F391976

General Info

Members Datasets Scaffolds Average Seq Length
294 174 294 103

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100052425|Ga0068856_1000524251
Length 104
Sequence MSKNKISGGVVHTMPTDLKKILIADKVALAKWENSTPLARNEWICWIESVKTPEKRKEHIKRTASELSELKEGMRRPCCWIGCIHRKDKPLSPSQKFILHKRTS

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
101 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
104 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
105 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
106 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
109 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
122 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
123 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
124 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
174 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 0
Rhizoplane 0
Rhizosphere 94.22
Stem 0
Stem Tuber 0
Unclassified 4.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000115 3300002067 Bacteria 29387
2 JGI25165J46597_1000013 3300003214 Bacteria 402100
3 rootH1_10090752 3300003323 Archaea 2510
4 rootH1_10246200 3300003323 Bacteria 3424
5 Ga0065707_10773418 3300005295 Unclassified 564
6 Ga0070658_11593357 3300005327 Bacteria 566
7 Ga0070683_100000544 3300005329 Bacteria 26670
8 Ga0070690_100142685 3300005330 Unclassified 1627
9 Ga0070670_100365984 3300005331 Bacteria 1268
10 Ga0070670_101718335 3300005331 Unclassified 577
11 Ga0068869_100000137 3300005334 Bacteria 35570
12 Ga0070680_100131605 3300005336 Bacteria 2093
13 Ga0070680_100720567 3300005336 Bacteria 858
14 Ga0070689_100189241 3300005340 Unclassified 1675
15 Ga0070671_100512828 3300005355 Bacteria 1032
16 Ga0070673_102273239 3300005364 Viruses 515
17 Ga0070709_10186956 3300005434 Unclassified 1459
18 Ga0070709_11004272 3300005434 Unclassified 664
19 Ga0070713_100426903 3300005436 Bacteria 1242
20 Ga0070713_100663220 3300005436 Unclassified 994
21 Ga0070711_100072796 3300005439 Bacteria 2425
22 Ga0070705_100939997 3300005440 Unclassified 698
23 Ga0070700_100724694 3300005441 Unclassified 793
24 Ga0070708_100000451 3300005445 Bacteria 30807
25 Ga0070708_100032367 3300005445 Unclassified 4535
26 Ga0070708_100292812 3300005445 Unclassified 1533
27 Ga0070708_102073507 3300005445 Unclassified 526
28 Ga0070663_101645088 3300005455 Bacteria 573
29 Ga0070681_10006464 3300005458 Bacteria 11408
30 Ga0070681_10375086 3300005458 Bacteria 1333
31 Ga0070681_10402341 3300005458 Bacteria 1280
32 Ga0070706_100000132 3300005467 Bacteria 92406
33 Ga0070706_100002210 3300005467 Bacteria 19798
34 Ga0070706_100733852 3300005467 Unclassified 915
35 Ga0070706_100996848 3300005467 Bacteria 772
36 Ga0070707_100126476 3300005468 Bacteria 2484
37 Ga0070707_100253945 3300005468 Unclassified 1711
38 Ga0070707_100803718 3300005468 Bacteria 904
39 Ga0070707_102078722 3300005468 Bacteria 535
40 Ga0070698_100766141 3300005471 Bacteria 908
41 Ga0070698_100909820 3300005471 Unclassified 825
42 Ga0070699_100050543 3300005518 Bacteria 3599
43 Ga0070699_100868653 3300005518 Bacteria 826
44 Ga0070679_101769673 3300005530 Bacteria 566
45 Ga0070684_100548858 3300005535 Bacteria 1072
46 Ga0070697_100048653 3300005536 Bacteria 3438
47 Ga0070697_100165908 3300005536 Unclassified 1867
48 Ga0070697_100792178 3300005536 Unclassified 838
49 Ga0070697_101981999 3300005536 Unclassified 521
50 Ga0070686_100088264 3300005544 Bacteria 2069
51 Ga0070686_100105450 3300005544 Bacteria 1911
52 Ga0070686_100197849 3300005544 Bacteria 1439
53 Ga0070695_100111032 3300005545 Bacteria 1860
54 Ga0070665_100229905 3300005548 Bacteria 1854
55 Ga0070665_100485015 3300005548 Unclassified 1247
56 Ga0070665_101618664 3300005548 Unclassified 655
57 Ga0070704_101381730 3300005549 Unclassified 646
58 Ga0068855_100085381 3300005563 Bacteria 3652
59 Ga0068855_100347548 3300005563 Bacteria 1634
60 Ga0068855_101259879 3300005563 Unclassified 767
61 Ga0068855_101862158 3300005563 Unclassified 610
62 Ga0070664_100193309 3300005564 Bacteria 1813
63 Ga0068856_100052425 3300005614 Bacteria 4023
64 Ga0068856_100777450 3300005614 Bacteria 977
65 Ga0068859_102341890 3300005617 Unclassified 589
66 Ga0068863_102018988 3300005841 Unclassified 587
67 Ga0068860_100233096 3300005843 Bacteria 1789
68 Ga0068862_100010808 3300005844 Bacteria 7539
69 Ga0070717_10000882 3300006028 Bacteria 19841
70 Ga0070717_10124204 3300006028 Bacteria 2214
71 Ga0070716_100676292 3300006173 Unclassified 786
72 Ga0070712_101173411 3300006175 Unclassified 668
73 Ga0068871_101719425 3300006358 Unclassified 595
74 Ga0075428_101326463 3300006844 Bacteria 756
75 Ga0075429_100450659 3300006880 Bacteria 1127
76 Ga0075436_100013421 3300006914 Bacteria 5609
77 Ga0097620_102341619 3300006931 Unclassified 589
78 Ga0075435_101225895 3300007076 Unclassified 656
79 Ga0099795_10188346 3300007788 Unclassified 865
80 Ga0105240_10024231 3300009093 Bacteria 8007
81 Ga0105240_10111451 3300009093 Bacteria 3310
82 Ga0105240_10144670 3300009093 Bacteria 2838
83 Ga0105240_10248592 3300009093 Bacteria 2058
84 Ga0105240_10493250 3300009093 Bacteria 1363
85 Ga0105240_10708966 3300009093 Bacteria 1098
86 Ga0105240_11254875 3300009093 Bacteria 783
87 Ga0105245_12824824 3300009098 Bacteria 538
88 Ga0114129_10133098 3300009147 Bacteria 3414
89 Ga0105243_10344009 3300009148 Bacteria 1367
90 Ga0105241_10205149 3300009174 Bacteria 1649
91 Ga0105241_10360351 3300009174 Bacteria 1265
92 Ga0105241_11267263 3300009174 Unclassified 701
93 Ga0105241_11896343 3300009174 Bacteria 584
94 Ga0105242_12551086 3300009176 Bacteria 560
95 Ga0105237_10755789 3300009545 Bacteria 979
96 Ga0105238_10009271 3300009551 Bacteria 9849
97 Ga0105238_10845252 3300009551 Bacteria 932
98 Ga0105238_11301999 3300009551 Bacteria 753
99 Ga0105249_10278094 3300009553 Bacteria 1670
100 Ga0105239_10011818 3300010375 Bacteria 9744
101 Ga0105239_10841255 3300010375 Unclassified 1052
102 Ga0105239_12068978 3300010375 Bacteria 661
103 Ga0105239_12290054 3300010375 Bacteria 629
104 Ga0105246_10180928 3300011119 Bacteria 1623
105 Ga0157373_10066770 3300013100 Bacteria 2543
106 Ga0157369_10105224 3300013105 Unclassified 3004
107 Ga0157374_10013652 3300013296 Bacteria 7095
108 Ga0157378_12457291 3300013297 Unclassified 573
109 Ga0157378_12743928 3300013297 Unclassified 545
110 Ga0157372_11117806 3300013307 Bacteria 911
111 Ga0157372_12454957 3300013307 Bacteria 598
112 Ga0157372_12907464 3300013307 Bacteria 548
113 Ga0163163_10006016 3300014325 Bacteria 10556
114 Ga0163163_10139599 3300014325 Unclassified 2465
115 Ga0163163_11576582 3300014325 Bacteria 718
116 Ga0163163_12699511 3300014325 Bacteria 554
117 Ga0157377_10575939 3300014745 Unclassified 799
118 Ga0157376_10890921 3300014969 Bacteria 907
119 Ga0213876_10007202 3300021384 Bacteria 6064
120 Ga0213875_10545217 3300021388 Unclassified 559
121 Ga0209233_1000013 3300025261 Bacteria 1013785
122 Ga0209233_1004477 3300025261 Bacteria 4743
123 Ga0207692_10206498 3300025898 Unclassified 1158
124 Ga0207647_10000004 3300025904 Bacteria 307217
125 Ga0207705_11240982 3300025909 Bacteria 571
126 Ga0207684_10000244 3300025910 Bacteria 81549
127 Ga0207684_10000643 3300025910 Bacteria 41347
128 Ga0207684_10252192 3300025910 Bacteria 1522
129 Ga0207684_11041042 3300025910 Unclassified 683
130 Ga0207707_10209553 3300025912 Unclassified 1698
131 Ga0207707_10869004 3300025912 Bacteria 747
132 Ga0207707_11533203 3300025912 Unclassified 527
133 Ga0207695_10019297 3300025913 Bacteria 7852
134 Ga0207695_10083665 3300025913 Bacteria 3223
135 Ga0207695_10253928 3300025913 Bacteria 1657
136 Ga0207695_10379493 3300025913 Bacteria 1299
137 Ga0207695_11346649 3300025913 Unclassified 594
138 Ga0207671_10439258 3300025914 Bacteria 1039
139 Ga0207671_10471464 3300025914 Bacteria 1000
140 Ga0207671_11461032 3300025914 Unclassified 529
141 Ga0207693_10133481 3300025915 Unclassified 1951
142 Ga0207660_10022662 3300025917 Bacteria 4233
143 Ga0207652_10050300 3300025921 Bacteria 3570
144 Ga0207652_11383880 3300025921 Bacteria 607
145 Ga0207646_10021254 3300025922 Bacteria 5998
146 Ga0207646_10730326 3300025922 Unclassified 884
147 Ga0207694_10022291 3300025924 Bacteria 4804
148 Ga0207650_10537473 3300025925 Unclassified 979
149 Ga0207650_10782256 3300025925 Bacteria 808
150 Ga0207670_10403002 3300025936 Bacteria 1094
151 Ga0207665_10153270 3300025939 Bacteria 1652
152 Ga0207689_10015621 3300025942 Bacteria 6430
153 Ga0207661_10000163 3300025944 Bacteria 43092
154 Ga0207667_10000975 3300025949 Bacteria 36500
155 Ga0207667_10133026 3300025949 Bacteria 2562
156 Ga0207667_11109775 3300025949 Unclassified 774
157 Ga0207667_11297870 3300025949 Unclassified 704
158 Ga0207667_11456134 3300025949 Unclassified 657
159 Ga0207651_11624730 3300025960 Unclassified 582
160 Ga0207712_10815146 3300025961 Bacteria 821
161 Ga0207712_10824633 3300025961 Bacteria 816
162 Ga0207658_11105534 3300025986 Bacteria 724
163 Ga0207658_11571625 3300025986 Bacteria 601
164 Ga0207677_10991446 3300026023 Unclassified 761
165 Ga0207703_10055429 3300026035 Bacteria 3225
166 Ga0207639_10251155 3300026041 Bacteria 1542
167 Ga0207639_11085456 3300026041 Unclassified 750
168 Ga0207639_12200933 3300026041 Bacteria 513
169 Ga0207674_11123494 3300026116 Unclassified 755
170 Ga0209966_1000307 3300027695 Bacteria 16038
171 Ga0268266_10027347 3300028379 Bacteria 4850
172 Ga0268266_10257054 3300028379 Bacteria 1617
173 Ga0268266_10561355 3300028379 Bacteria 1094
174 Ga0268265_10876906 3300028380 Bacteria 880
175 Ga0265337_1000274 3300028556 Bacteria 28166
176 Ga0265326_10000050 3300028558 Bacteria 68195
177 Ga0265326_10036762 3300028558 Bacteria 1392
178 Ga0265334_10000472 3300028573 Bacteria 20774
179 Ga0265334_10045717 3300028573 Bacteria 1695
180 Ga0265318_10008904 3300028577 Unclassified 4445
181 Ga0265318_10096835 3300028577 Bacteria 1086
182 Ga0265318_10257214 3300028577 Archaea 637
183 Ga0265323_10163342 3300028653 Archaea 710
184 Ga0265322_10024963 3300028654 Bacteria 1710
185 Ga0265322_10069721 3300028654 Unclassified 997
186 Ga0265336_10000020 3300028666 Bacteria 213480
187 Ga0265336_10230573 3300028666 Unclassified 550
188 Ga0265338_10000093 3300028800 Bacteria 168444
189 Ga0265338_10030394 3300028800 Bacteria 5323
190 Ga0265338_10224812 3300028800 Bacteria 1400
191 Ga0265338_10401572 3300028800 Bacteria 977
192 Ga0265338_10462000 3300028800 Bacteria 898
193 Ga0265338_10611993 3300028800 Unclassified 758
194 Ga0265338_10726351 3300028800 Bacteria 684
195 Ga0265324_10002131 3300029957 Bacteria 10414
196 Ga0314311_1248726 3300030733 Unclassified 588
197 Ga0265320_10016715 3300031240 Bacteria 4103
198 Ga0265320_10092471 3300031240 Bacteria 1400
199 Ga0265325_10006375 3300031241 Bacteria 7163
200 Ga0265329_10111070 3300031242 Bacteria 876
201 Ga0265339_10064651 3300031249 Bacteria 1963
202 Ga0265339_10363774 3300031249 Bacteria 680
203 Ga0265331_10024160 3300031250 Bacteria 3078
204 Ga0265327_10010105 3300031251 Bacteria 6691
205 Ga0265316_10000097 3300031344 Bacteria 95218
206 Ga0265316_10069003 3300031344 Bacteria 2729
207 Ga0265313_10017432 3300031595 Unclassified 4082
208 Ga0265313_10104938 3300031595 Bacteria 1249
209 Ga0265314_10033941 3300031711 Unclassified 3734
210 Ga0265314_10050321 3300031711 Bacteria 2911
211 Ga0307412_10920122 3300031911 Bacteria 768
212 Ga0307416_100996860 3300032002 Bacteria 941
213 Ga0373959_0000001 3300034820 Bacteria 189143
214 Ga0373934_0030299 3300035086 Bacteria 2115
215 Ga0373954_0000426 3300035118 Bacteria 15702
216 Ga0373956_0000807 3300035119 Bacteria 13039
217 Ga0373956_0109069 3300035119 Unclassified 1288
218 Ga0373955_0062569 3300035172 Unclassified 2058
219 Ga0373955_0626509 3300035172 Unclassified 659
220 Ga0373935_0021138 3300035692 Bacteria 3983
221 Ga0373933_0049411 3300035724 Bacteria 2508
222 Ga0373933_0069868 3300035724 Unclassified 2135
223 Ga0373933_0223729 3300035724 Unclassified 1208
224 Ga0373937_0430028 3300036401 Unclassified 1253
225 Ga0395899_0303434 3300037312 Unclassified 1080
226 Ga0395900_0002606 3300037418 Bacteria 19714
227 Ga0395900_0195455 3300037418 Bacteria 2050
228 Ga0436364_0009184 3300037853 Bacteria 1273
229 Ga0436364_1216436 3300037853 Unclassified 564
230 Ga0395901_0001031 3300038443 Bacteria 30174
231 Ga0395901_0266873 3300038443 Unclassified 1781
232 Ga0395901_0466372 3300038443 Bacteria 1290
233 Ga0436365_0994555 3300039437 Bacteria 9705
234 Ga0436365_1636125 3300039437 Unclassified 635
235 Ga0436363_0577851 3300039450 Bacteria 969
236 Ga0436363_0756724 3300039450 Bacteria 1679
237 Ga0436363_0998545 3300039450 Bacteria 1648
238 Ga0436362_0121625 3300039453 Bacteria 974
239 Ga0436362_1155497 3300039453 Bacteria 513
240 Ga0451839_1596977 3300041496 Unclassified 526
241 Ga0451577_0010870 3300042876 Bacteria 8648
242 Ga0451577_0024875 3300042876 Bacteria 5439
243 Ga0451577_0027562 3300042876 Bacteria 5143
244 Ga0451577_0815784 3300042876 Viruses 842
245 Ga0453683_0075942 3300044673 Bacteria 2104
246 Ga0453684_0004925 3300044712 Bacteria 27251
247 Ga0453684_0032502 3300044712 Bacteria 7301
248 Ga0453684_0085776 3300044712 Bacteria 3911
249 Ga0453684_0146981 3300044712 Bacteria 2806
250 Ga0453684_0479326 3300044712 Bacteria 1380
251 Ga0453684_0849144 3300044712 Unclassified 981
252 Ga0451576_0000067 3300045051 Bacteria 265145
253 Ga0451576_0005229 3300045051 Bacteria 16389
254 Ga0495592_0697140 3300046454 Unclassified 611
255 Ga0495651_0001429 3300046462 Bacteria 18505
256 Ga0495653_0218777 3300046463 Unclassified 1281
257 Ga0495652_0014953 3300046529 Bacteria 6955
258 Ga0495587_0001268 3300046536 Bacteria 16793
259 Ga0495645_0000426 3300046543 Bacteria 28998
260 Ga0495599_0000608 3300046678 Bacteria 20366
261 Ga0495646_0053898 3300046680 Bacteria 2422
262 Ga0495581_0332785 3300047315 Unclassified 887
263 Ga0495684_0185550 3300047471 Unclassified 1540
264 Ga0495602_0007546 3300048088 Bacteria 11378
265 Ga0501299_162918 3300049522 Unclassified 571
266 Ga0501033_0439601 3300049570 Bacteria 907
267 Ga0501033_0795949 3300049570 Unclassified 639
268 Ga0501034_0036307 3300049571 Bacteria 4993
269 Ga0501034_0055791 3300049571 Bacteria 3976
270 Ga0501034_0682047 3300049571 Unclassified 927
271 Ga0501037_0939478 3300049573 Unclassified 565
272 Ga0501038_0412555 3300049574 Unclassified 1043
273 Ga0501038_0762237 3300049574 Bacteria 721
274 Ga0501043_0415115 3300049579 Bacteria 1015
275 Ga0501046_0012451 3300049580 Bacteria 7241
276 Ga0501047_0628647 3300049581 Bacteria 894
277 Ga0501068_0904570 3300049584 Unclassified 581
278 Ga0501072_0979064 3300049588 Unclassified 660
279 Ga0501075_0890763 3300049591 Unclassified 677
280 Ga0501080_0000652 3300049742 Bacteria 27516
281 Ga0501083_0000624 3300049744 Bacteria 22863
282 Ga0501083_0032062 3300049744 Unclassified 3605
283 Ga0501083_0384145 3300049744 Unclassified 913
284 nmdc:mga05p37_421917_c1 3300050507 Bacteria 1552
285 nmdc:mga09592_438910_c1 3300050508 Bacteria 1127
286 nmdc:mga06r32_800541_c1 3300050510 Unclassified 903
287 nmdc:mga0n895_20032_c1 3300050512 Bacteria 6229
288 nmdc:mga0rr50_1034396_c1 3300050513 Unclassified 699
289 nmdc:mga0rr50_1840083_c1 3300050513 Unclassified 509
290 nmdc:mga08x19_6644_c1 3300050514 Bacteria 6861
291 Ga0495612_0066774 3300053078 Unclassified 1495
292 Ga0495595_0322349 3300053084 Unclassified 778
293 Ga0500556_0032517 3300053104 Bacteria 1783
294 Ga0500604_0082947 3300053151 Bacteria 1038

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031249 Ga0265339_10064651 Ga0265339_100646513 82
2 3300005549 Ga0070704_101381730 Ga0070704_1013817301 83
3 3300028800 Ga0265338_10224812 Ga0265338_102248122 83
4 3300031249 Ga0265339_10363774 Ga0265339_103637742 83
5 3300013307 Ga0157372_12454957 Ga0157372_124549572 93
6 3300049571 Ga0501034_0036307 Ga0501034_0036307_1212_1499 94
7 3300049573 Ga0501037_0939478 Ga0501037_0939478_180_467 94
8 3300049574 Ga0501038_0412555 Ga0501038_0412555_72_359 94
9 3300005468 Ga0070707_100803718 Ga0070707_1008037182 97
10 3300045051 Ga0451576_0005229 Ga0451576_0005229_15497_15790 97
11 3300005536 Ga0070697_101981999 Ga0070697_1019819991 98
12 3300009147 Ga0114129_10133098 Ga0114129_101330985 98
13 3300031242 Ga0265329_10111070 Ga0265329_101110702 98
14 3300031250 Ga0265331_10024160 Ga0265331_100241603 98
15 3300041496 Ga0451839_1596977 Ga0451839_1596977_108_497 98
16 3300042876 Ga0451577_0815784 Ga0451577_0815784_141_437 98
17 3300044673 Ga0453683_0075942 Ga0453683_0075942_1271_1567 98
18 3300044712 Ga0453684_0004925 Ga0453684_0004925_65_361 98
19 3300050507 nmdc:mga05p37_421917_c1 nmdc:mga05p37_421917_c1_1065_1364 98
20 3300013297 Ga0157378_12743928 Ga0157378_127439281 99
21 3300025924 Ga0207694_10022291 Ga0207694_100222918 99
22 3300049580 Ga0501046_0012451 Ga0501046_0012451_6668_6967 99
23 3300049581 Ga0501047_0628647 Ga0501047_0628647_483_785 99
24 3300049744 Ga0501083_0000624 Ga0501083_0000624_21060_21359 99
25 3300009093 Ga0105240_11254875 Ga0105240_112548751 100
26 3300009176 Ga0105242_12551086 Ga0105242_125510862 100
27 3300013307 Ga0157372_11117806 Ga0157372_111178062 100
28 3300025912 Ga0207707_10209553 Ga0207707_102095533 100
29 3300025913 Ga0207695_11346649 Ga0207695_113466491 100
30 3300025917 Ga0207660_10022662 Ga0207660_100226623 100
31 3300025921 Ga0207652_10050300 Ga0207652_100503006 100
32 3300028800 Ga0265338_10030394 Ga0265338_100303947 100
33 3300028800 Ga0265338_10462000 Ga0265338_104620003 100
34 3300042876 Ga0451577_0024875 Ga0451577_0024875_1500_1823 100
35 3300044712 Ga0453684_0849144 Ga0453684_0849144_41_343 100
36 3300049744 Ga0501083_0032062 Ga0501083_0032062_32_334 100
37 3300005336 Ga0070680_100131605 Ga0070680_1001316051 101
38 3300005340 Ga0070689_100189241 Ga0070689_1001892413 101
39 3300005436 Ga0070713_100663220 Ga0070713_1006632203 101
40 3300005439 Ga0070711_100072796 Ga0070711_1000727963 101
41 3300005440 Ga0070705_100939997 Ga0070705_1009399972 101
42 3300005441 Ga0070700_100724694 Ga0070700_1007246941 101
43 3300005468 Ga0070707_100126476 Ga0070707_1001264763 101
44 3300005545 Ga0070695_100111032 Ga0070695_1001110322 101
45 3300005548 Ga0070665_101618664 Ga0070665_1016186642 101
46 3300005563 Ga0068855_100085381 Ga0068855_1000853817 101
47 3300005614 Ga0068856_100052425 Ga0068856_1000524251 101
48 3300005614 Ga0068856_100777450 Ga0068856_1007774502 101
49 3300009551 Ga0105238_10009271 Ga0105238_100092718 101
50 3300014969 Ga0157376_10890921 Ga0157376_108909211 101
51 3300021388 Ga0213875_10545217 Ga0213875_105452171 101
52 3300025904 Ga0207647_10000004 Ga0207647_1000000469 101
53 3300025949 Ga0207667_10000975 Ga0207667_1000097523 101
54 3300026041 Ga0207639_12200933 Ga0207639_122009332 101
55 3300028379 Ga0268266_10561355 Ga0268266_105613551 101
56 3300028800 Ga0265338_10401572 Ga0265338_104015722 101
57 3300028800 Ga0265338_10611993 Ga0265338_106119932 101
58 3300028800 Ga0265338_10726351 Ga0265338_107263512 101
59 3300030733 Ga0314311_1248726 Ga0314311_12487262 101
60 3300031240 Ga0265320_10016715 Ga0265320_100167157 101
61 3300035086 Ga0373934_0030299 Ga0373934_0030299_1060_1371 101
62 3300035172 Ga0373955_0062569 Ga0373955_0062569_21_332 101
63 3300035692 Ga0373935_0021138 Ga0373935_0021138_3661_3966 101
64 3300035724 Ga0373933_0069868 Ga0373933_0069868_1729_2040 101
65 3300037312 Ga0395899_0303434 Ga0395899_0303434_602_907 101
66 3300037853 Ga0436364_1216436 Ga0436364_1216436_65_388 101
67 3300038443 Ga0395901_0266873 Ga0395901_0266873_392_697 101
68 3300039450 Ga0436363_0577851 Ga0436363_0577851_627_932 101
69 3300039453 Ga0436362_1155497 Ga0436362_1155497_128_433 101
70 3300042876 Ga0451577_0010870 Ga0451577_0010870_3599_3931 101
71 3300042876 Ga0451577_0027562 Ga0451577_0027562_1932_2237 101
72 3300044712 Ga0453684_0146981 Ga0453684_0146981_2218_2550 101
73 3300044712 Ga0453684_0479326 Ga0453684_0479326_364_669 101
74 3300046454 Ga0495592_0697140 Ga0495592_0697140_216_527 101
75 3300046462 Ga0495651_0001429 Ga0495651_0001429_4995_5306 101
76 3300046463 Ga0495653_0218777 Ga0495653_0218777_68_379 101
77 3300046529 Ga0495652_0014953 Ga0495652_0014953_1430_1741 101
78 3300046536 Ga0495587_0001268 Ga0495587_0001268_16137_16448 101
79 3300046543 Ga0495645_0000426 Ga0495645_0000426_3519_3830 101
80 3300046678 Ga0495599_0000608 Ga0495599_0000608_8026_8337 101
81 3300046680 Ga0495646_0053898 Ga0495646_0053898_1738_2049 101
82 3300047471 Ga0495684_0185550 Ga0495684_0185550_959_1270 101
83 3300048088 Ga0495602_0007546 Ga0495602_0007546_1397_1708 101
84 3300049571 Ga0501034_0055791 Ga0501034_0055791_656_961 101
85 3300049742 Ga0501080_0000652 Ga0501080_0000652_21684_21989 101
86 3300050510 nmdc:mga06r32_800541_c1 nmdc:mga06r32_800541_c1_474_779 101
87 3300050512 nmdc:mga0n895_20032_c1 nmdc:mga0n895_20032_c1_2010_2336 101
88 3300053084 Ga0495595_0322349 Ga0495595_0322349_229_540 101
89 3300053104 Ga0500556_0032517 Ga0500556_0032517_850_1155 101
90 3300003214 JGI25165J46597_1000013 JGI25165J46597_1000013288 102
91 3300003323 rootH1_10246200 rootH1_102462004 102
92 3300005329 Ga0070683_100000544 Ga0070683_1000005449 102
93 3300005330 Ga0070690_100142685 Ga0070690_1001426854 102
94 3300005331 Ga0070670_100365984 Ga0070670_1003659842 102
95 3300005336 Ga0070680_100720567 Ga0070680_1007205672 102
96 3300005445 Ga0070708_102073507 Ga0070708_1020735072 102
97 3300005458 Ga0070681_10006464 Ga0070681_100064646 102
98 3300005458 Ga0070681_10375086 Ga0070681_103750862 102
99 3300005458 Ga0070681_10402341 Ga0070681_104023412 102
100 3300005544 Ga0070686_100088264 Ga0070686_1000882641 102
101 3300005544 Ga0070686_100105450 Ga0070686_1001054502 102
102 3300005563 Ga0068855_101259879 Ga0068855_1012598792 102
103 3300005564 Ga0070664_100193309 Ga0070664_1001933093 102
104 3300005843 Ga0068860_100233096 Ga0068860_1002330963 102
105 3300005844 Ga0068862_100010808 Ga0068862_1000108087 102
106 3300009093 Ga0105240_10111451 Ga0105240_101114512 102
107 3300009093 Ga0105240_10248592 Ga0105240_102485922 102
108 3300009093 Ga0105240_10493250 Ga0105240_104932503 102
109 3300009174 Ga0105241_11267263 Ga0105241_112672631 102
110 3300009551 Ga0105238_11301999 Ga0105238_113019991 102
111 3300010375 Ga0105239_10011818 Ga0105239_100118188 102
112 3300010375 Ga0105239_10841255 Ga0105239_108412551 102
113 3300011119 Ga0105246_10180928 Ga0105246_101809282 102
114 3300013105 Ga0157369_10105224 Ga0157369_101052243 102
115 3300013296 Ga0157374_10013652 Ga0157374_100136525 102
116 3300014325 Ga0163163_12699511 Ga0163163_126995112 102
117 3300025261 Ga0209233_1000013 Ga0209233_1000013536 102
118 3300025912 Ga0207707_10869004 Ga0207707_108690042 102
119 3300025913 Ga0207695_10083665 Ga0207695_100836654 102
120 3300025913 Ga0207695_10253928 Ga0207695_102539282 102
121 3300025925 Ga0207650_10782256 Ga0207650_107822562 102
122 3300025944 Ga0207661_10000163 Ga0207661_1000016326 102
123 3300025949 Ga0207667_11297870 Ga0207667_112978702 102
124 3300025961 Ga0207712_10824633 Ga0207712_108246331 102
125 3300025986 Ga0207658_11571625 Ga0207658_115716251 102
126 3300026023 Ga0207677_10991446 Ga0207677_109914462 102
127 3300026041 Ga0207639_11085456 Ga0207639_110854561 102
128 3300027695 Ga0209966_1000307 Ga0209966_100030717 102
129 3300028379 Ga0268266_10027347 Ga0268266_100273472 102
130 3300028556 Ga0265337_1000274 Ga0265337_100027425 102
131 3300028558 Ga0265326_10000050 Ga0265326_100000503 102
132 3300028573 Ga0265334_10000472 Ga0265334_1000047218 102
133 3300028573 Ga0265334_10045717 Ga0265334_100457172 102
134 3300028577 Ga0265318_10096835 Ga0265318_100968352 102
135 3300028654 Ga0265322_10024963 Ga0265322_100249633 102
136 3300028654 Ga0265322_10069721 Ga0265322_100697211 102
137 3300028666 Ga0265336_10000020 Ga0265336_10000020138 102
138 3300028800 Ga0265338_10000093 Ga0265338_10000093117 102
139 3300029957 Ga0265324_10002131 Ga0265324_1000213112 102
140 3300031240 Ga0265320_10092471 Ga0265320_100924712 102
141 3300031241 Ga0265325_10006375 Ga0265325_100063753 102
142 3300031251 Ga0265327_10010105 Ga0265327_100101055 102
143 3300031344 Ga0265316_10069003 Ga0265316_100690032 102
144 3300031595 Ga0265313_10104938 Ga0265313_101049382 102
145 3300031711 Ga0265314_10050321 Ga0265314_100503216 102
146 3300037418 Ga0395900_0002606 Ga0395900_0002606_4422_4730 102
147 3300037418 Ga0395900_0195455 Ga0395900_0195455_525_872 102
148 3300038443 Ga0395901_0466372 Ga0395901_0466372_67_375 102
149 3300039450 Ga0436363_0756724 Ga0436363_0756724_220_546 102
150 3300044712 Ga0453684_0032502 Ga0453684_0032502_2881_3189 102
151 3300044712 Ga0453684_0085776 Ga0453684_0085776_2573_2881 102
152 3300045051 Ga0451576_0000067 Ga0451576_0000067_41583_41891 102
153 3300049574 Ga0501038_0762237 Ga0501038_0762237_13_321 102
154 3300050513 nmdc:mga0rr50_1840083_c1 nmdc:mga0rr50_1840083_c1_27_335 102
155 3300005295 Ga0065707_10773418 Ga0065707_107734181 103
156 3300005327 Ga0070658_11593357 Ga0070658_115933572 103
157 3300005331 Ga0070670_101718335 Ga0070670_1017183351 103
158 3300005334 Ga0068869_100000137 Ga0068869_10000013725 103
159 3300005355 Ga0070671_100512828 Ga0070671_1005128282 103
160 3300005364 Ga0070673_102273239 Ga0070673_1022732391 103
161 3300005445 Ga0070708_100000451 Ga0070708_10000045111 103
162 3300005467 Ga0070706_100000132 Ga0070706_10000013294 103
163 3300005467 Ga0070706_100996848 Ga0070706_1009968481 103
164 3300005468 Ga0070707_100253945 Ga0070707_1002539452 103
165 3300005468 Ga0070707_102078722 Ga0070707_1020787222 103
166 3300005471 Ga0070698_100766141 Ga0070698_1007661411 103
167 3300005471 Ga0070698_100909820 Ga0070698_1009098202 103
168 3300005518 Ga0070699_100050543 Ga0070699_1000505433 103
169 3300005518 Ga0070699_100868653 Ga0070699_1008686531 103
170 3300005530 Ga0070679_101769673 Ga0070679_1017696731 103
171 3300005536 Ga0070697_100048653 Ga0070697_1000486535 103
172 3300005548 Ga0070665_100229905 Ga0070665_1002299052 103
173 3300005548 Ga0070665_100485015 Ga0070665_1004850151 103
174 3300005563 Ga0068855_100347548 Ga0068855_1003475482 103
175 3300005563 Ga0068855_101862158 Ga0068855_1018621582 103
176 3300005617 Ga0068859_102341890 Ga0068859_1023418901 103
177 3300005841 Ga0068863_102018988 Ga0068863_1020189882 103
178 3300006028 Ga0070717_10000882 Ga0070717_100008828 103
179 3300006358 Ga0068871_101719425 Ga0068871_1017194252 103
180 3300006844 Ga0075428_101326463 Ga0075428_1013264632 103
181 3300006880 Ga0075429_100450659 Ga0075429_1004506592 103
182 3300006931 Ga0097620_102341619 Ga0097620_1023416192 103
183 3300009093 Ga0105240_10024231 Ga0105240_100242313 103
184 3300009093 Ga0105240_10144670 Ga0105240_101446706 103
185 3300009093 Ga0105240_10708966 Ga0105240_107089662 103
186 3300009098 Ga0105245_12824824 Ga0105245_128248241 103
187 3300009148 Ga0105243_10344009 Ga0105243_103440091 103
188 3300009174 Ga0105241_10205149 Ga0105241_102051494 103
189 3300009174 Ga0105241_10360351 Ga0105241_103603513 103
190 3300009174 Ga0105241_11896343 Ga0105241_118963432 103
191 3300009545 Ga0105237_10755789 Ga0105237_107557891 103
192 3300009551 Ga0105238_10845252 Ga0105238_108452521 103
193 3300009553 Ga0105249_10278094 Ga0105249_102780942 103
194 3300010375 Ga0105239_12068978 Ga0105239_120689782 103
195 3300010375 Ga0105239_12290054 Ga0105239_122900541 103
196 3300013100 Ga0157373_10066770 Ga0157373_100667703 103
197 3300013297 Ga0157378_12457291 Ga0157378_124572911 103
198 3300013307 Ga0157372_12907464 Ga0157372_129074641 103
199 3300014325 Ga0163163_10006016 Ga0163163_1000601611 103
200 3300014325 Ga0163163_10139599 Ga0163163_101395991 103
201 3300014325 Ga0163163_11576582 Ga0163163_115765821 103
202 3300014745 Ga0157377_10575939 Ga0157377_105759391 103
203 3300021384 Ga0213876_10007202 Ga0213876_100072023 103
204 3300025909 Ga0207705_11240982 Ga0207705_112409822 103
205 3300025910 Ga0207684_10000244 Ga0207684_1000024431 103
206 3300025912 Ga0207707_11533203 Ga0207707_115332031 103
207 3300025913 Ga0207695_10019297 Ga0207695_100192978 103
208 3300025913 Ga0207695_10379493 Ga0207695_103794932 103
209 3300025914 Ga0207671_10439258 Ga0207671_104392582 103
210 3300025914 Ga0207671_10471464 Ga0207671_104714642 103
211 3300025914 Ga0207671_11461032 Ga0207671_114610321 103
212 3300025921 Ga0207652_11383880 Ga0207652_113838801 103
213 3300025922 Ga0207646_10021254 Ga0207646_100212547 103
214 3300025922 Ga0207646_10730326 Ga0207646_107303262 103
215 3300025925 Ga0207650_10537473 Ga0207650_105374732 103
216 3300025936 Ga0207670_10403002 Ga0207670_104030022 103
217 3300025942 Ga0207689_10015621 Ga0207689_100156218 103
218 3300025949 Ga0207667_10133026 Ga0207667_101330264 103
219 3300025949 Ga0207667_11456134 Ga0207667_114561342 103
220 3300025960 Ga0207651_11624730 Ga0207651_116247301 103
221 3300025961 Ga0207712_10815146 Ga0207712_108151461 103
222 3300025986 Ga0207658_11105534 Ga0207658_111055342 103
223 3300026035 Ga0207703_10055429 Ga0207703_100554293 103
224 3300026041 Ga0207639_10251155 Ga0207639_102511551 103
225 3300026116 Ga0207674_11123494 Ga0207674_111234941 103
226 3300028379 Ga0268266_10257054 Ga0268266_102570541 103
227 3300028380 Ga0268265_10876906 Ga0268265_108769062 103
228 3300028577 Ga0265318_10008904 Ga0265318_100089045 103
229 3300028577 Ga0265318_10257214 Ga0265318_102572141 103
230 3300028653 Ga0265323_10163342 Ga0265323_101633421 103
231 3300031595 Ga0265313_10017432 Ga0265313_100174324 103
232 3300031711 Ga0265314_10033941 Ga0265314_100339415 103
233 3300031911 Ga0307412_10920122 Ga0307412_109201221 103
234 3300032002 Ga0307416_100996860 Ga0307416_1009968602 103
235 3300037853 Ga0436364_0009184 Ga0436364_0009184_565_894 103
236 3300038443 Ga0395901_0001031 Ga0395901_0001031_28260_28571 103
237 3300039437 Ga0436365_0994555 Ga0436365_0994555_2989_3336 103
238 3300039450 Ga0436363_0998545 Ga0436363_0998545_712_1053 103
239 3300039453 Ga0436362_0121625 Ga0436362_0121625_414_743 103
240 3300049522 Ga0501299_162918 Ga0501299_162918_72_386 103
241 3300049570 Ga0501033_0439601 Ga0501033_0439601_347_661 103
242 3300049570 Ga0501033_0795949 Ga0501033_0795949_294_608 103
243 3300049579 Ga0501043_0415115 Ga0501043_0415115_208_522 103
244 3300049588 Ga0501072_0979064 Ga0501072_0979064_225_539 103
245 3300049591 Ga0501075_0890763 Ga0501075_0890763_309_623 103
246 3300049744 Ga0501083_0384145 Ga0501083_0384145_79_390 103
247 3300050508 nmdc:mga09592_438910_c1 nmdc:mga09592_438910_c1_407_718 103
248 3300053151 Ga0500604_0082947 Ga0500604_0082947_462_773 103
249 3300003323 rootH1_10090752 rootH1_100907522 104
250 3300005434 Ga0070709_10186956 Ga0070709_101869562 104
251 3300005434 Ga0070709_11004272 Ga0070709_110042721 104
252 3300005436 Ga0070713_100426903 Ga0070713_1004269031 104
253 3300005445 Ga0070708_100032367 Ga0070708_1000323672 104
254 3300005445 Ga0070708_100292812 Ga0070708_1002928123 104
255 3300005455 Ga0070663_101645088 Ga0070663_1016450881 104
256 3300005467 Ga0070706_100002210 Ga0070706_1000022107 104
257 3300005467 Ga0070706_100733852 Ga0070706_1007338522 104
258 3300005535 Ga0070684_100548858 Ga0070684_1005488581 104
259 3300005536 Ga0070697_100165908 Ga0070697_1001659082 104
260 3300005536 Ga0070697_100792178 Ga0070697_1007921781 104
261 3300005544 Ga0070686_100197849 Ga0070686_1001978491 104
262 3300006028 Ga0070717_10124204 Ga0070717_101242043 104
263 3300006173 Ga0070716_100676292 Ga0070716_1006762922 104
264 3300006175 Ga0070712_101173411 Ga0070712_1011734111 104
265 3300006914 Ga0075436_100013421 Ga0075436_1000134215 104
266 3300007076 Ga0075435_101225895 Ga0075435_1012258952 104
267 3300007788 Ga0099795_10188346 Ga0099795_101883462 104
268 3300025261 Ga0209233_1004477 Ga0209233_10044776 104
269 3300025898 Ga0207692_10206498 Ga0207692_102064982 104
270 3300025910 Ga0207684_10000643 Ga0207684_1000064341 104
271 3300025910 Ga0207684_10252192 Ga0207684_102521922 104
272 3300025910 Ga0207684_11041042 Ga0207684_110410422 104
273 3300025915 Ga0207693_10133481 Ga0207693_101334811 104
274 3300025939 Ga0207665_10153270 Ga0207665_101532702 104
275 3300025949 Ga0207667_11109775 Ga0207667_111097752 104
276 3300028558 Ga0265326_10036762 Ga0265326_100367622 104
277 3300031344 Ga0265316_10000097 Ga0265316_1000009781 104
278 3300034820 Ga0373959_0000001 Ga0373959_0000001_101715_102035 104
279 3300035118 Ga0373954_0000426 Ga0373954_0000426_9159_9473 104
280 3300035119 Ga0373956_0000807 Ga0373956_0000807_9122_9436 104
281 3300035119 Ga0373956_0109069 Ga0373956_0109069_591_911 104
282 3300035172 Ga0373955_0626509 Ga0373955_0626509_235_549 104
283 3300035724 Ga0373933_0049411 Ga0373933_0049411_307_621 104
284 3300035724 Ga0373933_0223729 Ga0373933_0223729_71_391 104
285 3300036401 Ga0373937_0430028 Ga0373937_0430028_149_463 104
286 3300039437 Ga0436365_1636125 Ga0436365_1636125_56_379 104
287 3300047315 Ga0495581_0332785 Ga0495581_0332785_307_627 104
288 3300049571 Ga0501034_0682047 Ga0501034_0682047_67_381 104
289 3300049584 Ga0501068_0904570 Ga0501068_0904570_143_457 104
290 3300050513 nmdc:mga0rr50_1034396_c1 nmdc:mga0rr50_1034396_c1_182_505 104
291 3300050514 nmdc:mga08x19_6644_c1 nmdc:mga08x19_6644_c1_3298_3612 104
292 3300053078 Ga0495612_0066774 Ga0495612_0066774_1107_1421 104
293 3300002067 JGI24735J21928_10000115 JGI24735J21928_1000011521 105
294 3300028666 Ga0265336_10230573 Ga0265336_102305731 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13376

OmdA

Bacteriocin-protection, YdeI or OmpD-Associated

12

69

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w76-assembly2.cif.gz_F crystal structure of the k. lactis bre1 rbd in complex with rad6, crystal form ii 0.4818 17 69
6qaj-assembly1.cif.gz_A structure of the tripartite motif of kap1/trim28 0.438 17 71
7z34-assembly1.cif.gz_b structure of pre-60s particle bound to drg1(afg2). 0.4352 15 97
5t1a-assembly1.cif.gz_A structure of cc chemokine receptor 2 with orthosteric and allosteric antagonists 0.4302 17 70
6a9j-assembly1.cif.gz_A crystal structure of the pe-bound n-terminal domain of atg2 0.423 17 71
ID Description Score Start End Superfamily
af_Q2FW95_606_682_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5774 16 69 1.20.58.90
af_Q2FXH4_657_733_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.556 18 74 1.20.58.90
af_A0A1D6E4R1_1_104_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5494 14 69 1.25.10.10
af_Q2FXH4_1735_1811_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.5418 16 69 1.10.8.10
af_Q2FW95_1530_1606_1.20.5.420 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.5405 17 74 1.20.5.420
ID Description Score Start End GO Terms
AF-A0A2W4MCE8-F1-model_v4 Bacteriocin-protection protein 0.9753 14 69
AF-A0A535WYN3-F1-model_v4 DUF1905 domain-containing protein 0.9725 12 67
AF-A0A6L4A4V5-F1-model_v4 deleted 0.9716 3 67
AF-A0A537ILI1-F1-model_v4 Bacteriocin-protection protein 0.971 13 69
AF-A0A419GXD7-F1-model_v4 Bacteriocin-protection protein 0.9699 14 70

Feature Viewer

pLDDT pTM Quality
81.23 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map