F391998

General Info

Members Datasets Scaffolds Average Seq Length
294 171 294 200

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10003548|Ga0075364_1000354812
Length 221
Sequence METAQYQDFSMTKGNKGMKALLGTKIGMTQILQEDGVAIPVTLIQAGPCTVTQVKTVENDGYDAVQLGFGSGKNLSNAVAGHVKAAGVTPKFIREFRDVELSDDVKVGAEVDVTTFEVGDHIDVTGTSKGKGFAGNVKRNNFNTSKSTHGGNGYVRKPGSIGSMYPQKVFKGKRMAGRMGAEQVTVKNLIVALVDKENNLIGVKGAVPGPRRSLVVLGEVK

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
51 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
52 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
93 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
94 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
95 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
98 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
99 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
100 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
101 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
123 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
124 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
125 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
126 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
127 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
128 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
129 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
149 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
157 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
158 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
159 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
160 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
161 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
162 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
163 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
164 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
165 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
166 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
167 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
168 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
169 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
170 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 1.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.83
Nodule 0
Rhizoplane 1.36
Rhizosphere 71.43
Stem 0
Stem Tuber 0
Unclassified 2.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10014513 3300001979 Bacteria 2902
2 JGI24739J22299_10002659 3300001989 Bacteria 6878
3 JGI24739J22299_10038219 3300001989 Bacteria 1614
4 JGI24737J22298_10001063 3300001990 Bacteria 9703
5 JGI24735J21928_10000051 3300002067 Bacteria 50715
6 JGI24738J21930_10000517 3300002075 Bacteria 11027
7 rootH1_10010401 3300003316 Bacteria 137135
8 rootH2_10090274 3300003320 Bacteria 2401
9 rootH1_10161764 3300003323 Bacteria 2646
10 rootH1_10188805 3300003323 Bacteria 1896
11 Ga0070658_10000015 3300005327 Bacteria 230579
12 Ga0070658_10000038 3300005327 Bacteria 137159
13 Ga0070658_10000749 3300005327 Bacteria 27863
14 Ga0070658_10355114 3300005327 Bacteria 1255
15 Ga0070683_100436133 3300005329 Bacteria 1250
16 Ga0070680_100389559 3300005336 Bacteria 1187
17 Ga0070660_100002817 3300005339 Bacteria 11964
18 Ga0070660_100064422 3300005339 Bacteria 2851
19 Ga0070661_100120902 3300005344 Bacteria 1962
20 Ga0070692_10333193 3300005345 Bacteria 937
21 Ga0070671_100011362 3300005355 Bacteria 7159
22 Ga0070659_100052748 3300005366 Bacteria 3199
23 Ga0070667_100004521 3300005367 Bacteria 11712
24 Ga0070714_100000778 3300005435 Bacteria 22615
25 Ga0070662_100001599 3300005457 Bacteria 13983
26 Ga0070681_10041601 3300005458 Bacteria 4606
27 Ga0070679_100002994 3300005530 Bacteria 15427
28 Ga0070679_100220191 3300005530 Bacteria 1859
29 Ga0070679_100310303 3300005530 Bacteria 1527
30 Ga0070679_101199679 3300005530 Unclassified 704
31 Ga0070684_100021107 3300005535 Bacteria 5412
32 Ga0070684_101293301 3300005535 Unclassified 686
33 Ga0068855_100000002 3300005563 Bacteria 616881
34 Ga0068855_100000011 3300005563 Bacteria 244140
35 Ga0070664_100002342 3300005564 Bacteria 15228
36 Ga0068857_100004496 3300005577 Bacteria 11786
37 Ga0068857_100010860 3300005577 Bacteria 7925
38 Ga0068857_100012235 3300005577 Bacteria 7466
39 Ga0068856_100053648 3300005614 Bacteria 3975
40 Ga0068856_101363901 3300005614 Bacteria 724
41 Ga0068852_100000001 3300005616 Bacteria 716526
42 Ga0068852_100000135 3300005616 Bacteria 49773
43 Ga0068852_100064341 3300005616 Bacteria 3197
44 Ga0068863_100284704 3300005841 Bacteria 1602
45 Ga0068863_100378676 3300005841 Unclassified 1382
46 Ga0068858_100022783 3300005842 Bacteria 5841
47 Ga0068858_100301287 3300005842 Bacteria 1529
48 Ga0081455_10000003 3300005937 Bacteria 367763
49 Ga0075365_10000214 3300006038 Bacteria 19436
50 Ga0075365_10052043 3300006038 Bacteria 2707
51 Ga0075365_10062192 3300006038 Bacteria 2496
52 Ga0075365_10151605 3300006038 Bacteria 1612
53 Ga0075365_10233082 3300006038 Bacteria 1293
54 Ga0075368_10000022 3300006042 Bacteria 37479
55 Ga0075363_100013867 3300006048 Bacteria 3922
56 Ga0075363_100070456 3300006048 Bacteria 1899
57 Ga0075364_10000164 3300006051 Bacteria 29508
58 Ga0075364_10003548 3300006051 Bacteria 8878
59 Ga0075364_10011764 3300006051 Bacteria 5328
60 Ga0075364_10033950 3300006051 Bacteria 3288
61 Ga0075364_10106585 3300006051 Bacteria 1867
62 Ga0075362_10086185 3300006177 Unclassified 1453
63 Ga0075367_10007006 3300006178 Bacteria 5742
64 Ga0075369_10000098 3300006186 Bacteria 23291
65 Ga0075369_10002696 3300006186 Bacteria 6366
66 Ga0075369_10122036 3300006186 Bacteria 1180
67 Ga0075366_10002227 3300006195 Bacteria 9899
68 Ga0075366_10007166 3300006195 Bacteria 6141
69 Ga0075366_10157019 3300006195 Bacteria 1378
70 Ga0097621_100000003 3300006237 Bacteria 164830
71 Ga0075370_10002897 3300006353 Bacteria 8052
72 Ga0075370_10192930 3300006353 Bacteria 1201
73 Ga0068871_100000013 3300006358 Bacteria 102533
74 Ga0075428_100002637 3300006844 Bacteria 19511
75 Ga0105240_10000099 3300009093 Bacteria 177984
76 Ga0105240_10000789 3300009093 Bacteria 57388
77 Ga0105240_10006053 3300009093 Bacteria 17870
78 Ga0105240_10041368 3300009093 Bacteria 5882
79 Ga0105240_10280704 3300009093 Bacteria 1913
80 Ga0105245_10004821 3300009098 Bacteria 11893
81 Ga0105245_10058511 3300009098 Bacteria 3469
82 Ga0105245_10097872 3300009098 Bacteria 2710
83 Ga0105241_10211172 3300009174 Bacteria 1626
84 Ga0105241_10238520 3300009174 Bacteria 1536
85 Ga0105248_10081293 3300009177 Bacteria 3642
86 Ga0105248_10125134 3300009177 Bacteria 2900
87 Ga0105248_10137424 3300009177 Bacteria 2757
88 Ga0105237_10000002 3300009545 Bacteria 702357
89 Ga0105237_10098952 3300009545 Bacteria 2908
90 Ga0105238_10000463 3300009551 Bacteria 42690
91 Ga0105249_10650179 3300009553 Bacteria 1112
92 Ga0105032_100001 3300009979 Bacteria 472394
93 Ga0105029_103435 3300009984 Bacteria 1059
94 Ga0105028_114182 3300009993 Bacteria 846
95 Ga0105239_10000261 3300010375 Bacteria 78396
96 Ga0105239_10030706 3300010375 Bacteria 5910
97 Ga0105239_10082083 3300010375 Bacteria 3549
98 Ga0105246_10026407 3300011119 Bacteria 3793
99 Ga0157373_10045816 3300013100 Bacteria 3121
100 Ga0157371_10014329 3300013102 Bacteria 5987
101 Ga0157371_10016956 3300013102 Bacteria 5424
102 Ga0157371_10106092 3300013102 Bacteria 1994
103 Ga0157374_10005678 3300013296 Bacteria 10519
104 Ga0157372_10000008 3300013307 Bacteria 305449
105 Ga0157372_10014740 3300013307 Bacteria 8367
106 Ga0157372_10064805 3300013307 Bacteria 4100
107 Ga0157372_10083034 3300013307 Bacteria 3629
108 Ga0157372_10603391 3300013307 Unclassified 1279
109 Ga0157375_10379132 3300013308 Bacteria 1581
110 Ga0163163_10026685 3300014325 Bacteria 5525
111 Ga0163163_10040682 3300014325 Bacteria 4540
112 Ga0157377_10006077 3300014745 Bacteria 5729
113 Ga0157379_10807415 3300014968 Bacteria 886
114 Ga0206354_10409707 3300020081 Bacteria 906
115 Ga0154015_1647357 3300020610 Bacteria 2333
116 Ga0207697_10112750 3300025315 Bacteria 1165
117 Ga0207688_10026962 3300025901 Bacteria 3160
118 Ga0207647_10000670 3300025904 Bacteria 26786
119 Ga0207705_10000011 3300025909 Bacteria 517768
120 Ga0207705_10000051 3300025909 Bacteria 169369
121 Ga0207705_10000805 3300025909 Bacteria 25778
122 Ga0207654_10062122 3300025911 Bacteria 2187
123 Ga0207654_10181016 3300025911 Bacteria 1375
124 Ga0207695_10000980 3300025913 Bacteria 50757
125 Ga0207695_10002053 3300025913 Bacteria 30792
126 Ga0207695_10005007 3300025913 Bacteria 17795
127 Ga0207695_10167710 3300025913 Bacteria 2123
128 Ga0207695_10621433 3300025913 Unclassified 961
129 Ga0207671_10000008 3300025914 Bacteria 798229
130 Ga0207657_10002122 3300025919 Bacteria 21466
131 Ga0207657_10006928 3300025919 Bacteria 11684
132 Ga0207652_10298533 3300025921 Bacteria 1454
133 Ga0207652_11077551 3300025921 Unclassified 704
134 Ga0207694_10001212 3300025924 Bacteria 22387
135 Ga0207687_10032456 3300025927 Bacteria 3536
136 Ga0207664_10003229 3300025929 Bacteria 10836
137 Ga0207644_10018410 3300025931 Bacteria 4725
138 Ga0207690_10037930 3300025932 Bacteria 3132
139 Ga0207706_10000543 3300025933 Bacteria 40146
140 Ga0207711_10111283 3300025941 Bacteria 2436
141 Ga0207661_10020254 3300025944 Bacteria 4967
142 Ga0207679_10001254 3300025945 Bacteria 16096
143 Ga0207667_10000005 3300025949 Bacteria 715503
144 Ga0207667_10000042 3300025949 Bacteria 263461
145 Ga0207658_10149931 3300025986 Bacteria 1898
146 Ga0207703_10083378 3300026035 Bacteria 2671
147 Ga0207702_10000015 3300026078 Bacteria 250830
148 Ga0207702_11372335 3300026078 Bacteria 701
149 Ga0207641_10394019 3300026088 Unclassified 1328
150 Ga0207674_10001283 3300026116 Bacteria 32760
151 Ga0207674_10006337 3300026116 Bacteria 13931
152 Ga0207674_11270348 3300026116 Unclassified 706
153 Ga0207683_10124859 3300026121 Bacteria 2313
154 Ga0207698_10000001 3300026142 Bacteria 625389
155 Ga0207698_10000100 3300026142 Bacteria 54808
156 Ga0207698_10104850 3300026142 Bacteria 2354
157 Ga0209974_10003244 3300027876 Bacteria 5880
158 Ga0265337_1000393 3300028556 Bacteria 23484
159 Ga0265337_1001212 3300028556 Bacteria 13111
160 Ga0265326_10001574 3300028558 Bacteria 7973
161 Ga0265326_10025778 3300028558 Bacteria 1676
162 Ga0265326_10102610 3300028558 Unclassified 811
163 Ga0265322_10003222 3300028654 Bacteria 4953
164 Ga0265336_10001312 3300028666 Bacteria 11608
165 Ga0265336_10014347 3300028666 Bacteria 2627
166 Ga0265338_10000366 3300028800 Bacteria 81024
167 Ga0265338_10005862 3300028800 Bacteria 15847
168 Ga0265338_10006100 3300028800 Bacteria 15472
169 Ga0265338_10009458 3300028800 Bacteria 11616
170 Ga0265338_10028695 3300028800 Bacteria 5543
171 Ga0265338_10077670 3300028800 Bacteria 2806
172 Ga0265324_10075144 3300029957 Bacteria 1150
173 Ga0314311_1192020 3300030733 Bacteria 2799
174 Ga0314311_1247552 3300030733 Bacteria 817
175 Ga0316179_1092254 3300030734 Bacteria 2026
176 Ga0316182_1174300 3300030745 Bacteria 8921
177 Ga0265330_10014985 3300031235 Bacteria 3589
178 Ga0265320_10006089 3300031240 Bacteria 7652
179 Ga0265320_10023257 3300031240 Bacteria 3301
180 Ga0265325_10049734 3300031241 Bacteria 2161
181 Ga0265329_10008397 3300031242 Bacteria 3918
182 Ga0265340_10171292 3300031247 Bacteria 983
183 Ga0265331_10030101 3300031250 Bacteria 2705
184 Ga0265327_10000017 3300031251 Bacteria 445264
185 Ga0265327_10003953 3300031251 Bacteria 13546
186 Ga0265327_10051807 3300031251 Bacteria 2140
187 Ga0265316_10082558 3300031344 Bacteria 2462
188 Ga0307509_10022978 3300031507 Bacteria 7011
189 Ga0265313_10046207 3300031595 Bacteria 2115
190 Ga0265314_10198631 3300031711 Bacteria 1187
191 Ga0265342_10253422 3300031712 Bacteria 938
192 Ga0307516_10000021 3300031730 Bacteria 192678
193 Ga0307516_10007665 3300031730 Bacteria 12354
194 Ga0307405_10552332 3300031731 Bacteria 932
195 Ga0307406_10000001 3300031901 Bacteria 638191
196 Ga0307406_10001464 3300031901 Bacteria 13054
197 Ga0316593_10000418 3300032168 Bacteria 7700
198 Ga0316593_10094715 3300032168 Bacteria 1054
199 Ga0395899_0007520 3300037312 Bacteria 8420
200 Ga0395899_0028089 3300037312 Bacteria 4238
201 Ga0395900_0000001 3300037418 Bacteria 931146
202 Ga0395900_0007425 3300037418 Bacteria 11327
203 Ga0395900_0012262 3300037418 Bacteria 8765
204 Ga0395900_0028633 3300037418 Bacteria 5710
205 Ga0395900_0047517 3300037418 Bacteria 4419
206 Ga0395900_0337994 3300037418 Bacteria 1482
207 Ga0395898_0000002 3300037466 Bacteria 931013
208 Ga0395898_0002536 3300037466 Bacteria 21416
209 Ga0395898_0019794 3300037466 Bacteria 6844
210 Ga0395898_0023323 3300037466 Bacteria 6255
211 Ga0395905_0008237 3300037471 Bacteria 10294
212 Ga0395905_0830521 3300037471 Bacteria 827
213 Ga0395901_0000060 3300038443 Bacteria 152235
214 Ga0395901_0021849 3300038443 Bacteria 6557
215 Ga0395901_0774811 3300038443 Bacteria 950
216 Ga0439461_0002061 3300041410 Bacteria 3182
217 Ga0451791_1481266 3300041451 Bacteria 641
218 Ga0439437_005689 3300042000 Bacteria 1374
219 Ga0439463_013422 3300042016 Bacteria 2015
220 Ga0439463_044428 3300042016 Bacteria 1131
221 Ga0450910_011948 3300042147 Bacteria 1251
222 Ga0439446_0025878 3300042156 Bacteria 1678
223 Ga0439459_0098297 3300042438 Bacteria 713
224 Ga0439464_0000015 3300042439 Bacteria 23381
225 Ga0439464_0010888 3300042439 Bacteria 2404
226 Ga0466963_0083237 3300044694 Bacteria 2170
227 Ga0453684_0184817 3300044712 Bacteria 2444
228 Ga0466970_0080419 3300044765 Bacteria 1761
229 Ga0451576_0057342 3300045051 Bacteria 4072
230 Ga0495638_0000070 3300046460 Bacteria 166954
231 Ga0495609_0242265 3300046538 Bacteria 744
232 Ga0495660_0025091 3300046810 Bacteria 3387
233 Ga0495672_0045226 3300047320 Bacteria 2636
234 Ga0495672_0234728 3300047320 Bacteria 898
235 Ga0496100_0017467 3300048903 Bacteria 4235
236 Ga0496101_0259683 3300048904 Bacteria 1355
237 Ga0496113_0255648 3300048916 Bacteria 1399
238 Ga0501034_0095158 3300049571 Bacteria 2975
239 Ga0501037_0065519 3300049573 Bacteria 2647
240 Ga0501038_0985983 3300049574 Bacteria 619
241 Ga0501047_0000229 3300049581 Bacteria 66412
242 Ga0501073_0086672 3300049589 Bacteria 2178
243 Ga0501080_0001402 3300049742 Bacteria 20194
244 Ga0501035_0000033 3300049822 Bacteria 175087
245 nmdc:mga03683_23826_c1 3300050489 Unclassified 1475
246 nmdc:mga03n38_19_c1 3300050490 Bacteria 41192
247 nmdc:mga03n38_29122_c1 3300050490 Bacteria 2308
248 nmdc:mga03n38_44353_c1 3300050490 Bacteria 1953
249 nmdc:mga00v17_105154_c1 3300050491 Bacteria 1786
250 nmdc:mga00v17_1085_c1 3300050491 Bacteria 14334
251 nmdc:mga00v17_130291_c1 3300050491 Bacteria 1607
252 nmdc:mga00v17_21407_c1 3300050491 Bacteria 3717
253 nmdc:mga0yw44_1645_c1 3300050492 Bacteria 8998
254 nmdc:mga0yw44_164612_c1 3300050492 Bacteria 1453
255 nmdc:mga0yw44_182956_c1 3300050492 Bacteria 1380
256 nmdc:mga0yw44_184_c1 3300050492 Bacteria 21563
257 nmdc:mga0yw44_710131_c1 3300050492 Bacteria 683
258 nmdc:mga0yw44_7289_c1 3300050492 Bacteria 5427
259 nmdc:mga0k408_152150_c1 3300050493 Bacteria 1378
260 nmdc:mga0k408_2531_c1 3300050493 Bacteria 9718
261 nmdc:mga0k408_3588_c1 3300050493 Bacteria 7866
262 nmdc:mga06z11_14_c1 3300050494 Bacteria 96662
263 nmdc:mga06z11_306_c1 3300050494 Bacteria 18617
264 nmdc:mga06z11_724795_c1 3300050494 Bacteria 606
265 nmdc:mga04h51_10_c1 3300050495 Bacteria 102434
266 nmdc:mga07m45_172045_c1 3300050496 Bacteria 1259
267 nmdc:mga07m45_18647_c1 3300050496 Bacteria 3751
268 nmdc:mga07m45_259727_c1 3300050496 Bacteria 1011
269 nmdc:mga0sz30_502_c1 3300050516 Bacteria 11988
270 nmdc:mga0sz30_8841_c1 3300050516 Bacteria 3817
271 Ga0500610_0000001 3300053079 Bacteria 185468
272 Ga0500643_000011 3300053087 Bacteria 385630
273 Ga0500643_004330 3300053087 Bacteria 6473
274 Ga0500643_053770 3300053087 Bacteria 1145
275 Ga0500644_0000365 3300053088 Bacteria 22175
276 Ga0500644_0006209 3300053088 Bacteria 3051
277 Ga0500646_0021137 3300053090 Bacteria 1732
278 Ga0500646_0040356 3300053090 Bacteria 1312
279 Ga0500583_0032370 3300053092 Bacteria 2306
280 Ga0500651_0000203 3300053093 Bacteria 37688
281 Ga0500555_000002 3300053103 Bacteria 1314346
282 Ga0500556_0000829 3300053104 Bacteria 17806
283 Ga0500562_000001 3300053108 Bacteria 1178987
284 Ga0500562_024707 3300053108 Bacteria 1571
285 Ga0500593_000001 3300053117 Bacteria 784404
286 Ga0500593_046489 3300053117 Bacteria 1934
287 Ga0500594_0000139 3300053118 Bacteria 20048
288 Ga0500628_000006 3300053129 Bacteria 154858
289 Ga0500652_000084 3300053131 Bacteria 39562
290 Ga0500652_149987 3300053131 Bacteria 968
291 Ga0500655_000643 3300053133 Bacteria 7006
292 Ga0500655_001125 3300053133 Bacteria 5106
293 Ga0500616_0000005 3300053153 Bacteria 961725
294 Ga0500616_0000012 3300053153 Bacteria 681798

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006186 Ga0075369_10122036 Ga0075369_101220361 163
2 3300041451 Ga0451791_1481266 Ga0451791_1481266_33_617 164
3 3300049574 Ga0501038_0985983 Ga0501038_0985983_20_541 164
4 3300050491 nmdc:mga00v17_130291_c1 nmdc:mga00v17_130291_c1_399_983 165
5 3300050492 nmdc:mga0yw44_182956_c1 nmdc:mga0yw44_182956_c1_269_853 165
6 3300006353 Ga0075370_10192930 Ga0075370_101929302 166
7 3300050496 nmdc:mga07m45_172045_c1 nmdc:mga07m45_172045_c1_244_858 166
8 3300053153 Ga0500616_0000012 Ga0500616_0000012_516242_516856 166
9 3300009979 Ga0105032_100001 Ga0105032_100001152 167
10 3300032168 Ga0316593_10000418 Ga0316593_1000041815 169
11 3300050494 nmdc:mga06z11_724795_c1 nmdc:mga06z11_724795_c1_61_573 170
12 3300032168 Ga0316593_10094715 Ga0316593_100947152 173
13 3300031730 Ga0307516_10000021 Ga0307516_1000002117 174
14 3300001989 JGI24739J22299_10038219 JGI24739J22299_100382192 175
15 3300006038 Ga0075365_10151605 Ga0075365_101516052 175
16 3300006051 Ga0075364_10106585 Ga0075364_101065852 175
17 3300006195 Ga0075366_10007166 Ga0075366_100071662 175
18 3300050493 nmdc:mga0k408_3588_c1 nmdc:mga0k408_3588_c1_2366_2980 175
19 3300049589 Ga0501073_0086672 Ga0501073_0086672_872_1456 179
20 3300049742 Ga0501080_0001402 Ga0501080_0001402_1006_1590 179
21 3300009993 Ga0105028_114182 Ga0105028_1141821 181
22 3300037471 Ga0395905_0830521 Ga0395905_0830521_26_577 181
23 3300046538 Ga0495609_0242265 Ga0495609_0242265_167_730 181
24 3300053087 Ga0500643_000011 Ga0500643_000011_56870_57487 184
25 3300046460 Ga0495638_0000070 Ga0495638_0000070_96606_97217 185
26 3300009093 Ga0105240_10000099 Ga0105240_10000099167 186
27 3300009545 Ga0105237_10098952 Ga0105237_100989524 186
28 3300025913 Ga0207695_10000980 Ga0207695_1000098040 186
29 3300006844 Ga0075428_100002637 Ga0075428_1000026378 187
30 3300009984 Ga0105029_103435 Ga0105029_1034352 187
31 3300006038 Ga0075365_10052043 Ga0075365_100520432 188
32 3300006177 Ga0075362_10086185 Ga0075362_100861853 188
33 3300009093 Ga0105240_10280704 Ga0105240_102807042 188
34 3300050489 nmdc:mga03683_23826_c1 nmdc:mga03683_23826_c1_122_736 188
35 3300050492 nmdc:mga0yw44_7289_c1 nmdc:mga0yw44_7289_c1_3370_3981 188
36 3300003323 rootH1_10161764 rootH1_101617644 190
37 3300005530 Ga0070679_100220191 Ga0070679_1002201911 190
38 3300037418 Ga0395900_0007425 Ga0395900_0007425_4616_5194 190
39 3300037466 Ga0395898_0019794 Ga0395898_0019794_4502_5080 190
40 3300038443 Ga0395901_0774811 Ga0395901_0774811_159_737 190
41 3300005435 Ga0070714_100000778 Ga0070714_1000007782 191
42 3300005530 Ga0070679_100002994 Ga0070679_10000299417 191
43 3300005530 Ga0070679_101199679 Ga0070679_1011996791 191
44 3300010375 Ga0105239_10000261 Ga0105239_1000026162 191
45 3300025913 Ga0207695_10621433 Ga0207695_106214331 191
46 3300025921 Ga0207652_11077551 Ga0207652_110775511 191
47 3300030733 Ga0314311_1192020 Ga0314311_11920202 191
48 3300050490 nmdc:mga03n38_19_c1 nmdc:mga03n38_19_c1_1873_2460 191
49 3300050494 nmdc:mga06z11_14_c1 nmdc:mga06z11_14_c1_38823_39410 191
50 3300050495 nmdc:mga04h51_10_c1 nmdc:mga04h51_10_c1_27888_28475 191
51 3300050496 nmdc:mga07m45_18647_c1 nmdc:mga07m45_18647_c1_243_830 191
52 3300006038 Ga0075365_10062192 Ga0075365_100621924 192
53 3300006042 Ga0075368_10000022 Ga0075368_1000002251 192
54 3300006048 Ga0075363_100013867 Ga0075363_1000138671 192
55 3300006051 Ga0075364_10033950 Ga0075364_100339501 192
56 3300006178 Ga0075367_10007006 Ga0075367_100070067 192
57 3300006186 Ga0075369_10000098 Ga0075369_1000009837 192
58 3300030734 Ga0316179_1092254 Ga0316179_10922542 192
59 3300050490 nmdc:mga03n38_29122_c1 nmdc:mga03n38_29122_c1_1526_2140 192
60 3300050492 nmdc:mga0yw44_1645_c1 nmdc:mga0yw44_1645_c1_552_1166 192
61 3300050492 nmdc:mga0yw44_710131_c1 nmdc:mga0yw44_710131_c1_11_625 192
62 3300050494 nmdc:mga06z11_306_c1 nmdc:mga06z11_306_c1_6897_7511 192
63 3300050496 nmdc:mga07m45_259727_c1 nmdc:mga07m45_259727_c1_261_875 192
64 3300050516 nmdc:mga0sz30_502_c1 nmdc:mga0sz30_502_c1_4059_4673 192
65 3300053090 Ga0500646_0040356 Ga0500646_0040356_308_922 192
66 3300053092 Ga0500583_0032370 Ga0500583_0032370_90_704 192
67 3300053117 Ga0500593_046489 Ga0500593_046489_490_1104 192
68 3300053131 Ga0500652_149987 Ga0500652_149987_118_732 192
69 3300044712 Ga0453684_0184817 Ga0453684_0184817_21_605 193
70 3300003323 rootH1_10188805 rootH1_101888051 194
71 3300005563 Ga0068855_100000002 Ga0068855_100000002177 194
72 3300025913 Ga0207695_10167710 Ga0207695_101677102 194
73 3300025949 Ga0207667_10000005 Ga0207667_10000005287 194
74 3300030733 Ga0314311_1247552 Ga0314311_12475522 194
75 3300053093 Ga0500651_0000203 Ga0500651_0000203_32103_32717 194
76 3300005327 Ga0070658_10355114 Ga0070658_103551141 195
77 3300013102 Ga0157371_10106092 Ga0157371_101060922 195
78 3300030745 Ga0316182_1174300 Ga0316182_117430013 195
79 3300041410 Ga0439461_0002061 Ga0439461_0002061_240_854 195
80 3300042016 Ga0439463_044428 Ga0439463_044428_149_763 195
81 3300042147 Ga0450910_011948 Ga0450910_011948_42_656 195
82 3300042438 Ga0439459_0098297 Ga0439459_0098297_80_694 195
83 3300042439 Ga0439464_0010888 Ga0439464_0010888_1744_2358 195
84 3300003316 rootH1_10010401 rootH1_100104015 197
85 3300005355 Ga0070671_100011362 Ga0070671_10001136212 200
86 3300005841 Ga0068863_100378676 Ga0068863_1003786762 200
87 3300009177 Ga0105248_10125134 Ga0105248_101251344 200
88 3300014968 Ga0157379_10807415 Ga0157379_108074152 200
89 3300025931 Ga0207644_10018410 Ga0207644_100184103 200
90 3300025941 Ga0207711_10111283 Ga0207711_101112833 200
91 3300026088 Ga0207641_10394019 Ga0207641_103940192 200
92 3300028800 Ga0265338_10000366 Ga0265338_1000036623 200
93 3300028800 Ga0265338_10028695 Ga0265338_100286958 200
94 3300005336 Ga0070680_100389559 Ga0070680_1003895592 201
95 3300005367 Ga0070667_100004521 Ga0070667_10000452120 201
96 3300005937 Ga0081455_10000003 Ga0081455_10000003294 201
97 3300006048 Ga0075363_100070456 Ga0075363_1000704562 201
98 3300006195 Ga0075366_10157019 Ga0075366_101570192 201
99 3300009093 Ga0105240_10041368 Ga0105240_100413688 201
100 3300009177 Ga0105248_10081293 Ga0105248_100812934 201
101 3300009553 Ga0105249_10650179 Ga0105249_106501791 201
102 3300013307 Ga0157372_10603391 Ga0157372_106033912 201
103 3300014325 Ga0163163_10026685 Ga0163163_100266853 201
104 3300014325 Ga0163163_10040682 Ga0163163_100406828 201
105 3300025929 Ga0207664_10003229 Ga0207664_1000322919 201
106 3300025986 Ga0207658_10149931 Ga0207658_101499312 201
107 3300026116 Ga0207674_11270348 Ga0207674_112703481 201
108 3300026121 Ga0207683_10124859 Ga0207683_101248594 201
109 3300028556 Ga0265337_1000393 Ga0265337_100039312 201
110 3300028556 Ga0265337_1001212 Ga0265337_100121217 201
111 3300028558 Ga0265326_10001574 Ga0265326_100015746 201
112 3300028558 Ga0265326_10025778 Ga0265326_100257784 201
113 3300028654 Ga0265322_10003222 Ga0265322_100032222 201
114 3300028666 Ga0265336_10001312 Ga0265336_1000131211 201
115 3300028666 Ga0265336_10014347 Ga0265336_100143473 201
116 3300028800 Ga0265338_10005862 Ga0265338_1000586217 201
117 3300028800 Ga0265338_10006100 Ga0265338_1000610011 201
118 3300028800 Ga0265338_10009458 Ga0265338_1000945819 201
119 3300028800 Ga0265338_10077670 Ga0265338_100776702 201
120 3300029957 Ga0265324_10075144 Ga0265324_100751441 201
121 3300031235 Ga0265330_10014985 Ga0265330_100149853 201
122 3300031240 Ga0265320_10006089 Ga0265320_1000608915 201
123 3300031240 Ga0265320_10023257 Ga0265320_100232572 201
124 3300031241 Ga0265325_10049734 Ga0265325_100497342 201
125 3300031242 Ga0265329_10008397 Ga0265329_100083972 201
126 3300031247 Ga0265340_10171292 Ga0265340_101712922 201
127 3300031250 Ga0265331_10030101 Ga0265331_100301011 201
128 3300031251 Ga0265327_10000017 Ga0265327_10000017162 201
129 3300031251 Ga0265327_10051807 Ga0265327_100518072 201
130 3300031344 Ga0265316_10082558 Ga0265316_100825583 201
131 3300031595 Ga0265313_10046207 Ga0265313_100462071 201
132 3300031711 Ga0265314_10198631 Ga0265314_101986313 201
133 3300031712 Ga0265342_10253422 Ga0265342_102534221 201
134 3300037418 Ga0395900_0028633 Ga0395900_0028633_648_1259 201
135 3300037418 Ga0395900_0047517 Ga0395900_0047517_275_886 201
136 3300037466 Ga0395898_0023323 Ga0395898_0023323_1400_2011 201
137 3300050490 nmdc:mga03n38_44353_c1 nmdc:mga03n38_44353_c1_917_1534 201
138 3300050493 nmdc:mga0k408_152150_c1 nmdc:mga0k408_152150_c1_145_768 201
139 3300053079 Ga0500610_0000001 Ga0500610_0000001_57322_57945 201
140 3300053088 Ga0500644_0000365 Ga0500644_0000365_13239_13862 201
141 3300053088 Ga0500644_0006209 Ga0500644_0006209_1121_1744 201
142 3300053104 Ga0500556_0000829 Ga0500556_0000829_8733_9371 201
143 3300053118 Ga0500594_0000139 Ga0500594_0000139_12472_13095 201
144 3300053129 Ga0500628_000006 Ga0500628_000006_148496_149119 201
145 3300053153 Ga0500616_0000005 Ga0500616_0000005_391924_392562 201
146 3300005327 Ga0070658_10000015 Ga0070658_1000001537 202
147 3300005329 Ga0070683_100436133 Ga0070683_1004361331 202
148 3300005535 Ga0070684_101293301 Ga0070684_1012933011 202
149 3300005842 Ga0068858_100022783 Ga0068858_10002278312 202
150 3300009098 Ga0105245_10004821 Ga0105245_1000482118 202
151 3300009098 Ga0105245_10058511 Ga0105245_100585113 202
152 3300025909 Ga0207705_10000011 Ga0207705_10000011309 202
153 3300025927 Ga0207687_10032456 Ga0207687_100324565 202
154 3300026035 Ga0207703_10083378 Ga0207703_100833785 202
155 3300028558 Ga0265326_10102610 Ga0265326_101026101 202
156 3300031251 Ga0265327_10003953 Ga0265327_100039532 202
157 3300037418 Ga0395900_0012262 Ga0395900_0012262_5499_6113 202
158 3300037418 Ga0395900_0337994 Ga0395900_0337994_482_1102 202
159 3300037466 Ga0395898_0002536 Ga0395898_0002536_5219_5833 202
160 3300037471 Ga0395905_0008237 Ga0395905_0008237_2553_3167 202
161 3300038443 Ga0395901_0021849 Ga0395901_0021849_798_1412 202
162 3300049571 Ga0501034_0095158 Ga0501034_0095158_1211_1825 202
163 3300049573 Ga0501037_0065519 Ga0501037_0065519_1117_1731 202
164 3300049581 Ga0501047_0000229 Ga0501047_0000229_59592_60206 202
165 3300049822 Ga0501035_0000033 Ga0501035_0000033_157636_158250 202
166 3300053087 Ga0500643_004330 Ga0500643_004330_467_1093 202
167 3300053103 Ga0500555_000002 Ga0500555_000002_472633_473259 202
168 3300053108 Ga0500562_024707 Ga0500562_024707_174_800 202
169 3300053131 Ga0500652_000084 Ga0500652_000084_19260_19886 202
170 3300001979 JGI24740J21852_10014513 JGI24740J21852_100145132 203
171 3300001989 JGI24739J22299_10002659 JGI24739J22299_100026592 203
172 3300001990 JGI24737J22298_10001063 JGI24737J22298_100010636 203
173 3300002067 JGI24735J21928_10000051 JGI24735J21928_1000005112 203
174 3300002075 JGI24738J21930_10000517 JGI24738J21930_1000051718 203
175 3300003320 rootH2_10090274 rootH2_100902744 203
176 3300005327 Ga0070658_10000038 Ga0070658_10000038121 203
177 3300005327 Ga0070658_10000749 Ga0070658_100007499 203
178 3300005339 Ga0070660_100002817 Ga0070660_10000281724 203
179 3300005339 Ga0070660_100064422 Ga0070660_1000644222 203
180 3300005344 Ga0070661_100120902 Ga0070661_1001209021 203
181 3300005345 Ga0070692_10333193 Ga0070692_103331931 203
182 3300005366 Ga0070659_100052748 Ga0070659_1000527484 203
183 3300005457 Ga0070662_100001599 Ga0070662_1000015991 203
184 3300005458 Ga0070681_10041601 Ga0070681_100416019 203
185 3300005530 Ga0070679_100310303 Ga0070679_1003103032 203
186 3300005535 Ga0070684_100021107 Ga0070684_1000211076 203
187 3300005563 Ga0068855_100000011 Ga0068855_10000001194 203
188 3300005564 Ga0070664_100002342 Ga0070664_10000234213 203
189 3300005577 Ga0068857_100004496 Ga0068857_1000044964 203
190 3300005577 Ga0068857_100010860 Ga0068857_1000108602 203
191 3300005577 Ga0068857_100012235 Ga0068857_1000122355 203
192 3300005614 Ga0068856_100053648 Ga0068856_1000536484 203
193 3300005614 Ga0068856_101363901 Ga0068856_1013639012 203
194 3300005616 Ga0068852_100000001 Ga0068852_100000001565 203
195 3300005616 Ga0068852_100000135 Ga0068852_10000013538 203
196 3300005616 Ga0068852_100064341 Ga0068852_1000643414 203
197 3300005841 Ga0068863_100284704 Ga0068863_1002847042 203
198 3300005842 Ga0068858_100301287 Ga0068858_1003012873 203
199 3300006038 Ga0075365_10000214 Ga0075365_100002148 203
200 3300006038 Ga0075365_10233082 Ga0075365_102330822 203
201 3300006051 Ga0075364_10000164 Ga0075364_1000016414 203
202 3300006051 Ga0075364_10003548 Ga0075364_1000354812 203
203 3300006051 Ga0075364_10011764 Ga0075364_100117642 203
204 3300006186 Ga0075369_10002696 Ga0075369_100026964 203
205 3300006195 Ga0075366_10002227 Ga0075366_100022278 203
206 3300006237 Ga0097621_100000003 Ga0097621_10000000390 203
207 3300006353 Ga0075370_10002897 Ga0075370_100028979 203
208 3300006358 Ga0068871_100000013 Ga0068871_10000001388 203
209 3300009093 Ga0105240_10000789 Ga0105240_1000078917 203
210 3300009093 Ga0105240_10006053 Ga0105240_1000605330 203
211 3300009098 Ga0105245_10097872 Ga0105245_100978723 203
212 3300009174 Ga0105241_10211172 Ga0105241_102111722 203
213 3300009174 Ga0105241_10238520 Ga0105241_102385201 203
214 3300009177 Ga0105248_10137424 Ga0105248_101374242 203
215 3300009545 Ga0105237_10000002 Ga0105237_10000002457 203
216 3300009551 Ga0105238_10000463 Ga0105238_1000046315 203
217 3300010375 Ga0105239_10030706 Ga0105239_1003070612 203
218 3300010375 Ga0105239_10082083 Ga0105239_100820831 203
219 3300011119 Ga0105246_10026407 Ga0105246_100264074 203
220 3300013100 Ga0157373_10045816 Ga0157373_100458163 203
221 3300013102 Ga0157371_10014329 Ga0157371_100143298 203
222 3300013102 Ga0157371_10016956 Ga0157371_100169566 203
223 3300013296 Ga0157374_10005678 Ga0157374_100056787 203
224 3300013307 Ga0157372_10000008 Ga0157372_1000000820 203
225 3300013307 Ga0157372_10014740 Ga0157372_1001474019 203
226 3300013307 Ga0157372_10064805 Ga0157372_100648055 203
227 3300013307 Ga0157372_10083034 Ga0157372_100830344 203
228 3300013308 Ga0157375_10379132 Ga0157375_103791322 203
229 3300014745 Ga0157377_10006077 Ga0157377_100060772 203
230 3300020081 Ga0206354_10409707 Ga0206354_104097071 203
231 3300020610 Ga0154015_1647357 Ga0154015_16473571 203
232 3300025315 Ga0207697_10112750 Ga0207697_101127501 203
233 3300025901 Ga0207688_10026962 Ga0207688_100269624 203
234 3300025904 Ga0207647_10000670 Ga0207647_1000067014 203
235 3300025909 Ga0207705_10000051 Ga0207705_1000005169 203
236 3300025909 Ga0207705_10000805 Ga0207705_1000080525 203
237 3300025911 Ga0207654_10062122 Ga0207654_100621222 203
238 3300025911 Ga0207654_10181016 Ga0207654_101810162 203
239 3300025913 Ga0207695_10002053 Ga0207695_1000205317 203
240 3300025913 Ga0207695_10005007 Ga0207695_1000500730 203
241 3300025914 Ga0207671_10000008 Ga0207671_10000008562 203
242 3300025919 Ga0207657_10002122 Ga0207657_1000212213 203
243 3300025919 Ga0207657_10006928 Ga0207657_100069285 203
244 3300025921 Ga0207652_10298533 Ga0207652_102985332 203
245 3300025924 Ga0207694_10001212 Ga0207694_1000121216 203
246 3300025932 Ga0207690_10037930 Ga0207690_100379304 203
247 3300025933 Ga0207706_10000543 Ga0207706_1000054313 203
248 3300025944 Ga0207661_10020254 Ga0207661_100202545 203
249 3300025945 Ga0207679_10001254 Ga0207679_1000125413 203
250 3300025949 Ga0207667_10000042 Ga0207667_10000042196 203
251 3300026078 Ga0207702_10000015 Ga0207702_10000015273 203
252 3300026078 Ga0207702_11372335 Ga0207702_113723351 203
253 3300026116 Ga0207674_10001283 Ga0207674_1000128324 203
254 3300026116 Ga0207674_10006337 Ga0207674_100063372 203
255 3300026142 Ga0207698_10000001 Ga0207698_10000001515 203
256 3300026142 Ga0207698_10000100 Ga0207698_1000010028 203
257 3300026142 Ga0207698_10104850 Ga0207698_101048503 203
258 3300027876 Ga0209974_10003244 Ga0209974_100032443 203
259 3300031507 Ga0307509_10022978 Ga0307509_100229783 203
260 3300031730 Ga0307516_10007665 Ga0307516_1000766512 203
261 3300031731 Ga0307405_10552332 Ga0307405_105523322 203
262 3300031901 Ga0307406_10000001 Ga0307406_10000001111 203
263 3300031901 Ga0307406_10001464 Ga0307406_100014646 203
264 3300037312 Ga0395899_0007520 Ga0395899_0007520_2891_3502 203
265 3300037312 Ga0395899_0028089 Ga0395899_0028089_1885_2499 203
266 3300037418 Ga0395900_0000001 Ga0395900_0000001_99057_99668 203
267 3300037466 Ga0395898_0000002 Ga0395898_0000002_75452_76063 203
268 3300038443 Ga0395901_0000060 Ga0395901_0000060_138029_138640 203
269 3300042000 Ga0439437_005689 Ga0439437_005689_140_751 203
270 3300042016 Ga0439463_013422 Ga0439463_013422_683_1294 203
271 3300042156 Ga0439446_0025878 Ga0439446_0025878_1018_1653 203
272 3300042439 Ga0439464_0000015 Ga0439464_0000015_2511_3122 203
273 3300044694 Ga0466963_0083237 Ga0466963_0083237_1470_2084 203
274 3300044765 Ga0466970_0080419 Ga0466970_0080419_503_1126 203
275 3300045051 Ga0451576_0057342 Ga0451576_0057342_378_992 203
276 3300046810 Ga0495660_0025091 Ga0495660_0025091_113_778 203
277 3300047320 Ga0495672_0045226 Ga0495672_0045226_1255_1869 203
278 3300047320 Ga0495672_0234728 Ga0495672_0234728_270_884 203
279 3300048903 Ga0496100_0017467 Ga0496100_0017467_2903_3526 203
280 3300048904 Ga0496101_0259683 Ga0496101_0259683_364_978 203
281 3300048916 Ga0496113_0255648 Ga0496113_0255648_390_1001 203
282 3300050491 nmdc:mga00v17_105154_c1 nmdc:mga00v17_105154_c1_924_1535 203
283 3300050491 nmdc:mga00v17_1085_c1 nmdc:mga00v17_1085_c1_3565_4203 203
284 3300050491 nmdc:mga00v17_21407_c1 nmdc:mga00v17_21407_c1_2661_3326 203
285 3300050492 nmdc:mga0yw44_164612_c1 nmdc:mga0yw44_164612_c1_407_1021 203
286 3300050492 nmdc:mga0yw44_184_c1 nmdc:mga0yw44_184_c1_15213_15851 203
287 3300050493 nmdc:mga0k408_2531_c1 nmdc:mga0k408_2531_c1_5786_6397 203
288 3300050516 nmdc:mga0sz30_8841_c1 nmdc:mga0sz30_8841_c1_1249_1860 203
289 3300053087 Ga0500643_053770 Ga0500643_053770_258_887 203
290 3300053090 Ga0500646_0021137 Ga0500646_0021137_1067_1681 203
291 3300053108 Ga0500562_000001 Ga0500562_000001_302037_302702 203
292 3300053117 Ga0500593_000001 Ga0500593_000001_565718_566341 203
293 3300053133 Ga0500655_000643 Ga0500655_000643_3588_4253 203
294 3300053133 Ga0500655_001125 Ga0500655_001125_1131_1754 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00297

Ribosomal_L3

Ribosomal protein L3

97

199

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9277 1 203
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9208 1 203
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9168 1 203
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.9043 2 203
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9042 1 203
ID Description Score Start End Superfamily
af_Q9SKX4_88_148_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9258 34 89 3.30.160.810
af_P9WH87_35_101_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.902 34 91 3.30.160.810
af_Q9LIT4_106_169_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9018 34 93 3.30.160.810
af_Q2FW06_34_105_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8931 34 91 3.30.160.810
af_P60438_33_95_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8899 34 91 3.30.160.810
ID Description Score Start End GO Terms
AF-X1RPG5-F1-model_v4 50S ribosomal protein L3 0.9093 4 115 GO:0003735
GO:0006412
GO:0022625
AF-A0A7C6X7N2-F1-model_v4 50S ribosomal protein L3 0.7974 4 133 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A3B8XIH3-F1-model_v4 deleted 0.7804 1 144
AF-A0A3B8XIH3-F1-model_v4 deleted 0.7751 1 144
AF-A0A2H0XZV5-F1-model_v4 Large ribosomal subunit protein uL3 0.7728 1 200 GO:0003735
GO:0006412
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
80.46 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map