| 467 | Ga0495599_0189883 | |||
| 468 | Ga0495623_0001494 | |||
| 469 | Ga0495646_0069453 | |||
| 470 | Ga0495646_0095404 | |||
| 471 | Ga0495669_0239048 | |||
| 472 | Ga0495624_0167373 | |||
| 473 | Ga0495600_0020632 | |||
| 474 | Ga0495604_0000470 | |||
| 475 | Ga0495604_0047648 | |||
| 476 | Ga0495674_0008519 | |||
| 477 | Ga0495674_0108966 | |||
| 478 | Ga0495676_0039914 | |||
| 479 | Ga0495676_0540663 | |||
| 480 | Ga0495680_0000546 | |||
| 481 | Ga0495684_0035426 | |||
| 482 | Ga0495593_0075436 | |||
| 483 | Ga0495602_0006281 | |||
| 484 | Ga0495602_0086653 | |||
| 485 | Ga0495602_0188035 | |||
| 486 | Ga0496101_0149809 | |||
| 487 | Ga0496102_0501248 | |||
| 488 | Ga0496104_0013573 | |||
| 489 | Ga0496104_0150730 | |||
| 490 | Ga0496105_0005035 | |||
| 491 | Ga0496106_0001945 | |||
| 492 | Ga0496109_0209210 | |||
| 493 | Ga0496110_0574401 | |||
| 494 | Ga0496111_0209108 | |||
| 495 | Ga0496112_0236460 | |||
| 496 | Ga0496113_0115052 | |||
| 497 | Ga0496115_0143379 | |||
| 498 | Ga0496115_0148377 | |||
| 499 | Ga0496116_0246341 | |||
| 500 | Ga0496117_0070417 | |||
| 501 | Ga0496118_0003943 | |||
| 502 | Ga0496118_0031182 | |||
| 503 | Ga0496119_0102913 | |||
| 504 | Ga0496120_0011626 | |||
| 505 | Ga0496121_0003178 | |||
| 506 | Ga0496121_0081358 | |||
| 507 | Ga0496121_0183092 | |||
| 508 | Ga0496124_0002348 | |||
| 509 | Ga0496124_0044249 | |||
| 510 | Ga0496124_0509930 | |||
| 511 | Ga0496125_0028745 | |||
| 512 | Ga0496125_0041231 | |||
| 513 | Ga0496125_0134383 | |||
| 514 | Ga0496126_0017275 | |||
| 515 | Ga0496126_0022316 | |||
| 516 | Ga0496126_0116401 | |||
| 517 | Ga0496126_0133366 | |||
| 518 | Ga0496126_0223347 | |||
| 519 | Ga0501032_0002419 | |||
| 520 | Ga0501034_0411046 | |||
| 521 | Ga0501038_0000519 | |||
| 522 | Ga0501039_0017792 | |||
| 523 | Ga0501043_0012980 | |||
| 524 | Ga0501047_0346015 | |||
| 525 | Ga0501044_0047933 | |||
| 526 | nmdc:mga06z11_139169_c1 | |||
| 527 | nmdc:mga06z11_531570_c1 | |||
| 528 | Ga0500635_0020203 | |||
| 529 | Ga0500635_0214910 | |||
| 530 | Ga0495619_0055645 | |||
| 531 | Ga0500566_0000126 | |||
| 532 | Ga0500566_0087716 | |||
| 533 | Ga0500640_068477 | |||
| 534 | Ga0500572_000014 | |||
| 535 | Ga0500572_000110 | |||
| 536 | Ga0500572_000976 | |||
| 537 | Ga0500595_064249 | |||
| 538 | Ga0500607_120722 | |||
| 539 | Ga0500608_010946 | |||
| 540 | Ga0500608_143460 | |||
| 541 | Ga0500614_000373 | |||
| 542 | Ga0500559_0000230 | |||
| 543 | Ga0500559_0000455 | |||
| 544 | Ga0500559_0002208 | |||
| 545 | Ga0500559_0011866 | |||
| 546 | Ga0500559_0015782 | |||
| 547 | Ga0500564_048416 | |||
| 548 | Ga0500573_0018252 | |||
| 549 | Ga0500585_163184 | |||
| 550 | Ga0500603_002065 | |||
| 551 | Ga0500603_049713 | |||
| 552 | Ga0500619_052780 | |||
| 553 | Ga0500620_015935 | |||
| 554 | Ga0500624_022591 | |||
| 555 | Ga0500630_006930 | |||
| 556 | Ga0500638_087113 | |||
| 557 | Ga0500639_000039 | |||
| 558 | Ga0500639_165125 | |||
| 559 | Ga0500636_0000016 | |||
| 560 | Ga0500636_0019099 | |||
| 561 | Ga0500636_0051388 | |||
| 562 | Ga0500636_0146228 | |||
| 563 | Ga0500636_0250257 | |||
| 564 | Ga0500636_0442319 | |||
| 565 | Ga0500637_0039982 | |||
| 566 | Ga0500576_136868 | |||
| 567 | Ga0500596_001190 | |||
| 568 | Ga0500596_006529 | |||
| 569 | Ga0500601_000237 | |||
| 570 | Ga0500601_008341 | |||
| 571 | Ga0500601_029467 | |||
| 572 | Ga0500661_006813 | |||
| 573 | Ga0500661_057030 | |||
| 574 | 2513638850 | |||
| 575 | 2513891679 | |||
| 576 | 2528856880 | |||
| 577 | 2644291677 | |||
| 578 | 2844321554 | |||
| 579 | 2881672337 | |||
| 580 | 2885377138 | |||
| 581 | 2885417526 | |||
| 582 | 2903727872 | |||
| 583 | 2906602644 | |||
| 584 | 2906614412 | |||
| 585 | 2908746761 | |||
| 586 | 2922426242 | |||
| 587 | 3005717645 | |||
| 588 | 3005724704 | |||
| 589 | 8019561733 | |||
| 590 | 8019571803 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5oc0-assembly1.cif.gz_A | structure of e. coli superoxide oxidase | 0.8256 | 6 | 176 |
| 5oc0-assembly1.cif.gz_A | structure of e. coli superoxide oxidase | 0.8039 | 6 | 176 |
| 4gd3-assembly1.cif.gz_A | structure of e. coli hydrogenase-1 in complex with cytochrome b | 0.6182 | 8 | 161 |
| 6g94-assembly1.cif.gz_A | structure of e. coli hydrogenase-1 c19g variant in complex with cytochrome b | 0.5868 | 12 | 161 |
| 4gd3-assembly1.cif.gz_A | structure of e. coli hydrogenase-1 in complex with cytochrome b | 0.5461 | 8 | 161 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76345_3_174_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.8536 | 10 | 176 | 1.20.950.20 |
| af_P76345_3_174_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.8258 | 10 | 176 | 1.20.950.20 |
| af_P0ABE5_4_173_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.8153 | 11 | 176 | 1.20.950.20 |
| af_P0ABE5_4_173_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.7891 | 11 | 176 | 1.20.950.20 |
| af_P0AAM1_1_207_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.6214 | 8 | 161 | 1.20.950.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q5ZRH6-F1-model_v4 | Cytochrome B | 0.9406 | 1 | 175 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 GO:0046872 |
| AF-A0A1H1ZYY3-F1-model_v4 | Cytochrome b561 | 0.9397 | 1 | 176 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 GO:0046872 |
| AF-A0A149U1N0-F1-model_v4 | deleted | 0.9397 | 81 | 174 |
|
| AF-A0A1G0DSZ9-F1-model_v4 | deleted | 0.9385 | 46 | 175 |
|
| AF-A0A3S0EIZ6-F1-model_v4 | Cytochrome b | 0.9356 | 77 | 176 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 GO:0046872 |