F391998
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 294 | 171 | 294 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300006051|Ga0075364_10003548|Ga0075364_1000354812 |
| Length | 221 |
| Sequence | METAQYQDFSMTKGNKGMKALLGTKIGMTQILQEDGVAIPVTLIQAGPCTVTQVKTVENDGYDAVQLGFGSGKNLSNAVAGHVKAAGVTPKFIREFRDVELSDDVKVGAEVDVTTFEVGDHIDVTGTSKGKGFAGNVKRNNFNTSKSTHGGNGYVRKPGSIGSMYPQKVFKGKRMAGRMGAEQVTVKNLIVALVDKENNLIGVKGAVPGPRRSLVVLGEVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 30 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 32 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 33 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 36 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 37 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 38 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 51 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 52 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 65 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 93 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 94 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 95 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 96 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 98 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 99 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 100 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 101 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 103 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 104 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 105 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 106 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 108 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 109 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 110 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 114 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 118 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 119 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 122 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 123 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 124 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 125 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 126 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 127 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 128 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 129 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 130 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 131 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 132 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 133 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 134 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 141 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 149 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 150 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 151 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 152 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 153 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 154 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 155 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 156 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 157 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 158 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 159 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 160 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 161 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 162 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 163 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 164 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 165 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 166 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 167 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 168 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 169 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 170 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 171 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.64 |
| Metatranscriptomes | 1.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.83 |
| Nodule | 0 |
| Rhizoplane | 1.36 |
| Rhizosphere | 71.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10014513 | 3300001979 | Bacteria | 2902 |
| 2 | JGI24739J22299_10002659 | 3300001989 | Bacteria | 6878 |
| 3 | JGI24739J22299_10038219 | 3300001989 | Bacteria | 1614 |
| 4 | JGI24737J22298_10001063 | 3300001990 | Bacteria | 9703 |
| 5 | JGI24735J21928_10000051 | 3300002067 | Bacteria | 50715 |
| 6 | JGI24738J21930_10000517 | 3300002075 | Bacteria | 11027 |
| 7 | rootH1_10010401 | 3300003316 | Bacteria | 137135 |
| 8 | rootH2_10090274 | 3300003320 | Bacteria | 2401 |
| 9 | rootH1_10161764 | 3300003323 | Bacteria | 2646 |
| 10 | rootH1_10188805 | 3300003323 | Bacteria | 1896 |
| 11 | Ga0070658_10000015 | 3300005327 | Bacteria | 230579 |
| 12 | Ga0070658_10000038 | 3300005327 | Bacteria | 137159 |
| 13 | Ga0070658_10000749 | 3300005327 | Bacteria | 27863 |
| 14 | Ga0070658_10355114 | 3300005327 | Bacteria | 1255 |
| 15 | Ga0070683_100436133 | 3300005329 | Bacteria | 1250 |
| 16 | Ga0070680_100389559 | 3300005336 | Bacteria | 1187 |
| 17 | Ga0070660_100002817 | 3300005339 | Bacteria | 11964 |
| 18 | Ga0070660_100064422 | 3300005339 | Bacteria | 2851 |
| 19 | Ga0070661_100120902 | 3300005344 | Bacteria | 1962 |
| 20 | Ga0070692_10333193 | 3300005345 | Bacteria | 937 |
| 21 | Ga0070671_100011362 | 3300005355 | Bacteria | 7159 |
| 22 | Ga0070659_100052748 | 3300005366 | Bacteria | 3199 |
| 23 | Ga0070667_100004521 | 3300005367 | Bacteria | 11712 |
| 24 | Ga0070714_100000778 | 3300005435 | Bacteria | 22615 |
| 25 | Ga0070662_100001599 | 3300005457 | Bacteria | 13983 |
| 26 | Ga0070681_10041601 | 3300005458 | Bacteria | 4606 |
| 27 | Ga0070679_100002994 | 3300005530 | Bacteria | 15427 |
| 28 | Ga0070679_100220191 | 3300005530 | Bacteria | 1859 |
| 29 | Ga0070679_100310303 | 3300005530 | Bacteria | 1527 |
| 30 | Ga0070679_101199679 | 3300005530 | Unclassified | 704 |
| 31 | Ga0070684_100021107 | 3300005535 | Bacteria | 5412 |
| 32 | Ga0070684_101293301 | 3300005535 | Unclassified | 686 |
| 33 | Ga0068855_100000002 | 3300005563 | Bacteria | 616881 |
| 34 | Ga0068855_100000011 | 3300005563 | Bacteria | 244140 |
| 35 | Ga0070664_100002342 | 3300005564 | Bacteria | 15228 |
| 36 | Ga0068857_100004496 | 3300005577 | Bacteria | 11786 |
| 37 | Ga0068857_100010860 | 3300005577 | Bacteria | 7925 |
| 38 | Ga0068857_100012235 | 3300005577 | Bacteria | 7466 |
| 39 | Ga0068856_100053648 | 3300005614 | Bacteria | 3975 |
| 40 | Ga0068856_101363901 | 3300005614 | Bacteria | 724 |
| 41 | Ga0068852_100000001 | 3300005616 | Bacteria | 716526 |
| 42 | Ga0068852_100000135 | 3300005616 | Bacteria | 49773 |
| 43 | Ga0068852_100064341 | 3300005616 | Bacteria | 3197 |
| 44 | Ga0068863_100284704 | 3300005841 | Bacteria | 1602 |
| 45 | Ga0068863_100378676 | 3300005841 | Unclassified | 1382 |
| 46 | Ga0068858_100022783 | 3300005842 | Bacteria | 5841 |
| 47 | Ga0068858_100301287 | 3300005842 | Bacteria | 1529 |
| 48 | Ga0081455_10000003 | 3300005937 | Bacteria | 367763 |
| 49 | Ga0075365_10000214 | 3300006038 | Bacteria | 19436 |
| 50 | Ga0075365_10052043 | 3300006038 | Bacteria | 2707 |
| 51 | Ga0075365_10062192 | 3300006038 | Bacteria | 2496 |
| 52 | Ga0075365_10151605 | 3300006038 | Bacteria | 1612 |
| 53 | Ga0075365_10233082 | 3300006038 | Bacteria | 1293 |
| 54 | Ga0075368_10000022 | 3300006042 | Bacteria | 37479 |
| 55 | Ga0075363_100013867 | 3300006048 | Bacteria | 3922 |
| 56 | Ga0075363_100070456 | 3300006048 | Bacteria | 1899 |
| 57 | Ga0075364_10000164 | 3300006051 | Bacteria | 29508 |
| 58 | Ga0075364_10003548 | 3300006051 | Bacteria | 8878 |
| 59 | Ga0075364_10011764 | 3300006051 | Bacteria | 5328 |
| 60 | Ga0075364_10033950 | 3300006051 | Bacteria | 3288 |
| 61 | Ga0075364_10106585 | 3300006051 | Bacteria | 1867 |
| 62 | Ga0075362_10086185 | 3300006177 | Unclassified | 1453 |
| 63 | Ga0075367_10007006 | 3300006178 | Bacteria | 5742 |
| 64 | Ga0075369_10000098 | 3300006186 | Bacteria | 23291 |
| 65 | Ga0075369_10002696 | 3300006186 | Bacteria | 6366 |
| 66 | Ga0075369_10122036 | 3300006186 | Bacteria | 1180 |
| 67 | Ga0075366_10002227 | 3300006195 | Bacteria | 9899 |
| 68 | Ga0075366_10007166 | 3300006195 | Bacteria | 6141 |
| 69 | Ga0075366_10157019 | 3300006195 | Bacteria | 1378 |
| 70 | Ga0097621_100000003 | 3300006237 | Bacteria | 164830 |
| 71 | Ga0075370_10002897 | 3300006353 | Bacteria | 8052 |
| 72 | Ga0075370_10192930 | 3300006353 | Bacteria | 1201 |
| 73 | Ga0068871_100000013 | 3300006358 | Bacteria | 102533 |
| 74 | Ga0075428_100002637 | 3300006844 | Bacteria | 19511 |
| 75 | Ga0105240_10000099 | 3300009093 | Bacteria | 177984 |
| 76 | Ga0105240_10000789 | 3300009093 | Bacteria | 57388 |
| 77 | Ga0105240_10006053 | 3300009093 | Bacteria | 17870 |
| 78 | Ga0105240_10041368 | 3300009093 | Bacteria | 5882 |
| 79 | Ga0105240_10280704 | 3300009093 | Bacteria | 1913 |
| 80 | Ga0105245_10004821 | 3300009098 | Bacteria | 11893 |
| 81 | Ga0105245_10058511 | 3300009098 | Bacteria | 3469 |
| 82 | Ga0105245_10097872 | 3300009098 | Bacteria | 2710 |
| 83 | Ga0105241_10211172 | 3300009174 | Bacteria | 1626 |
| 84 | Ga0105241_10238520 | 3300009174 | Bacteria | 1536 |
| 85 | Ga0105248_10081293 | 3300009177 | Bacteria | 3642 |
| 86 | Ga0105248_10125134 | 3300009177 | Bacteria | 2900 |
| 87 | Ga0105248_10137424 | 3300009177 | Bacteria | 2757 |
| 88 | Ga0105237_10000002 | 3300009545 | Bacteria | 702357 |
| 89 | Ga0105237_10098952 | 3300009545 | Bacteria | 2908 |
| 90 | Ga0105238_10000463 | 3300009551 | Bacteria | 42690 |
| 91 | Ga0105249_10650179 | 3300009553 | Bacteria | 1112 |
| 92 | Ga0105032_100001 | 3300009979 | Bacteria | 472394 |
| 93 | Ga0105029_103435 | 3300009984 | Bacteria | 1059 |
| 94 | Ga0105028_114182 | 3300009993 | Bacteria | 846 |
| 95 | Ga0105239_10000261 | 3300010375 | Bacteria | 78396 |
| 96 | Ga0105239_10030706 | 3300010375 | Bacteria | 5910 |
| 97 | Ga0105239_10082083 | 3300010375 | Bacteria | 3549 |
| 98 | Ga0105246_10026407 | 3300011119 | Bacteria | 3793 |
| 99 | Ga0157373_10045816 | 3300013100 | Bacteria | 3121 |
| 100 | Ga0157371_10014329 | 3300013102 | Bacteria | 5987 |
| 101 | Ga0157371_10016956 | 3300013102 | Bacteria | 5424 |
| 102 | Ga0157371_10106092 | 3300013102 | Bacteria | 1994 |
| 103 | Ga0157374_10005678 | 3300013296 | Bacteria | 10519 |
| 104 | Ga0157372_10000008 | 3300013307 | Bacteria | 305449 |
| 105 | Ga0157372_10014740 | 3300013307 | Bacteria | 8367 |
| 106 | Ga0157372_10064805 | 3300013307 | Bacteria | 4100 |
| 107 | Ga0157372_10083034 | 3300013307 | Bacteria | 3629 |
| 108 | Ga0157372_10603391 | 3300013307 | Unclassified | 1279 |
| 109 | Ga0157375_10379132 | 3300013308 | Bacteria | 1581 |
| 110 | Ga0163163_10026685 | 3300014325 | Bacteria | 5525 |
| 111 | Ga0163163_10040682 | 3300014325 | Bacteria | 4540 |
| 112 | Ga0157377_10006077 | 3300014745 | Bacteria | 5729 |
| 113 | Ga0157379_10807415 | 3300014968 | Bacteria | 886 |
| 114 | Ga0206354_10409707 | 3300020081 | Bacteria | 906 |
| 115 | Ga0154015_1647357 | 3300020610 | Bacteria | 2333 |
| 116 | Ga0207697_10112750 | 3300025315 | Bacteria | 1165 |
| 117 | Ga0207688_10026962 | 3300025901 | Bacteria | 3160 |
| 118 | Ga0207647_10000670 | 3300025904 | Bacteria | 26786 |
| 119 | Ga0207705_10000011 | 3300025909 | Bacteria | 517768 |
| 120 | Ga0207705_10000051 | 3300025909 | Bacteria | 169369 |
| 121 | Ga0207705_10000805 | 3300025909 | Bacteria | 25778 |
| 122 | Ga0207654_10062122 | 3300025911 | Bacteria | 2187 |
| 123 | Ga0207654_10181016 | 3300025911 | Bacteria | 1375 |
| 124 | Ga0207695_10000980 | 3300025913 | Bacteria | 50757 |
| 125 | Ga0207695_10002053 | 3300025913 | Bacteria | 30792 |
| 126 | Ga0207695_10005007 | 3300025913 | Bacteria | 17795 |
| 127 | Ga0207695_10167710 | 3300025913 | Bacteria | 2123 |
| 128 | Ga0207695_10621433 | 3300025913 | Unclassified | 961 |
| 129 | Ga0207671_10000008 | 3300025914 | Bacteria | 798229 |
| 130 | Ga0207657_10002122 | 3300025919 | Bacteria | 21466 |
| 131 | Ga0207657_10006928 | 3300025919 | Bacteria | 11684 |
| 132 | Ga0207652_10298533 | 3300025921 | Bacteria | 1454 |
| 133 | Ga0207652_11077551 | 3300025921 | Unclassified | 704 |
| 134 | Ga0207694_10001212 | 3300025924 | Bacteria | 22387 |
| 135 | Ga0207687_10032456 | 3300025927 | Bacteria | 3536 |
| 136 | Ga0207664_10003229 | 3300025929 | Bacteria | 10836 |
| 137 | Ga0207644_10018410 | 3300025931 | Bacteria | 4725 |
| 138 | Ga0207690_10037930 | 3300025932 | Bacteria | 3132 |
| 139 | Ga0207706_10000543 | 3300025933 | Bacteria | 40146 |
| 140 | Ga0207711_10111283 | 3300025941 | Bacteria | 2436 |
| 141 | Ga0207661_10020254 | 3300025944 | Bacteria | 4967 |
| 142 | Ga0207679_10001254 | 3300025945 | Bacteria | 16096 |
| 143 | Ga0207667_10000005 | 3300025949 | Bacteria | 715503 |
| 144 | Ga0207667_10000042 | 3300025949 | Bacteria | 263461 |
| 145 | Ga0207658_10149931 | 3300025986 | Bacteria | 1898 |
| 146 | Ga0207703_10083378 | 3300026035 | Bacteria | 2671 |
| 147 | Ga0207702_10000015 | 3300026078 | Bacteria | 250830 |
| 148 | Ga0207702_11372335 | 3300026078 | Bacteria | 701 |
| 149 | Ga0207641_10394019 | 3300026088 | Unclassified | 1328 |
| 150 | Ga0207674_10001283 | 3300026116 | Bacteria | 32760 |
| 151 | Ga0207674_10006337 | 3300026116 | Bacteria | 13931 |
| 152 | Ga0207674_11270348 | 3300026116 | Unclassified | 706 |
| 153 | Ga0207683_10124859 | 3300026121 | Bacteria | 2313 |
| 154 | Ga0207698_10000001 | 3300026142 | Bacteria | 625389 |
| 155 | Ga0207698_10000100 | 3300026142 | Bacteria | 54808 |
| 156 | Ga0207698_10104850 | 3300026142 | Bacteria | 2354 |
| 157 | Ga0209974_10003244 | 3300027876 | Bacteria | 5880 |
| 158 | Ga0265337_1000393 | 3300028556 | Bacteria | 23484 |
| 159 | Ga0265337_1001212 | 3300028556 | Bacteria | 13111 |
| 160 | Ga0265326_10001574 | 3300028558 | Bacteria | 7973 |
| 161 | Ga0265326_10025778 | 3300028558 | Bacteria | 1676 |
| 162 | Ga0265326_10102610 | 3300028558 | Unclassified | 811 |
| 163 | Ga0265322_10003222 | 3300028654 | Bacteria | 4953 |
| 164 | Ga0265336_10001312 | 3300028666 | Bacteria | 11608 |
| 165 | Ga0265336_10014347 | 3300028666 | Bacteria | 2627 |
| 166 | Ga0265338_10000366 | 3300028800 | Bacteria | 81024 |
| 167 | Ga0265338_10005862 | 3300028800 | Bacteria | 15847 |
| 168 | Ga0265338_10006100 | 3300028800 | Bacteria | 15472 |
| 169 | Ga0265338_10009458 | 3300028800 | Bacteria | 11616 |
| 170 | Ga0265338_10028695 | 3300028800 | Bacteria | 5543 |
| 171 | Ga0265338_10077670 | 3300028800 | Bacteria | 2806 |
| 172 | Ga0265324_10075144 | 3300029957 | Bacteria | 1150 |
| 173 | Ga0314311_1192020 | 3300030733 | Bacteria | 2799 |
| 174 | Ga0314311_1247552 | 3300030733 | Bacteria | 817 |
| 175 | Ga0316179_1092254 | 3300030734 | Bacteria | 2026 |
| 176 | Ga0316182_1174300 | 3300030745 | Bacteria | 8921 |
| 177 | Ga0265330_10014985 | 3300031235 | Bacteria | 3589 |
| 178 | Ga0265320_10006089 | 3300031240 | Bacteria | 7652 |
| 179 | Ga0265320_10023257 | 3300031240 | Bacteria | 3301 |
| 180 | Ga0265325_10049734 | 3300031241 | Bacteria | 2161 |
| 181 | Ga0265329_10008397 | 3300031242 | Bacteria | 3918 |
| 182 | Ga0265340_10171292 | 3300031247 | Bacteria | 983 |
| 183 | Ga0265331_10030101 | 3300031250 | Bacteria | 2705 |
| 184 | Ga0265327_10000017 | 3300031251 | Bacteria | 445264 |
| 185 | Ga0265327_10003953 | 3300031251 | Bacteria | 13546 |
| 186 | Ga0265327_10051807 | 3300031251 | Bacteria | 2140 |
| 187 | Ga0265316_10082558 | 3300031344 | Bacteria | 2462 |
| 188 | Ga0307509_10022978 | 3300031507 | Bacteria | 7011 |
| 189 | Ga0265313_10046207 | 3300031595 | Bacteria | 2115 |
| 190 | Ga0265314_10198631 | 3300031711 | Bacteria | 1187 |
| 191 | Ga0265342_10253422 | 3300031712 | Bacteria | 938 |
| 192 | Ga0307516_10000021 | 3300031730 | Bacteria | 192678 |
| 193 | Ga0307516_10007665 | 3300031730 | Bacteria | 12354 |
| 194 | Ga0307405_10552332 | 3300031731 | Bacteria | 932 |
| 195 | Ga0307406_10000001 | 3300031901 | Bacteria | 638191 |
| 196 | Ga0307406_10001464 | 3300031901 | Bacteria | 13054 |
| 197 | Ga0316593_10000418 | 3300032168 | Bacteria | 7700 |
| 198 | Ga0316593_10094715 | 3300032168 | Bacteria | 1054 |
| 199 | Ga0395899_0007520 | 3300037312 | Bacteria | 8420 |
| 200 | Ga0395899_0028089 | 3300037312 | Bacteria | 4238 |
| 201 | Ga0395900_0000001 | 3300037418 | Bacteria | 931146 |
| 202 | Ga0395900_0007425 | 3300037418 | Bacteria | 11327 |
| 203 | Ga0395900_0012262 | 3300037418 | Bacteria | 8765 |
| 204 | Ga0395900_0028633 | 3300037418 | Bacteria | 5710 |
| 205 | Ga0395900_0047517 | 3300037418 | Bacteria | 4419 |
| 206 | Ga0395900_0337994 | 3300037418 | Bacteria | 1482 |
| 207 | Ga0395898_0000002 | 3300037466 | Bacteria | 931013 |
| 208 | Ga0395898_0002536 | 3300037466 | Bacteria | 21416 |
| 209 | Ga0395898_0019794 | 3300037466 | Bacteria | 6844 |
| 210 | Ga0395898_0023323 | 3300037466 | Bacteria | 6255 |
| 211 | Ga0395905_0008237 | 3300037471 | Bacteria | 10294 |
| 212 | Ga0395905_0830521 | 3300037471 | Bacteria | 827 |
| 213 | Ga0395901_0000060 | 3300038443 | Bacteria | 152235 |
| 214 | Ga0395901_0021849 | 3300038443 | Bacteria | 6557 |
| 215 | Ga0395901_0774811 | 3300038443 | Bacteria | 950 |
| 216 | Ga0439461_0002061 | 3300041410 | Bacteria | 3182 |
| 217 | Ga0451791_1481266 | 3300041451 | Bacteria | 641 |
| 218 | Ga0439437_005689 | 3300042000 | Bacteria | 1374 |
| 219 | Ga0439463_013422 | 3300042016 | Bacteria | 2015 |
| 220 | Ga0439463_044428 | 3300042016 | Bacteria | 1131 |
| 221 | Ga0450910_011948 | 3300042147 | Bacteria | 1251 |
| 222 | Ga0439446_0025878 | 3300042156 | Bacteria | 1678 |
| 223 | Ga0439459_0098297 | 3300042438 | Bacteria | 713 |
| 224 | Ga0439464_0000015 | 3300042439 | Bacteria | 23381 |
| 225 | Ga0439464_0010888 | 3300042439 | Bacteria | 2404 |
| 226 | Ga0466963_0083237 | 3300044694 | Bacteria | 2170 |
| 227 | Ga0453684_0184817 | 3300044712 | Bacteria | 2444 |
| 228 | Ga0466970_0080419 | 3300044765 | Bacteria | 1761 |
| 229 | Ga0451576_0057342 | 3300045051 | Bacteria | 4072 |
| 230 | Ga0495638_0000070 | 3300046460 | Bacteria | 166954 |
| 231 | Ga0495609_0242265 | 3300046538 | Bacteria | 744 |
| 232 | Ga0495660_0025091 | 3300046810 | Bacteria | 3387 |
| 233 | Ga0495672_0045226 | 3300047320 | Bacteria | 2636 |
| 234 | Ga0495672_0234728 | 3300047320 | Bacteria | 898 |
| 235 | Ga0496100_0017467 | 3300048903 | Bacteria | 4235 |
| 236 | Ga0496101_0259683 | 3300048904 | Bacteria | 1355 |
| 237 | Ga0496113_0255648 | 3300048916 | Bacteria | 1399 |
| 238 | Ga0501034_0095158 | 3300049571 | Bacteria | 2975 |
| 239 | Ga0501037_0065519 | 3300049573 | Bacteria | 2647 |
| 240 | Ga0501038_0985983 | 3300049574 | Bacteria | 619 |
| 241 | Ga0501047_0000229 | 3300049581 | Bacteria | 66412 |
| 242 | Ga0501073_0086672 | 3300049589 | Bacteria | 2178 |
| 243 | Ga0501080_0001402 | 3300049742 | Bacteria | 20194 |
| 244 | Ga0501035_0000033 | 3300049822 | Bacteria | 175087 |
| 245 | nmdc:mga03683_23826_c1 | 3300050489 | Unclassified | 1475 |
| 246 | nmdc:mga03n38_19_c1 | 3300050490 | Bacteria | 41192 |
| 247 | nmdc:mga03n38_29122_c1 | 3300050490 | Bacteria | 2308 |
| 248 | nmdc:mga03n38_44353_c1 | 3300050490 | Bacteria | 1953 |
| 249 | nmdc:mga00v17_105154_c1 | 3300050491 | Bacteria | 1786 |
| 250 | nmdc:mga00v17_1085_c1 | 3300050491 | Bacteria | 14334 |
| 251 | nmdc:mga00v17_130291_c1 | 3300050491 | Bacteria | 1607 |
| 252 | nmdc:mga00v17_21407_c1 | 3300050491 | Bacteria | 3717 |
| 253 | nmdc:mga0yw44_1645_c1 | 3300050492 | Bacteria | 8998 |
| 254 | nmdc:mga0yw44_164612_c1 | 3300050492 | Bacteria | 1453 |
| 255 | nmdc:mga0yw44_182956_c1 | 3300050492 | Bacteria | 1380 |
| 256 | nmdc:mga0yw44_184_c1 | 3300050492 | Bacteria | 21563 |
| 257 | nmdc:mga0yw44_710131_c1 | 3300050492 | Bacteria | 683 |
| 258 | nmdc:mga0yw44_7289_c1 | 3300050492 | Bacteria | 5427 |
| 259 | nmdc:mga0k408_152150_c1 | 3300050493 | Bacteria | 1378 |
| 260 | nmdc:mga0k408_2531_c1 | 3300050493 | Bacteria | 9718 |
| 261 | nmdc:mga0k408_3588_c1 | 3300050493 | Bacteria | 7866 |
| 262 | nmdc:mga06z11_14_c1 | 3300050494 | Bacteria | 96662 |
| 263 | nmdc:mga06z11_306_c1 | 3300050494 | Bacteria | 18617 |
| 264 | nmdc:mga06z11_724795_c1 | 3300050494 | Bacteria | 606 |
| 265 | nmdc:mga04h51_10_c1 | 3300050495 | Bacteria | 102434 |
| 266 | nmdc:mga07m45_172045_c1 | 3300050496 | Bacteria | 1259 |
| 267 | nmdc:mga07m45_18647_c1 | 3300050496 | Bacteria | 3751 |
| 268 | nmdc:mga07m45_259727_c1 | 3300050496 | Bacteria | 1011 |
| 269 | nmdc:mga0sz30_502_c1 | 3300050516 | Bacteria | 11988 |
| 270 | nmdc:mga0sz30_8841_c1 | 3300050516 | Bacteria | 3817 |
| 271 | Ga0500610_0000001 | 3300053079 | Bacteria | 185468 |
| 272 | Ga0500643_000011 | 3300053087 | Bacteria | 385630 |
| 273 | Ga0500643_004330 | 3300053087 | Bacteria | 6473 |
| 274 | Ga0500643_053770 | 3300053087 | Bacteria | 1145 |
| 275 | Ga0500644_0000365 | 3300053088 | Bacteria | 22175 |
| 276 | Ga0500644_0006209 | 3300053088 | Bacteria | 3051 |
| 277 | Ga0500646_0021137 | 3300053090 | Bacteria | 1732 |
| 278 | Ga0500646_0040356 | 3300053090 | Bacteria | 1312 |
| 279 | Ga0500583_0032370 | 3300053092 | Bacteria | 2306 |
| 280 | Ga0500651_0000203 | 3300053093 | Bacteria | 37688 |
| 281 | Ga0500555_000002 | 3300053103 | Bacteria | 1314346 |
| 282 | Ga0500556_0000829 | 3300053104 | Bacteria | 17806 |
| 283 | Ga0500562_000001 | 3300053108 | Bacteria | 1178987 |
| 284 | Ga0500562_024707 | 3300053108 | Bacteria | 1571 |
| 285 | Ga0500593_000001 | 3300053117 | Bacteria | 784404 |
| 286 | Ga0500593_046489 | 3300053117 | Bacteria | 1934 |
| 287 | Ga0500594_0000139 | 3300053118 | Bacteria | 20048 |
| 288 | Ga0500628_000006 | 3300053129 | Bacteria | 154858 |
| 289 | Ga0500652_000084 | 3300053131 | Bacteria | 39562 |
| 290 | Ga0500652_149987 | 3300053131 | Bacteria | 968 |
| 291 | Ga0500655_000643 | 3300053133 | Bacteria | 7006 |
| 292 | Ga0500655_001125 | 3300053133 | Bacteria | 5106 |
| 293 | Ga0500616_0000005 | 3300053153 | Bacteria | 961725 |
| 294 | Ga0500616_0000012 | 3300053153 | Bacteria | 681798 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006186 | Ga0075369_10122036 | Ga0075369_101220361 | 163 |
| 2 | 3300041451 | Ga0451791_1481266 | Ga0451791_1481266_33_617 | 164 |
| 3 | 3300049574 | Ga0501038_0985983 | Ga0501038_0985983_20_541 | 164 |
| 4 | 3300050491 | nmdc:mga00v17_130291_c1 | nmdc:mga00v17_130291_c1_399_983 | 165 |
| 5 | 3300050492 | nmdc:mga0yw44_182956_c1 | nmdc:mga0yw44_182956_c1_269_853 | 165 |
| 6 | 3300006353 | Ga0075370_10192930 | Ga0075370_101929302 | 166 |
| 7 | 3300050496 | nmdc:mga07m45_172045_c1 | nmdc:mga07m45_172045_c1_244_858 | 166 |
| 8 | 3300053153 | Ga0500616_0000012 | Ga0500616_0000012_516242_516856 | 166 |
| 9 | 3300009979 | Ga0105032_100001 | Ga0105032_100001152 | 167 |
| 10 | 3300032168 | Ga0316593_10000418 | Ga0316593_1000041815 | 169 |
| 11 | 3300050494 | nmdc:mga06z11_724795_c1 | nmdc:mga06z11_724795_c1_61_573 | 170 |
| 12 | 3300032168 | Ga0316593_10094715 | Ga0316593_100947152 | 173 |
| 13 | 3300031730 | Ga0307516_10000021 | Ga0307516_1000002117 | 174 |
| 14 | 3300001989 | JGI24739J22299_10038219 | JGI24739J22299_100382192 | 175 |
| 15 | 3300006038 | Ga0075365_10151605 | Ga0075365_101516052 | 175 |
| 16 | 3300006051 | Ga0075364_10106585 | Ga0075364_101065852 | 175 |
| 17 | 3300006195 | Ga0075366_10007166 | Ga0075366_100071662 | 175 |
| 18 | 3300050493 | nmdc:mga0k408_3588_c1 | nmdc:mga0k408_3588_c1_2366_2980 | 175 |
| 19 | 3300049589 | Ga0501073_0086672 | Ga0501073_0086672_872_1456 | 179 |
| 20 | 3300049742 | Ga0501080_0001402 | Ga0501080_0001402_1006_1590 | 179 |
| 21 | 3300009993 | Ga0105028_114182 | Ga0105028_1141821 | 181 |
| 22 | 3300037471 | Ga0395905_0830521 | Ga0395905_0830521_26_577 | 181 |
| 23 | 3300046538 | Ga0495609_0242265 | Ga0495609_0242265_167_730 | 181 |
| 24 | 3300053087 | Ga0500643_000011 | Ga0500643_000011_56870_57487 | 184 |
| 25 | 3300046460 | Ga0495638_0000070 | Ga0495638_0000070_96606_97217 | 185 |
| 26 | 3300009093 | Ga0105240_10000099 | Ga0105240_10000099167 | 186 |
| 27 | 3300009545 | Ga0105237_10098952 | Ga0105237_100989524 | 186 |
| 28 | 3300025913 | Ga0207695_10000980 | Ga0207695_1000098040 | 186 |
| 29 | 3300006844 | Ga0075428_100002637 | Ga0075428_1000026378 | 187 |
| 30 | 3300009984 | Ga0105029_103435 | Ga0105029_1034352 | 187 |
| 31 | 3300006038 | Ga0075365_10052043 | Ga0075365_100520432 | 188 |
| 32 | 3300006177 | Ga0075362_10086185 | Ga0075362_100861853 | 188 |
| 33 | 3300009093 | Ga0105240_10280704 | Ga0105240_102807042 | 188 |
| 34 | 3300050489 | nmdc:mga03683_23826_c1 | nmdc:mga03683_23826_c1_122_736 | 188 |
| 35 | 3300050492 | nmdc:mga0yw44_7289_c1 | nmdc:mga0yw44_7289_c1_3370_3981 | 188 |
| 36 | 3300003323 | rootH1_10161764 | rootH1_101617644 | 190 |
| 37 | 3300005530 | Ga0070679_100220191 | Ga0070679_1002201911 | 190 |
| 38 | 3300037418 | Ga0395900_0007425 | Ga0395900_0007425_4616_5194 | 190 |
| 39 | 3300037466 | Ga0395898_0019794 | Ga0395898_0019794_4502_5080 | 190 |
| 40 | 3300038443 | Ga0395901_0774811 | Ga0395901_0774811_159_737 | 190 |
| 41 | 3300005435 | Ga0070714_100000778 | Ga0070714_1000007782 | 191 |
| 42 | 3300005530 | Ga0070679_100002994 | Ga0070679_10000299417 | 191 |
| 43 | 3300005530 | Ga0070679_101199679 | Ga0070679_1011996791 | 191 |
| 44 | 3300010375 | Ga0105239_10000261 | Ga0105239_1000026162 | 191 |
| 45 | 3300025913 | Ga0207695_10621433 | Ga0207695_106214331 | 191 |
| 46 | 3300025921 | Ga0207652_11077551 | Ga0207652_110775511 | 191 |
| 47 | 3300030733 | Ga0314311_1192020 | Ga0314311_11920202 | 191 |
| 48 | 3300050490 | nmdc:mga03n38_19_c1 | nmdc:mga03n38_19_c1_1873_2460 | 191 |
| 49 | 3300050494 | nmdc:mga06z11_14_c1 | nmdc:mga06z11_14_c1_38823_39410 | 191 |
| 50 | 3300050495 | nmdc:mga04h51_10_c1 | nmdc:mga04h51_10_c1_27888_28475 | 191 |
| 51 | 3300050496 | nmdc:mga07m45_18647_c1 | nmdc:mga07m45_18647_c1_243_830 | 191 |
| 52 | 3300006038 | Ga0075365_10062192 | Ga0075365_100621924 | 192 |
| 53 | 3300006042 | Ga0075368_10000022 | Ga0075368_1000002251 | 192 |
| 54 | 3300006048 | Ga0075363_100013867 | Ga0075363_1000138671 | 192 |
| 55 | 3300006051 | Ga0075364_10033950 | Ga0075364_100339501 | 192 |
| 56 | 3300006178 | Ga0075367_10007006 | Ga0075367_100070067 | 192 |
| 57 | 3300006186 | Ga0075369_10000098 | Ga0075369_1000009837 | 192 |
| 58 | 3300030734 | Ga0316179_1092254 | Ga0316179_10922542 | 192 |
| 59 | 3300050490 | nmdc:mga03n38_29122_c1 | nmdc:mga03n38_29122_c1_1526_2140 | 192 |
| 60 | 3300050492 | nmdc:mga0yw44_1645_c1 | nmdc:mga0yw44_1645_c1_552_1166 | 192 |
| 61 | 3300050492 | nmdc:mga0yw44_710131_c1 | nmdc:mga0yw44_710131_c1_11_625 | 192 |
| 62 | 3300050494 | nmdc:mga06z11_306_c1 | nmdc:mga06z11_306_c1_6897_7511 | 192 |
| 63 | 3300050496 | nmdc:mga07m45_259727_c1 | nmdc:mga07m45_259727_c1_261_875 | 192 |
| 64 | 3300050516 | nmdc:mga0sz30_502_c1 | nmdc:mga0sz30_502_c1_4059_4673 | 192 |
| 65 | 3300053090 | Ga0500646_0040356 | Ga0500646_0040356_308_922 | 192 |
| 66 | 3300053092 | Ga0500583_0032370 | Ga0500583_0032370_90_704 | 192 |
| 67 | 3300053117 | Ga0500593_046489 | Ga0500593_046489_490_1104 | 192 |
| 68 | 3300053131 | Ga0500652_149987 | Ga0500652_149987_118_732 | 192 |
| 69 | 3300044712 | Ga0453684_0184817 | Ga0453684_0184817_21_605 | 193 |
| 70 | 3300003323 | rootH1_10188805 | rootH1_101888051 | 194 |
| 71 | 3300005563 | Ga0068855_100000002 | Ga0068855_100000002177 | 194 |
| 72 | 3300025913 | Ga0207695_10167710 | Ga0207695_101677102 | 194 |
| 73 | 3300025949 | Ga0207667_10000005 | Ga0207667_10000005287 | 194 |
| 74 | 3300030733 | Ga0314311_1247552 | Ga0314311_12475522 | 194 |
| 75 | 3300053093 | Ga0500651_0000203 | Ga0500651_0000203_32103_32717 | 194 |
| 76 | 3300005327 | Ga0070658_10355114 | Ga0070658_103551141 | 195 |
| 77 | 3300013102 | Ga0157371_10106092 | Ga0157371_101060922 | 195 |
| 78 | 3300030745 | Ga0316182_1174300 | Ga0316182_117430013 | 195 |
| 79 | 3300041410 | Ga0439461_0002061 | Ga0439461_0002061_240_854 | 195 |
| 80 | 3300042016 | Ga0439463_044428 | Ga0439463_044428_149_763 | 195 |
| 81 | 3300042147 | Ga0450910_011948 | Ga0450910_011948_42_656 | 195 |
| 82 | 3300042438 | Ga0439459_0098297 | Ga0439459_0098297_80_694 | 195 |
| 83 | 3300042439 | Ga0439464_0010888 | Ga0439464_0010888_1744_2358 | 195 |
| 84 | 3300003316 | rootH1_10010401 | rootH1_100104015 | 197 |
| 85 | 3300005355 | Ga0070671_100011362 | Ga0070671_10001136212 | 200 |
| 86 | 3300005841 | Ga0068863_100378676 | Ga0068863_1003786762 | 200 |
| 87 | 3300009177 | Ga0105248_10125134 | Ga0105248_101251344 | 200 |
| 88 | 3300014968 | Ga0157379_10807415 | Ga0157379_108074152 | 200 |
| 89 | 3300025931 | Ga0207644_10018410 | Ga0207644_100184103 | 200 |
| 90 | 3300025941 | Ga0207711_10111283 | Ga0207711_101112833 | 200 |
| 91 | 3300026088 | Ga0207641_10394019 | Ga0207641_103940192 | 200 |
| 92 | 3300028800 | Ga0265338_10000366 | Ga0265338_1000036623 | 200 |
| 93 | 3300028800 | Ga0265338_10028695 | Ga0265338_100286958 | 200 |
| 94 | 3300005336 | Ga0070680_100389559 | Ga0070680_1003895592 | 201 |
| 95 | 3300005367 | Ga0070667_100004521 | Ga0070667_10000452120 | 201 |
| 96 | 3300005937 | Ga0081455_10000003 | Ga0081455_10000003294 | 201 |
| 97 | 3300006048 | Ga0075363_100070456 | Ga0075363_1000704562 | 201 |
| 98 | 3300006195 | Ga0075366_10157019 | Ga0075366_101570192 | 201 |
| 99 | 3300009093 | Ga0105240_10041368 | Ga0105240_100413688 | 201 |
| 100 | 3300009177 | Ga0105248_10081293 | Ga0105248_100812934 | 201 |
| 101 | 3300009553 | Ga0105249_10650179 | Ga0105249_106501791 | 201 |
| 102 | 3300013307 | Ga0157372_10603391 | Ga0157372_106033912 | 201 |
| 103 | 3300014325 | Ga0163163_10026685 | Ga0163163_100266853 | 201 |
| 104 | 3300014325 | Ga0163163_10040682 | Ga0163163_100406828 | 201 |
| 105 | 3300025929 | Ga0207664_10003229 | Ga0207664_1000322919 | 201 |
| 106 | 3300025986 | Ga0207658_10149931 | Ga0207658_101499312 | 201 |
| 107 | 3300026116 | Ga0207674_11270348 | Ga0207674_112703481 | 201 |
| 108 | 3300026121 | Ga0207683_10124859 | Ga0207683_101248594 | 201 |
| 109 | 3300028556 | Ga0265337_1000393 | Ga0265337_100039312 | 201 |
| 110 | 3300028556 | Ga0265337_1001212 | Ga0265337_100121217 | 201 |
| 111 | 3300028558 | Ga0265326_10001574 | Ga0265326_100015746 | 201 |
| 112 | 3300028558 | Ga0265326_10025778 | Ga0265326_100257784 | 201 |
| 113 | 3300028654 | Ga0265322_10003222 | Ga0265322_100032222 | 201 |
| 114 | 3300028666 | Ga0265336_10001312 | Ga0265336_1000131211 | 201 |
| 115 | 3300028666 | Ga0265336_10014347 | Ga0265336_100143473 | 201 |
| 116 | 3300028800 | Ga0265338_10005862 | Ga0265338_1000586217 | 201 |
| 117 | 3300028800 | Ga0265338_10006100 | Ga0265338_1000610011 | 201 |
| 118 | 3300028800 | Ga0265338_10009458 | Ga0265338_1000945819 | 201 |
| 119 | 3300028800 | Ga0265338_10077670 | Ga0265338_100776702 | 201 |
| 120 | 3300029957 | Ga0265324_10075144 | Ga0265324_100751441 | 201 |
| 121 | 3300031235 | Ga0265330_10014985 | Ga0265330_100149853 | 201 |
| 122 | 3300031240 | Ga0265320_10006089 | Ga0265320_1000608915 | 201 |
| 123 | 3300031240 | Ga0265320_10023257 | Ga0265320_100232572 | 201 |
| 124 | 3300031241 | Ga0265325_10049734 | Ga0265325_100497342 | 201 |
| 125 | 3300031242 | Ga0265329_10008397 | Ga0265329_100083972 | 201 |
| 126 | 3300031247 | Ga0265340_10171292 | Ga0265340_101712922 | 201 |
| 127 | 3300031250 | Ga0265331_10030101 | Ga0265331_100301011 | 201 |
| 128 | 3300031251 | Ga0265327_10000017 | Ga0265327_10000017162 | 201 |
| 129 | 3300031251 | Ga0265327_10051807 | Ga0265327_100518072 | 201 |
| 130 | 3300031344 | Ga0265316_10082558 | Ga0265316_100825583 | 201 |
| 131 | 3300031595 | Ga0265313_10046207 | Ga0265313_100462071 | 201 |
| 132 | 3300031711 | Ga0265314_10198631 | Ga0265314_101986313 | 201 |
| 133 | 3300031712 | Ga0265342_10253422 | Ga0265342_102534221 | 201 |
| 134 | 3300037418 | Ga0395900_0028633 | Ga0395900_0028633_648_1259 | 201 |
| 135 | 3300037418 | Ga0395900_0047517 | Ga0395900_0047517_275_886 | 201 |
| 136 | 3300037466 | Ga0395898_0023323 | Ga0395898_0023323_1400_2011 | 201 |
| 137 | 3300050490 | nmdc:mga03n38_44353_c1 | nmdc:mga03n38_44353_c1_917_1534 | 201 |
| 138 | 3300050493 | nmdc:mga0k408_152150_c1 | nmdc:mga0k408_152150_c1_145_768 | 201 |
| 139 | 3300053079 | Ga0500610_0000001 | Ga0500610_0000001_57322_57945 | 201 |
| 140 | 3300053088 | Ga0500644_0000365 | Ga0500644_0000365_13239_13862 | 201 |
| 141 | 3300053088 | Ga0500644_0006209 | Ga0500644_0006209_1121_1744 | 201 |
| 142 | 3300053104 | Ga0500556_0000829 | Ga0500556_0000829_8733_9371 | 201 |
| 143 | 3300053118 | Ga0500594_0000139 | Ga0500594_0000139_12472_13095 | 201 |
| 144 | 3300053129 | Ga0500628_000006 | Ga0500628_000006_148496_149119 | 201 |
| 145 | 3300053153 | Ga0500616_0000005 | Ga0500616_0000005_391924_392562 | 201 |
| 146 | 3300005327 | Ga0070658_10000015 | Ga0070658_1000001537 | 202 |
| 147 | 3300005329 | Ga0070683_100436133 | Ga0070683_1004361331 | 202 |
| 148 | 3300005535 | Ga0070684_101293301 | Ga0070684_1012933011 | 202 |
| 149 | 3300005842 | Ga0068858_100022783 | Ga0068858_10002278312 | 202 |
| 150 | 3300009098 | Ga0105245_10004821 | Ga0105245_1000482118 | 202 |
| 151 | 3300009098 | Ga0105245_10058511 | Ga0105245_100585113 | 202 |
| 152 | 3300025909 | Ga0207705_10000011 | Ga0207705_10000011309 | 202 |
| 153 | 3300025927 | Ga0207687_10032456 | Ga0207687_100324565 | 202 |
| 154 | 3300026035 | Ga0207703_10083378 | Ga0207703_100833785 | 202 |
| 155 | 3300028558 | Ga0265326_10102610 | Ga0265326_101026101 | 202 |
| 156 | 3300031251 | Ga0265327_10003953 | Ga0265327_100039532 | 202 |
| 157 | 3300037418 | Ga0395900_0012262 | Ga0395900_0012262_5499_6113 | 202 |
| 158 | 3300037418 | Ga0395900_0337994 | Ga0395900_0337994_482_1102 | 202 |
| 159 | 3300037466 | Ga0395898_0002536 | Ga0395898_0002536_5219_5833 | 202 |
| 160 | 3300037471 | Ga0395905_0008237 | Ga0395905_0008237_2553_3167 | 202 |
| 161 | 3300038443 | Ga0395901_0021849 | Ga0395901_0021849_798_1412 | 202 |
| 162 | 3300049571 | Ga0501034_0095158 | Ga0501034_0095158_1211_1825 | 202 |
| 163 | 3300049573 | Ga0501037_0065519 | Ga0501037_0065519_1117_1731 | 202 |
| 164 | 3300049581 | Ga0501047_0000229 | Ga0501047_0000229_59592_60206 | 202 |
| 165 | 3300049822 | Ga0501035_0000033 | Ga0501035_0000033_157636_158250 | 202 |
| 166 | 3300053087 | Ga0500643_004330 | Ga0500643_004330_467_1093 | 202 |
| 167 | 3300053103 | Ga0500555_000002 | Ga0500555_000002_472633_473259 | 202 |
| 168 | 3300053108 | Ga0500562_024707 | Ga0500562_024707_174_800 | 202 |
| 169 | 3300053131 | Ga0500652_000084 | Ga0500652_000084_19260_19886 | 202 |
| 170 | 3300001979 | JGI24740J21852_10014513 | JGI24740J21852_100145132 | 203 |
| 171 | 3300001989 | JGI24739J22299_10002659 | JGI24739J22299_100026592 | 203 |
| 172 | 3300001990 | JGI24737J22298_10001063 | JGI24737J22298_100010636 | 203 |
| 173 | 3300002067 | JGI24735J21928_10000051 | JGI24735J21928_1000005112 | 203 |
| 174 | 3300002075 | JGI24738J21930_10000517 | JGI24738J21930_1000051718 | 203 |
| 175 | 3300003320 | rootH2_10090274 | rootH2_100902744 | 203 |
| 176 | 3300005327 | Ga0070658_10000038 | Ga0070658_10000038121 | 203 |
| 177 | 3300005327 | Ga0070658_10000749 | Ga0070658_100007499 | 203 |
| 178 | 3300005339 | Ga0070660_100002817 | Ga0070660_10000281724 | 203 |
| 179 | 3300005339 | Ga0070660_100064422 | Ga0070660_1000644222 | 203 |
| 180 | 3300005344 | Ga0070661_100120902 | Ga0070661_1001209021 | 203 |
| 181 | 3300005345 | Ga0070692_10333193 | Ga0070692_103331931 | 203 |
| 182 | 3300005366 | Ga0070659_100052748 | Ga0070659_1000527484 | 203 |
| 183 | 3300005457 | Ga0070662_100001599 | Ga0070662_1000015991 | 203 |
| 184 | 3300005458 | Ga0070681_10041601 | Ga0070681_100416019 | 203 |
| 185 | 3300005530 | Ga0070679_100310303 | Ga0070679_1003103032 | 203 |
| 186 | 3300005535 | Ga0070684_100021107 | Ga0070684_1000211076 | 203 |
| 187 | 3300005563 | Ga0068855_100000011 | Ga0068855_10000001194 | 203 |
| 188 | 3300005564 | Ga0070664_100002342 | Ga0070664_10000234213 | 203 |
| 189 | 3300005577 | Ga0068857_100004496 | Ga0068857_1000044964 | 203 |
| 190 | 3300005577 | Ga0068857_100010860 | Ga0068857_1000108602 | 203 |
| 191 | 3300005577 | Ga0068857_100012235 | Ga0068857_1000122355 | 203 |
| 192 | 3300005614 | Ga0068856_100053648 | Ga0068856_1000536484 | 203 |
| 193 | 3300005614 | Ga0068856_101363901 | Ga0068856_1013639012 | 203 |
| 194 | 3300005616 | Ga0068852_100000001 | Ga0068852_100000001565 | 203 |
| 195 | 3300005616 | Ga0068852_100000135 | Ga0068852_10000013538 | 203 |
| 196 | 3300005616 | Ga0068852_100064341 | Ga0068852_1000643414 | 203 |
| 197 | 3300005841 | Ga0068863_100284704 | Ga0068863_1002847042 | 203 |
| 198 | 3300005842 | Ga0068858_100301287 | Ga0068858_1003012873 | 203 |
| 199 | 3300006038 | Ga0075365_10000214 | Ga0075365_100002148 | 203 |
| 200 | 3300006038 | Ga0075365_10233082 | Ga0075365_102330822 | 203 |
| 201 | 3300006051 | Ga0075364_10000164 | Ga0075364_1000016414 | 203 |
| 202 | 3300006051 | Ga0075364_10003548 | Ga0075364_1000354812 | 203 |
| 203 | 3300006051 | Ga0075364_10011764 | Ga0075364_100117642 | 203 |
| 204 | 3300006186 | Ga0075369_10002696 | Ga0075369_100026964 | 203 |
| 205 | 3300006195 | Ga0075366_10002227 | Ga0075366_100022278 | 203 |
| 206 | 3300006237 | Ga0097621_100000003 | Ga0097621_10000000390 | 203 |
| 207 | 3300006353 | Ga0075370_10002897 | Ga0075370_100028979 | 203 |
| 208 | 3300006358 | Ga0068871_100000013 | Ga0068871_10000001388 | 203 |
| 209 | 3300009093 | Ga0105240_10000789 | Ga0105240_1000078917 | 203 |
| 210 | 3300009093 | Ga0105240_10006053 | Ga0105240_1000605330 | 203 |
| 211 | 3300009098 | Ga0105245_10097872 | Ga0105245_100978723 | 203 |
| 212 | 3300009174 | Ga0105241_10211172 | Ga0105241_102111722 | 203 |
| 213 | 3300009174 | Ga0105241_10238520 | Ga0105241_102385201 | 203 |
| 214 | 3300009177 | Ga0105248_10137424 | Ga0105248_101374242 | 203 |
| 215 | 3300009545 | Ga0105237_10000002 | Ga0105237_10000002457 | 203 |
| 216 | 3300009551 | Ga0105238_10000463 | Ga0105238_1000046315 | 203 |
| 217 | 3300010375 | Ga0105239_10030706 | Ga0105239_1003070612 | 203 |
| 218 | 3300010375 | Ga0105239_10082083 | Ga0105239_100820831 | 203 |
| 219 | 3300011119 | Ga0105246_10026407 | Ga0105246_100264074 | 203 |
| 220 | 3300013100 | Ga0157373_10045816 | Ga0157373_100458163 | 203 |
| 221 | 3300013102 | Ga0157371_10014329 | Ga0157371_100143298 | 203 |
| 222 | 3300013102 | Ga0157371_10016956 | Ga0157371_100169566 | 203 |
| 223 | 3300013296 | Ga0157374_10005678 | Ga0157374_100056787 | 203 |
| 224 | 3300013307 | Ga0157372_10000008 | Ga0157372_1000000820 | 203 |
| 225 | 3300013307 | Ga0157372_10014740 | Ga0157372_1001474019 | 203 |
| 226 | 3300013307 | Ga0157372_10064805 | Ga0157372_100648055 | 203 |
| 227 | 3300013307 | Ga0157372_10083034 | Ga0157372_100830344 | 203 |
| 228 | 3300013308 | Ga0157375_10379132 | Ga0157375_103791322 | 203 |
| 229 | 3300014745 | Ga0157377_10006077 | Ga0157377_100060772 | 203 |
| 230 | 3300020081 | Ga0206354_10409707 | Ga0206354_104097071 | 203 |
| 231 | 3300020610 | Ga0154015_1647357 | Ga0154015_16473571 | 203 |
| 232 | 3300025315 | Ga0207697_10112750 | Ga0207697_101127501 | 203 |
| 233 | 3300025901 | Ga0207688_10026962 | Ga0207688_100269624 | 203 |
| 234 | 3300025904 | Ga0207647_10000670 | Ga0207647_1000067014 | 203 |
| 235 | 3300025909 | Ga0207705_10000051 | Ga0207705_1000005169 | 203 |
| 236 | 3300025909 | Ga0207705_10000805 | Ga0207705_1000080525 | 203 |
| 237 | 3300025911 | Ga0207654_10062122 | Ga0207654_100621222 | 203 |
| 238 | 3300025911 | Ga0207654_10181016 | Ga0207654_101810162 | 203 |
| 239 | 3300025913 | Ga0207695_10002053 | Ga0207695_1000205317 | 203 |
| 240 | 3300025913 | Ga0207695_10005007 | Ga0207695_1000500730 | 203 |
| 241 | 3300025914 | Ga0207671_10000008 | Ga0207671_10000008562 | 203 |
| 242 | 3300025919 | Ga0207657_10002122 | Ga0207657_1000212213 | 203 |
| 243 | 3300025919 | Ga0207657_10006928 | Ga0207657_100069285 | 203 |
| 244 | 3300025921 | Ga0207652_10298533 | Ga0207652_102985332 | 203 |
| 245 | 3300025924 | Ga0207694_10001212 | Ga0207694_1000121216 | 203 |
| 246 | 3300025932 | Ga0207690_10037930 | Ga0207690_100379304 | 203 |
| 247 | 3300025933 | Ga0207706_10000543 | Ga0207706_1000054313 | 203 |
| 248 | 3300025944 | Ga0207661_10020254 | Ga0207661_100202545 | 203 |
| 249 | 3300025945 | Ga0207679_10001254 | Ga0207679_1000125413 | 203 |
| 250 | 3300025949 | Ga0207667_10000042 | Ga0207667_10000042196 | 203 |
| 251 | 3300026078 | Ga0207702_10000015 | Ga0207702_10000015273 | 203 |
| 252 | 3300026078 | Ga0207702_11372335 | Ga0207702_113723351 | 203 |
| 253 | 3300026116 | Ga0207674_10001283 | Ga0207674_1000128324 | 203 |
| 254 | 3300026116 | Ga0207674_10006337 | Ga0207674_100063372 | 203 |
| 255 | 3300026142 | Ga0207698_10000001 | Ga0207698_10000001515 | 203 |
| 256 | 3300026142 | Ga0207698_10000100 | Ga0207698_1000010028 | 203 |
| 257 | 3300026142 | Ga0207698_10104850 | Ga0207698_101048503 | 203 |
| 258 | 3300027876 | Ga0209974_10003244 | Ga0209974_100032443 | 203 |
| 259 | 3300031507 | Ga0307509_10022978 | Ga0307509_100229783 | 203 |
| 260 | 3300031730 | Ga0307516_10007665 | Ga0307516_1000766512 | 203 |
| 261 | 3300031731 | Ga0307405_10552332 | Ga0307405_105523322 | 203 |
| 262 | 3300031901 | Ga0307406_10000001 | Ga0307406_10000001111 | 203 |
| 263 | 3300031901 | Ga0307406_10001464 | Ga0307406_100014646 | 203 |
| 264 | 3300037312 | Ga0395899_0007520 | Ga0395899_0007520_2891_3502 | 203 |
| 265 | 3300037312 | Ga0395899_0028089 | Ga0395899_0028089_1885_2499 | 203 |
| 266 | 3300037418 | Ga0395900_0000001 | Ga0395900_0000001_99057_99668 | 203 |
| 267 | 3300037466 | Ga0395898_0000002 | Ga0395898_0000002_75452_76063 | 203 |
| 268 | 3300038443 | Ga0395901_0000060 | Ga0395901_0000060_138029_138640 | 203 |
| 269 | 3300042000 | Ga0439437_005689 | Ga0439437_005689_140_751 | 203 |
| 270 | 3300042016 | Ga0439463_013422 | Ga0439463_013422_683_1294 | 203 |
| 271 | 3300042156 | Ga0439446_0025878 | Ga0439446_0025878_1018_1653 | 203 |
| 272 | 3300042439 | Ga0439464_0000015 | Ga0439464_0000015_2511_3122 | 203 |
| 273 | 3300044694 | Ga0466963_0083237 | Ga0466963_0083237_1470_2084 | 203 |
| 274 | 3300044765 | Ga0466970_0080419 | Ga0466970_0080419_503_1126 | 203 |
| 275 | 3300045051 | Ga0451576_0057342 | Ga0451576_0057342_378_992 | 203 |
| 276 | 3300046810 | Ga0495660_0025091 | Ga0495660_0025091_113_778 | 203 |
| 277 | 3300047320 | Ga0495672_0045226 | Ga0495672_0045226_1255_1869 | 203 |
| 278 | 3300047320 | Ga0495672_0234728 | Ga0495672_0234728_270_884 | 203 |
| 279 | 3300048903 | Ga0496100_0017467 | Ga0496100_0017467_2903_3526 | 203 |
| 280 | 3300048904 | Ga0496101_0259683 | Ga0496101_0259683_364_978 | 203 |
| 281 | 3300048916 | Ga0496113_0255648 | Ga0496113_0255648_390_1001 | 203 |
| 282 | 3300050491 | nmdc:mga00v17_105154_c1 | nmdc:mga00v17_105154_c1_924_1535 | 203 |
| 283 | 3300050491 | nmdc:mga00v17_1085_c1 | nmdc:mga00v17_1085_c1_3565_4203 | 203 |
| 284 | 3300050491 | nmdc:mga00v17_21407_c1 | nmdc:mga00v17_21407_c1_2661_3326 | 203 |
| 285 | 3300050492 | nmdc:mga0yw44_164612_c1 | nmdc:mga0yw44_164612_c1_407_1021 | 203 |
| 286 | 3300050492 | nmdc:mga0yw44_184_c1 | nmdc:mga0yw44_184_c1_15213_15851 | 203 |
| 287 | 3300050493 | nmdc:mga0k408_2531_c1 | nmdc:mga0k408_2531_c1_5786_6397 | 203 |
| 288 | 3300050516 | nmdc:mga0sz30_8841_c1 | nmdc:mga0sz30_8841_c1_1249_1860 | 203 |
| 289 | 3300053087 | Ga0500643_053770 | Ga0500643_053770_258_887 | 203 |
| 290 | 3300053090 | Ga0500646_0021137 | Ga0500646_0021137_1067_1681 | 203 |
| 291 | 3300053108 | Ga0500562_000001 | Ga0500562_000001_302037_302702 | 203 |
| 292 | 3300053117 | Ga0500593_000001 | Ga0500593_000001_565718_566341 | 203 |
| 293 | 3300053133 | Ga0500655_000643 | Ga0500655_000643_3588_4253 | 203 |
| 294 | 3300053133 | Ga0500655_001125 | Ga0500655_001125_1131_1754 | 203 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c93-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.9277 | 1 | 203 |
| 8c97-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.9208 | 1 | 203 |
| 8c93-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.9168 | 1 | 203 |
| 6pvk-assembly1.cif.gz_D | bacterial 45srbga ribosomal particle class a | 0.9043 | 2 | 203 |
| 8c97-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.9042 | 1 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9SKX4_88_148_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9258 | 34 | 89 | 3.30.160.810 |
| af_P9WH87_35_101_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.902 | 34 | 91 | 3.30.160.810 |
| af_Q9LIT4_106_169_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9018 | 34 | 93 | 3.30.160.810 |
| af_Q2FW06_34_105_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.8931 | 34 | 91 | 3.30.160.810 |
| af_P60438_33_95_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.8899 | 34 | 91 | 3.30.160.810 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1RPG5-F1-model_v4 | 50S ribosomal protein L3 | 0.9093 | 4 | 115 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A7C6X7N2-F1-model_v4 | 50S ribosomal protein L3 | 0.7974 | 4 | 133 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A3B8XIH3-F1-model_v4 | deleted | 0.7804 | 1 | 144 |
|
| AF-A0A3B8XIH3-F1-model_v4 | deleted | 0.7751 | 1 | 144 |
|
| AF-A0A2H0XZV5-F1-model_v4 | Large ribosomal subunit protein uL3 | 0.7728 | 1 | 200 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar