F391976
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 294 | 174 | 294 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100052425|Ga0068856_1000524251 |
| Length | 104 |
| Sequence | MSKNKISGGVVHTMPTDLKKILIADKVALAKWENSTPLARNEWICWIESVKTPEKRKEHIKRTASELSELKEGMRRPCCWIGCIHRKDKPLSPSQKFILHKRTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 2 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 45 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 49 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 70 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 71 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 101 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 102 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 103 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 104 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 105 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 106 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 107 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 110 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 111 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 112 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 114 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 115 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 116 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 117 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 120 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 121 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 122 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 123 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 124 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 125 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 126 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 127 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 128 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 132 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 133 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 134 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 135 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 136 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 137 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 138 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 139 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 140 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 141 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 153 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 174 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.7 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 94.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10000115 | 3300002067 | Bacteria | 29387 |
| 2 | JGI25165J46597_1000013 | 3300003214 | Bacteria | 402100 |
| 3 | rootH1_10090752 | 3300003323 | Archaea | 2510 |
| 4 | rootH1_10246200 | 3300003323 | Bacteria | 3424 |
| 5 | Ga0065707_10773418 | 3300005295 | Unclassified | 564 |
| 6 | Ga0070658_11593357 | 3300005327 | Bacteria | 566 |
| 7 | Ga0070683_100000544 | 3300005329 | Bacteria | 26670 |
| 8 | Ga0070690_100142685 | 3300005330 | Unclassified | 1627 |
| 9 | Ga0070670_100365984 | 3300005331 | Bacteria | 1268 |
| 10 | Ga0070670_101718335 | 3300005331 | Unclassified | 577 |
| 11 | Ga0068869_100000137 | 3300005334 | Bacteria | 35570 |
| 12 | Ga0070680_100131605 | 3300005336 | Bacteria | 2093 |
| 13 | Ga0070680_100720567 | 3300005336 | Bacteria | 858 |
| 14 | Ga0070689_100189241 | 3300005340 | Unclassified | 1675 |
| 15 | Ga0070671_100512828 | 3300005355 | Bacteria | 1032 |
| 16 | Ga0070673_102273239 | 3300005364 | Viruses | 515 |
| 17 | Ga0070709_10186956 | 3300005434 | Unclassified | 1459 |
| 18 | Ga0070709_11004272 | 3300005434 | Unclassified | 664 |
| 19 | Ga0070713_100426903 | 3300005436 | Bacteria | 1242 |
| 20 | Ga0070713_100663220 | 3300005436 | Unclassified | 994 |
| 21 | Ga0070711_100072796 | 3300005439 | Bacteria | 2425 |
| 22 | Ga0070705_100939997 | 3300005440 | Unclassified | 698 |
| 23 | Ga0070700_100724694 | 3300005441 | Unclassified | 793 |
| 24 | Ga0070708_100000451 | 3300005445 | Bacteria | 30807 |
| 25 | Ga0070708_100032367 | 3300005445 | Unclassified | 4535 |
| 26 | Ga0070708_100292812 | 3300005445 | Unclassified | 1533 |
| 27 | Ga0070708_102073507 | 3300005445 | Unclassified | 526 |
| 28 | Ga0070663_101645088 | 3300005455 | Bacteria | 573 |
| 29 | Ga0070681_10006464 | 3300005458 | Bacteria | 11408 |
| 30 | Ga0070681_10375086 | 3300005458 | Bacteria | 1333 |
| 31 | Ga0070681_10402341 | 3300005458 | Bacteria | 1280 |
| 32 | Ga0070706_100000132 | 3300005467 | Bacteria | 92406 |
| 33 | Ga0070706_100002210 | 3300005467 | Bacteria | 19798 |
| 34 | Ga0070706_100733852 | 3300005467 | Unclassified | 915 |
| 35 | Ga0070706_100996848 | 3300005467 | Bacteria | 772 |
| 36 | Ga0070707_100126476 | 3300005468 | Bacteria | 2484 |
| 37 | Ga0070707_100253945 | 3300005468 | Unclassified | 1711 |
| 38 | Ga0070707_100803718 | 3300005468 | Bacteria | 904 |
| 39 | Ga0070707_102078722 | 3300005468 | Bacteria | 535 |
| 40 | Ga0070698_100766141 | 3300005471 | Bacteria | 908 |
| 41 | Ga0070698_100909820 | 3300005471 | Unclassified | 825 |
| 42 | Ga0070699_100050543 | 3300005518 | Bacteria | 3599 |
| 43 | Ga0070699_100868653 | 3300005518 | Bacteria | 826 |
| 44 | Ga0070679_101769673 | 3300005530 | Bacteria | 566 |
| 45 | Ga0070684_100548858 | 3300005535 | Bacteria | 1072 |
| 46 | Ga0070697_100048653 | 3300005536 | Bacteria | 3438 |
| 47 | Ga0070697_100165908 | 3300005536 | Unclassified | 1867 |
| 48 | Ga0070697_100792178 | 3300005536 | Unclassified | 838 |
| 49 | Ga0070697_101981999 | 3300005536 | Unclassified | 521 |
| 50 | Ga0070686_100088264 | 3300005544 | Bacteria | 2069 |
| 51 | Ga0070686_100105450 | 3300005544 | Bacteria | 1911 |
| 52 | Ga0070686_100197849 | 3300005544 | Bacteria | 1439 |
| 53 | Ga0070695_100111032 | 3300005545 | Bacteria | 1860 |
| 54 | Ga0070665_100229905 | 3300005548 | Bacteria | 1854 |
| 55 | Ga0070665_100485015 | 3300005548 | Unclassified | 1247 |
| 56 | Ga0070665_101618664 | 3300005548 | Unclassified | 655 |
| 57 | Ga0070704_101381730 | 3300005549 | Unclassified | 646 |
| 58 | Ga0068855_100085381 | 3300005563 | Bacteria | 3652 |
| 59 | Ga0068855_100347548 | 3300005563 | Bacteria | 1634 |
| 60 | Ga0068855_101259879 | 3300005563 | Unclassified | 767 |
| 61 | Ga0068855_101862158 | 3300005563 | Unclassified | 610 |
| 62 | Ga0070664_100193309 | 3300005564 | Bacteria | 1813 |
| 63 | Ga0068856_100052425 | 3300005614 | Bacteria | 4023 |
| 64 | Ga0068856_100777450 | 3300005614 | Bacteria | 977 |
| 65 | Ga0068859_102341890 | 3300005617 | Unclassified | 589 |
| 66 | Ga0068863_102018988 | 3300005841 | Unclassified | 587 |
| 67 | Ga0068860_100233096 | 3300005843 | Bacteria | 1789 |
| 68 | Ga0068862_100010808 | 3300005844 | Bacteria | 7539 |
| 69 | Ga0070717_10000882 | 3300006028 | Bacteria | 19841 |
| 70 | Ga0070717_10124204 | 3300006028 | Bacteria | 2214 |
| 71 | Ga0070716_100676292 | 3300006173 | Unclassified | 786 |
| 72 | Ga0070712_101173411 | 3300006175 | Unclassified | 668 |
| 73 | Ga0068871_101719425 | 3300006358 | Unclassified | 595 |
| 74 | Ga0075428_101326463 | 3300006844 | Bacteria | 756 |
| 75 | Ga0075429_100450659 | 3300006880 | Bacteria | 1127 |
| 76 | Ga0075436_100013421 | 3300006914 | Bacteria | 5609 |
| 77 | Ga0097620_102341619 | 3300006931 | Unclassified | 589 |
| 78 | Ga0075435_101225895 | 3300007076 | Unclassified | 656 |
| 79 | Ga0099795_10188346 | 3300007788 | Unclassified | 865 |
| 80 | Ga0105240_10024231 | 3300009093 | Bacteria | 8007 |
| 81 | Ga0105240_10111451 | 3300009093 | Bacteria | 3310 |
| 82 | Ga0105240_10144670 | 3300009093 | Bacteria | 2838 |
| 83 | Ga0105240_10248592 | 3300009093 | Bacteria | 2058 |
| 84 | Ga0105240_10493250 | 3300009093 | Bacteria | 1363 |
| 85 | Ga0105240_10708966 | 3300009093 | Bacteria | 1098 |
| 86 | Ga0105240_11254875 | 3300009093 | Bacteria | 783 |
| 87 | Ga0105245_12824824 | 3300009098 | Bacteria | 538 |
| 88 | Ga0114129_10133098 | 3300009147 | Bacteria | 3414 |
| 89 | Ga0105243_10344009 | 3300009148 | Bacteria | 1367 |
| 90 | Ga0105241_10205149 | 3300009174 | Bacteria | 1649 |
| 91 | Ga0105241_10360351 | 3300009174 | Bacteria | 1265 |
| 92 | Ga0105241_11267263 | 3300009174 | Unclassified | 701 |
| 93 | Ga0105241_11896343 | 3300009174 | Bacteria | 584 |
| 94 | Ga0105242_12551086 | 3300009176 | Bacteria | 560 |
| 95 | Ga0105237_10755789 | 3300009545 | Bacteria | 979 |
| 96 | Ga0105238_10009271 | 3300009551 | Bacteria | 9849 |
| 97 | Ga0105238_10845252 | 3300009551 | Bacteria | 932 |
| 98 | Ga0105238_11301999 | 3300009551 | Bacteria | 753 |
| 99 | Ga0105249_10278094 | 3300009553 | Bacteria | 1670 |
| 100 | Ga0105239_10011818 | 3300010375 | Bacteria | 9744 |
| 101 | Ga0105239_10841255 | 3300010375 | Unclassified | 1052 |
| 102 | Ga0105239_12068978 | 3300010375 | Bacteria | 661 |
| 103 | Ga0105239_12290054 | 3300010375 | Bacteria | 629 |
| 104 | Ga0105246_10180928 | 3300011119 | Bacteria | 1623 |
| 105 | Ga0157373_10066770 | 3300013100 | Bacteria | 2543 |
| 106 | Ga0157369_10105224 | 3300013105 | Unclassified | 3004 |
| 107 | Ga0157374_10013652 | 3300013296 | Bacteria | 7095 |
| 108 | Ga0157378_12457291 | 3300013297 | Unclassified | 573 |
| 109 | Ga0157378_12743928 | 3300013297 | Unclassified | 545 |
| 110 | Ga0157372_11117806 | 3300013307 | Bacteria | 911 |
| 111 | Ga0157372_12454957 | 3300013307 | Bacteria | 598 |
| 112 | Ga0157372_12907464 | 3300013307 | Bacteria | 548 |
| 113 | Ga0163163_10006016 | 3300014325 | Bacteria | 10556 |
| 114 | Ga0163163_10139599 | 3300014325 | Unclassified | 2465 |
| 115 | Ga0163163_11576582 | 3300014325 | Bacteria | 718 |
| 116 | Ga0163163_12699511 | 3300014325 | Bacteria | 554 |
| 117 | Ga0157377_10575939 | 3300014745 | Unclassified | 799 |
| 118 | Ga0157376_10890921 | 3300014969 | Bacteria | 907 |
| 119 | Ga0213876_10007202 | 3300021384 | Bacteria | 6064 |
| 120 | Ga0213875_10545217 | 3300021388 | Unclassified | 559 |
| 121 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 122 | Ga0209233_1004477 | 3300025261 | Bacteria | 4743 |
| 123 | Ga0207692_10206498 | 3300025898 | Unclassified | 1158 |
| 124 | Ga0207647_10000004 | 3300025904 | Bacteria | 307217 |
| 125 | Ga0207705_11240982 | 3300025909 | Bacteria | 571 |
| 126 | Ga0207684_10000244 | 3300025910 | Bacteria | 81549 |
| 127 | Ga0207684_10000643 | 3300025910 | Bacteria | 41347 |
| 128 | Ga0207684_10252192 | 3300025910 | Bacteria | 1522 |
| 129 | Ga0207684_11041042 | 3300025910 | Unclassified | 683 |
| 130 | Ga0207707_10209553 | 3300025912 | Unclassified | 1698 |
| 131 | Ga0207707_10869004 | 3300025912 | Bacteria | 747 |
| 132 | Ga0207707_11533203 | 3300025912 | Unclassified | 527 |
| 133 | Ga0207695_10019297 | 3300025913 | Bacteria | 7852 |
| 134 | Ga0207695_10083665 | 3300025913 | Bacteria | 3223 |
| 135 | Ga0207695_10253928 | 3300025913 | Bacteria | 1657 |
| 136 | Ga0207695_10379493 | 3300025913 | Bacteria | 1299 |
| 137 | Ga0207695_11346649 | 3300025913 | Unclassified | 594 |
| 138 | Ga0207671_10439258 | 3300025914 | Bacteria | 1039 |
| 139 | Ga0207671_10471464 | 3300025914 | Bacteria | 1000 |
| 140 | Ga0207671_11461032 | 3300025914 | Unclassified | 529 |
| 141 | Ga0207693_10133481 | 3300025915 | Unclassified | 1951 |
| 142 | Ga0207660_10022662 | 3300025917 | Bacteria | 4233 |
| 143 | Ga0207652_10050300 | 3300025921 | Bacteria | 3570 |
| 144 | Ga0207652_11383880 | 3300025921 | Bacteria | 607 |
| 145 | Ga0207646_10021254 | 3300025922 | Bacteria | 5998 |
| 146 | Ga0207646_10730326 | 3300025922 | Unclassified | 884 |
| 147 | Ga0207694_10022291 | 3300025924 | Bacteria | 4804 |
| 148 | Ga0207650_10537473 | 3300025925 | Unclassified | 979 |
| 149 | Ga0207650_10782256 | 3300025925 | Bacteria | 808 |
| 150 | Ga0207670_10403002 | 3300025936 | Bacteria | 1094 |
| 151 | Ga0207665_10153270 | 3300025939 | Bacteria | 1652 |
| 152 | Ga0207689_10015621 | 3300025942 | Bacteria | 6430 |
| 153 | Ga0207661_10000163 | 3300025944 | Bacteria | 43092 |
| 154 | Ga0207667_10000975 | 3300025949 | Bacteria | 36500 |
| 155 | Ga0207667_10133026 | 3300025949 | Bacteria | 2562 |
| 156 | Ga0207667_11109775 | 3300025949 | Unclassified | 774 |
| 157 | Ga0207667_11297870 | 3300025949 | Unclassified | 704 |
| 158 | Ga0207667_11456134 | 3300025949 | Unclassified | 657 |
| 159 | Ga0207651_11624730 | 3300025960 | Unclassified | 582 |
| 160 | Ga0207712_10815146 | 3300025961 | Bacteria | 821 |
| 161 | Ga0207712_10824633 | 3300025961 | Bacteria | 816 |
| 162 | Ga0207658_11105534 | 3300025986 | Bacteria | 724 |
| 163 | Ga0207658_11571625 | 3300025986 | Bacteria | 601 |
| 164 | Ga0207677_10991446 | 3300026023 | Unclassified | 761 |
| 165 | Ga0207703_10055429 | 3300026035 | Bacteria | 3225 |
| 166 | Ga0207639_10251155 | 3300026041 | Bacteria | 1542 |
| 167 | Ga0207639_11085456 | 3300026041 | Unclassified | 750 |
| 168 | Ga0207639_12200933 | 3300026041 | Bacteria | 513 |
| 169 | Ga0207674_11123494 | 3300026116 | Unclassified | 755 |
| 170 | Ga0209966_1000307 | 3300027695 | Bacteria | 16038 |
| 171 | Ga0268266_10027347 | 3300028379 | Bacteria | 4850 |
| 172 | Ga0268266_10257054 | 3300028379 | Bacteria | 1617 |
| 173 | Ga0268266_10561355 | 3300028379 | Bacteria | 1094 |
| 174 | Ga0268265_10876906 | 3300028380 | Bacteria | 880 |
| 175 | Ga0265337_1000274 | 3300028556 | Bacteria | 28166 |
| 176 | Ga0265326_10000050 | 3300028558 | Bacteria | 68195 |
| 177 | Ga0265326_10036762 | 3300028558 | Bacteria | 1392 |
| 178 | Ga0265334_10000472 | 3300028573 | Bacteria | 20774 |
| 179 | Ga0265334_10045717 | 3300028573 | Bacteria | 1695 |
| 180 | Ga0265318_10008904 | 3300028577 | Unclassified | 4445 |
| 181 | Ga0265318_10096835 | 3300028577 | Bacteria | 1086 |
| 182 | Ga0265318_10257214 | 3300028577 | Archaea | 637 |
| 183 | Ga0265323_10163342 | 3300028653 | Archaea | 710 |
| 184 | Ga0265322_10024963 | 3300028654 | Bacteria | 1710 |
| 185 | Ga0265322_10069721 | 3300028654 | Unclassified | 997 |
| 186 | Ga0265336_10000020 | 3300028666 | Bacteria | 213480 |
| 187 | Ga0265336_10230573 | 3300028666 | Unclassified | 550 |
| 188 | Ga0265338_10000093 | 3300028800 | Bacteria | 168444 |
| 189 | Ga0265338_10030394 | 3300028800 | Bacteria | 5323 |
| 190 | Ga0265338_10224812 | 3300028800 | Bacteria | 1400 |
| 191 | Ga0265338_10401572 | 3300028800 | Bacteria | 977 |
| 192 | Ga0265338_10462000 | 3300028800 | Bacteria | 898 |
| 193 | Ga0265338_10611993 | 3300028800 | Unclassified | 758 |
| 194 | Ga0265338_10726351 | 3300028800 | Bacteria | 684 |
| 195 | Ga0265324_10002131 | 3300029957 | Bacteria | 10414 |
| 196 | Ga0314311_1248726 | 3300030733 | Unclassified | 588 |
| 197 | Ga0265320_10016715 | 3300031240 | Bacteria | 4103 |
| 198 | Ga0265320_10092471 | 3300031240 | Bacteria | 1400 |
| 199 | Ga0265325_10006375 | 3300031241 | Bacteria | 7163 |
| 200 | Ga0265329_10111070 | 3300031242 | Bacteria | 876 |
| 201 | Ga0265339_10064651 | 3300031249 | Bacteria | 1963 |
| 202 | Ga0265339_10363774 | 3300031249 | Bacteria | 680 |
| 203 | Ga0265331_10024160 | 3300031250 | Bacteria | 3078 |
| 204 | Ga0265327_10010105 | 3300031251 | Bacteria | 6691 |
| 205 | Ga0265316_10000097 | 3300031344 | Bacteria | 95218 |
| 206 | Ga0265316_10069003 | 3300031344 | Bacteria | 2729 |
| 207 | Ga0265313_10017432 | 3300031595 | Unclassified | 4082 |
| 208 | Ga0265313_10104938 | 3300031595 | Bacteria | 1249 |
| 209 | Ga0265314_10033941 | 3300031711 | Unclassified | 3734 |
| 210 | Ga0265314_10050321 | 3300031711 | Bacteria | 2911 |
| 211 | Ga0307412_10920122 | 3300031911 | Bacteria | 768 |
| 212 | Ga0307416_100996860 | 3300032002 | Bacteria | 941 |
| 213 | Ga0373959_0000001 | 3300034820 | Bacteria | 189143 |
| 214 | Ga0373934_0030299 | 3300035086 | Bacteria | 2115 |
| 215 | Ga0373954_0000426 | 3300035118 | Bacteria | 15702 |
| 216 | Ga0373956_0000807 | 3300035119 | Bacteria | 13039 |
| 217 | Ga0373956_0109069 | 3300035119 | Unclassified | 1288 |
| 218 | Ga0373955_0062569 | 3300035172 | Unclassified | 2058 |
| 219 | Ga0373955_0626509 | 3300035172 | Unclassified | 659 |
| 220 | Ga0373935_0021138 | 3300035692 | Bacteria | 3983 |
| 221 | Ga0373933_0049411 | 3300035724 | Bacteria | 2508 |
| 222 | Ga0373933_0069868 | 3300035724 | Unclassified | 2135 |
| 223 | Ga0373933_0223729 | 3300035724 | Unclassified | 1208 |
| 224 | Ga0373937_0430028 | 3300036401 | Unclassified | 1253 |
| 225 | Ga0395899_0303434 | 3300037312 | Unclassified | 1080 |
| 226 | Ga0395900_0002606 | 3300037418 | Bacteria | 19714 |
| 227 | Ga0395900_0195455 | 3300037418 | Bacteria | 2050 |
| 228 | Ga0436364_0009184 | 3300037853 | Bacteria | 1273 |
| 229 | Ga0436364_1216436 | 3300037853 | Unclassified | 564 |
| 230 | Ga0395901_0001031 | 3300038443 | Bacteria | 30174 |
| 231 | Ga0395901_0266873 | 3300038443 | Unclassified | 1781 |
| 232 | Ga0395901_0466372 | 3300038443 | Bacteria | 1290 |
| 233 | Ga0436365_0994555 | 3300039437 | Bacteria | 9705 |
| 234 | Ga0436365_1636125 | 3300039437 | Unclassified | 635 |
| 235 | Ga0436363_0577851 | 3300039450 | Bacteria | 969 |
| 236 | Ga0436363_0756724 | 3300039450 | Bacteria | 1679 |
| 237 | Ga0436363_0998545 | 3300039450 | Bacteria | 1648 |
| 238 | Ga0436362_0121625 | 3300039453 | Bacteria | 974 |
| 239 | Ga0436362_1155497 | 3300039453 | Bacteria | 513 |
| 240 | Ga0451839_1596977 | 3300041496 | Unclassified | 526 |
| 241 | Ga0451577_0010870 | 3300042876 | Bacteria | 8648 |
| 242 | Ga0451577_0024875 | 3300042876 | Bacteria | 5439 |
| 243 | Ga0451577_0027562 | 3300042876 | Bacteria | 5143 |
| 244 | Ga0451577_0815784 | 3300042876 | Viruses | 842 |
| 245 | Ga0453683_0075942 | 3300044673 | Bacteria | 2104 |
| 246 | Ga0453684_0004925 | 3300044712 | Bacteria | 27251 |
| 247 | Ga0453684_0032502 | 3300044712 | Bacteria | 7301 |
| 248 | Ga0453684_0085776 | 3300044712 | Bacteria | 3911 |
| 249 | Ga0453684_0146981 | 3300044712 | Bacteria | 2806 |
| 250 | Ga0453684_0479326 | 3300044712 | Bacteria | 1380 |
| 251 | Ga0453684_0849144 | 3300044712 | Unclassified | 981 |
| 252 | Ga0451576_0000067 | 3300045051 | Bacteria | 265145 |
| 253 | Ga0451576_0005229 | 3300045051 | Bacteria | 16389 |
| 254 | Ga0495592_0697140 | 3300046454 | Unclassified | 611 |
| 255 | Ga0495651_0001429 | 3300046462 | Bacteria | 18505 |
| 256 | Ga0495653_0218777 | 3300046463 | Unclassified | 1281 |
| 257 | Ga0495652_0014953 | 3300046529 | Bacteria | 6955 |
| 258 | Ga0495587_0001268 | 3300046536 | Bacteria | 16793 |
| 259 | Ga0495645_0000426 | 3300046543 | Bacteria | 28998 |
| 260 | Ga0495599_0000608 | 3300046678 | Bacteria | 20366 |
| 261 | Ga0495646_0053898 | 3300046680 | Bacteria | 2422 |
| 262 | Ga0495581_0332785 | 3300047315 | Unclassified | 887 |
| 263 | Ga0495684_0185550 | 3300047471 | Unclassified | 1540 |
| 264 | Ga0495602_0007546 | 3300048088 | Bacteria | 11378 |
| 265 | Ga0501299_162918 | 3300049522 | Unclassified | 571 |
| 266 | Ga0501033_0439601 | 3300049570 | Bacteria | 907 |
| 267 | Ga0501033_0795949 | 3300049570 | Unclassified | 639 |
| 268 | Ga0501034_0036307 | 3300049571 | Bacteria | 4993 |
| 269 | Ga0501034_0055791 | 3300049571 | Bacteria | 3976 |
| 270 | Ga0501034_0682047 | 3300049571 | Unclassified | 927 |
| 271 | Ga0501037_0939478 | 3300049573 | Unclassified | 565 |
| 272 | Ga0501038_0412555 | 3300049574 | Unclassified | 1043 |
| 273 | Ga0501038_0762237 | 3300049574 | Bacteria | 721 |
| 274 | Ga0501043_0415115 | 3300049579 | Bacteria | 1015 |
| 275 | Ga0501046_0012451 | 3300049580 | Bacteria | 7241 |
| 276 | Ga0501047_0628647 | 3300049581 | Bacteria | 894 |
| 277 | Ga0501068_0904570 | 3300049584 | Unclassified | 581 |
| 278 | Ga0501072_0979064 | 3300049588 | Unclassified | 660 |
| 279 | Ga0501075_0890763 | 3300049591 | Unclassified | 677 |
| 280 | Ga0501080_0000652 | 3300049742 | Bacteria | 27516 |
| 281 | Ga0501083_0000624 | 3300049744 | Bacteria | 22863 |
| 282 | Ga0501083_0032062 | 3300049744 | Unclassified | 3605 |
| 283 | Ga0501083_0384145 | 3300049744 | Unclassified | 913 |
| 284 | nmdc:mga05p37_421917_c1 | 3300050507 | Bacteria | 1552 |
| 285 | nmdc:mga09592_438910_c1 | 3300050508 | Bacteria | 1127 |
| 286 | nmdc:mga06r32_800541_c1 | 3300050510 | Unclassified | 903 |
| 287 | nmdc:mga0n895_20032_c1 | 3300050512 | Bacteria | 6229 |
| 288 | nmdc:mga0rr50_1034396_c1 | 3300050513 | Unclassified | 699 |
| 289 | nmdc:mga0rr50_1840083_c1 | 3300050513 | Unclassified | 509 |
| 290 | nmdc:mga08x19_6644_c1 | 3300050514 | Bacteria | 6861 |
| 291 | Ga0495612_0066774 | 3300053078 | Unclassified | 1495 |
| 292 | Ga0495595_0322349 | 3300053084 | Unclassified | 778 |
| 293 | Ga0500556_0032517 | 3300053104 | Bacteria | 1783 |
| 294 | Ga0500604_0082947 | 3300053151 | Bacteria | 1038 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031249 | Ga0265339_10064651 | Ga0265339_100646513 | 82 |
| 2 | 3300005549 | Ga0070704_101381730 | Ga0070704_1013817301 | 83 |
| 3 | 3300028800 | Ga0265338_10224812 | Ga0265338_102248122 | 83 |
| 4 | 3300031249 | Ga0265339_10363774 | Ga0265339_103637742 | 83 |
| 5 | 3300013307 | Ga0157372_12454957 | Ga0157372_124549572 | 93 |
| 6 | 3300049571 | Ga0501034_0036307 | Ga0501034_0036307_1212_1499 | 94 |
| 7 | 3300049573 | Ga0501037_0939478 | Ga0501037_0939478_180_467 | 94 |
| 8 | 3300049574 | Ga0501038_0412555 | Ga0501038_0412555_72_359 | 94 |
| 9 | 3300005468 | Ga0070707_100803718 | Ga0070707_1008037182 | 97 |
| 10 | 3300045051 | Ga0451576_0005229 | Ga0451576_0005229_15497_15790 | 97 |
| 11 | 3300005536 | Ga0070697_101981999 | Ga0070697_1019819991 | 98 |
| 12 | 3300009147 | Ga0114129_10133098 | Ga0114129_101330985 | 98 |
| 13 | 3300031242 | Ga0265329_10111070 | Ga0265329_101110702 | 98 |
| 14 | 3300031250 | Ga0265331_10024160 | Ga0265331_100241603 | 98 |
| 15 | 3300041496 | Ga0451839_1596977 | Ga0451839_1596977_108_497 | 98 |
| 16 | 3300042876 | Ga0451577_0815784 | Ga0451577_0815784_141_437 | 98 |
| 17 | 3300044673 | Ga0453683_0075942 | Ga0453683_0075942_1271_1567 | 98 |
| 18 | 3300044712 | Ga0453684_0004925 | Ga0453684_0004925_65_361 | 98 |
| 19 | 3300050507 | nmdc:mga05p37_421917_c1 | nmdc:mga05p37_421917_c1_1065_1364 | 98 |
| 20 | 3300013297 | Ga0157378_12743928 | Ga0157378_127439281 | 99 |
| 21 | 3300025924 | Ga0207694_10022291 | Ga0207694_100222918 | 99 |
| 22 | 3300049580 | Ga0501046_0012451 | Ga0501046_0012451_6668_6967 | 99 |
| 23 | 3300049581 | Ga0501047_0628647 | Ga0501047_0628647_483_785 | 99 |
| 24 | 3300049744 | Ga0501083_0000624 | Ga0501083_0000624_21060_21359 | 99 |
| 25 | 3300009093 | Ga0105240_11254875 | Ga0105240_112548751 | 100 |
| 26 | 3300009176 | Ga0105242_12551086 | Ga0105242_125510862 | 100 |
| 27 | 3300013307 | Ga0157372_11117806 | Ga0157372_111178062 | 100 |
| 28 | 3300025912 | Ga0207707_10209553 | Ga0207707_102095533 | 100 |
| 29 | 3300025913 | Ga0207695_11346649 | Ga0207695_113466491 | 100 |
| 30 | 3300025917 | Ga0207660_10022662 | Ga0207660_100226623 | 100 |
| 31 | 3300025921 | Ga0207652_10050300 | Ga0207652_100503006 | 100 |
| 32 | 3300028800 | Ga0265338_10030394 | Ga0265338_100303947 | 100 |
| 33 | 3300028800 | Ga0265338_10462000 | Ga0265338_104620003 | 100 |
| 34 | 3300042876 | Ga0451577_0024875 | Ga0451577_0024875_1500_1823 | 100 |
| 35 | 3300044712 | Ga0453684_0849144 | Ga0453684_0849144_41_343 | 100 |
| 36 | 3300049744 | Ga0501083_0032062 | Ga0501083_0032062_32_334 | 100 |
| 37 | 3300005336 | Ga0070680_100131605 | Ga0070680_1001316051 | 101 |
| 38 | 3300005340 | Ga0070689_100189241 | Ga0070689_1001892413 | 101 |
| 39 | 3300005436 | Ga0070713_100663220 | Ga0070713_1006632203 | 101 |
| 40 | 3300005439 | Ga0070711_100072796 | Ga0070711_1000727963 | 101 |
| 41 | 3300005440 | Ga0070705_100939997 | Ga0070705_1009399972 | 101 |
| 42 | 3300005441 | Ga0070700_100724694 | Ga0070700_1007246941 | 101 |
| 43 | 3300005468 | Ga0070707_100126476 | Ga0070707_1001264763 | 101 |
| 44 | 3300005545 | Ga0070695_100111032 | Ga0070695_1001110322 | 101 |
| 45 | 3300005548 | Ga0070665_101618664 | Ga0070665_1016186642 | 101 |
| 46 | 3300005563 | Ga0068855_100085381 | Ga0068855_1000853817 | 101 |
| 47 | 3300005614 | Ga0068856_100052425 | Ga0068856_1000524251 | 101 |
| 48 | 3300005614 | Ga0068856_100777450 | Ga0068856_1007774502 | 101 |
| 49 | 3300009551 | Ga0105238_10009271 | Ga0105238_100092718 | 101 |
| 50 | 3300014969 | Ga0157376_10890921 | Ga0157376_108909211 | 101 |
| 51 | 3300021388 | Ga0213875_10545217 | Ga0213875_105452171 | 101 |
| 52 | 3300025904 | Ga0207647_10000004 | Ga0207647_1000000469 | 101 |
| 53 | 3300025949 | Ga0207667_10000975 | Ga0207667_1000097523 | 101 |
| 54 | 3300026041 | Ga0207639_12200933 | Ga0207639_122009332 | 101 |
| 55 | 3300028379 | Ga0268266_10561355 | Ga0268266_105613551 | 101 |
| 56 | 3300028800 | Ga0265338_10401572 | Ga0265338_104015722 | 101 |
| 57 | 3300028800 | Ga0265338_10611993 | Ga0265338_106119932 | 101 |
| 58 | 3300028800 | Ga0265338_10726351 | Ga0265338_107263512 | 101 |
| 59 | 3300030733 | Ga0314311_1248726 | Ga0314311_12487262 | 101 |
| 60 | 3300031240 | Ga0265320_10016715 | Ga0265320_100167157 | 101 |
| 61 | 3300035086 | Ga0373934_0030299 | Ga0373934_0030299_1060_1371 | 101 |
| 62 | 3300035172 | Ga0373955_0062569 | Ga0373955_0062569_21_332 | 101 |
| 63 | 3300035692 | Ga0373935_0021138 | Ga0373935_0021138_3661_3966 | 101 |
| 64 | 3300035724 | Ga0373933_0069868 | Ga0373933_0069868_1729_2040 | 101 |
| 65 | 3300037312 | Ga0395899_0303434 | Ga0395899_0303434_602_907 | 101 |
| 66 | 3300037853 | Ga0436364_1216436 | Ga0436364_1216436_65_388 | 101 |
| 67 | 3300038443 | Ga0395901_0266873 | Ga0395901_0266873_392_697 | 101 |
| 68 | 3300039450 | Ga0436363_0577851 | Ga0436363_0577851_627_932 | 101 |
| 69 | 3300039453 | Ga0436362_1155497 | Ga0436362_1155497_128_433 | 101 |
| 70 | 3300042876 | Ga0451577_0010870 | Ga0451577_0010870_3599_3931 | 101 |
| 71 | 3300042876 | Ga0451577_0027562 | Ga0451577_0027562_1932_2237 | 101 |
| 72 | 3300044712 | Ga0453684_0146981 | Ga0453684_0146981_2218_2550 | 101 |
| 73 | 3300044712 | Ga0453684_0479326 | Ga0453684_0479326_364_669 | 101 |
| 74 | 3300046454 | Ga0495592_0697140 | Ga0495592_0697140_216_527 | 101 |
| 75 | 3300046462 | Ga0495651_0001429 | Ga0495651_0001429_4995_5306 | 101 |
| 76 | 3300046463 | Ga0495653_0218777 | Ga0495653_0218777_68_379 | 101 |
| 77 | 3300046529 | Ga0495652_0014953 | Ga0495652_0014953_1430_1741 | 101 |
| 78 | 3300046536 | Ga0495587_0001268 | Ga0495587_0001268_16137_16448 | 101 |
| 79 | 3300046543 | Ga0495645_0000426 | Ga0495645_0000426_3519_3830 | 101 |
| 80 | 3300046678 | Ga0495599_0000608 | Ga0495599_0000608_8026_8337 | 101 |
| 81 | 3300046680 | Ga0495646_0053898 | Ga0495646_0053898_1738_2049 | 101 |
| 82 | 3300047471 | Ga0495684_0185550 | Ga0495684_0185550_959_1270 | 101 |
| 83 | 3300048088 | Ga0495602_0007546 | Ga0495602_0007546_1397_1708 | 101 |
| 84 | 3300049571 | Ga0501034_0055791 | Ga0501034_0055791_656_961 | 101 |
| 85 | 3300049742 | Ga0501080_0000652 | Ga0501080_0000652_21684_21989 | 101 |
| 86 | 3300050510 | nmdc:mga06r32_800541_c1 | nmdc:mga06r32_800541_c1_474_779 | 101 |
| 87 | 3300050512 | nmdc:mga0n895_20032_c1 | nmdc:mga0n895_20032_c1_2010_2336 | 101 |
| 88 | 3300053084 | Ga0495595_0322349 | Ga0495595_0322349_229_540 | 101 |
| 89 | 3300053104 | Ga0500556_0032517 | Ga0500556_0032517_850_1155 | 101 |
| 90 | 3300003214 | JGI25165J46597_1000013 | JGI25165J46597_1000013288 | 102 |
| 91 | 3300003323 | rootH1_10246200 | rootH1_102462004 | 102 |
| 92 | 3300005329 | Ga0070683_100000544 | Ga0070683_1000005449 | 102 |
| 93 | 3300005330 | Ga0070690_100142685 | Ga0070690_1001426854 | 102 |
| 94 | 3300005331 | Ga0070670_100365984 | Ga0070670_1003659842 | 102 |
| 95 | 3300005336 | Ga0070680_100720567 | Ga0070680_1007205672 | 102 |
| 96 | 3300005445 | Ga0070708_102073507 | Ga0070708_1020735072 | 102 |
| 97 | 3300005458 | Ga0070681_10006464 | Ga0070681_100064646 | 102 |
| 98 | 3300005458 | Ga0070681_10375086 | Ga0070681_103750862 | 102 |
| 99 | 3300005458 | Ga0070681_10402341 | Ga0070681_104023412 | 102 |
| 100 | 3300005544 | Ga0070686_100088264 | Ga0070686_1000882641 | 102 |
| 101 | 3300005544 | Ga0070686_100105450 | Ga0070686_1001054502 | 102 |
| 102 | 3300005563 | Ga0068855_101259879 | Ga0068855_1012598792 | 102 |
| 103 | 3300005564 | Ga0070664_100193309 | Ga0070664_1001933093 | 102 |
| 104 | 3300005843 | Ga0068860_100233096 | Ga0068860_1002330963 | 102 |
| 105 | 3300005844 | Ga0068862_100010808 | Ga0068862_1000108087 | 102 |
| 106 | 3300009093 | Ga0105240_10111451 | Ga0105240_101114512 | 102 |
| 107 | 3300009093 | Ga0105240_10248592 | Ga0105240_102485922 | 102 |
| 108 | 3300009093 | Ga0105240_10493250 | Ga0105240_104932503 | 102 |
| 109 | 3300009174 | Ga0105241_11267263 | Ga0105241_112672631 | 102 |
| 110 | 3300009551 | Ga0105238_11301999 | Ga0105238_113019991 | 102 |
| 111 | 3300010375 | Ga0105239_10011818 | Ga0105239_100118188 | 102 |
| 112 | 3300010375 | Ga0105239_10841255 | Ga0105239_108412551 | 102 |
| 113 | 3300011119 | Ga0105246_10180928 | Ga0105246_101809282 | 102 |
| 114 | 3300013105 | Ga0157369_10105224 | Ga0157369_101052243 | 102 |
| 115 | 3300013296 | Ga0157374_10013652 | Ga0157374_100136525 | 102 |
| 116 | 3300014325 | Ga0163163_12699511 | Ga0163163_126995112 | 102 |
| 117 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013536 | 102 |
| 118 | 3300025912 | Ga0207707_10869004 | Ga0207707_108690042 | 102 |
| 119 | 3300025913 | Ga0207695_10083665 | Ga0207695_100836654 | 102 |
| 120 | 3300025913 | Ga0207695_10253928 | Ga0207695_102539282 | 102 |
| 121 | 3300025925 | Ga0207650_10782256 | Ga0207650_107822562 | 102 |
| 122 | 3300025944 | Ga0207661_10000163 | Ga0207661_1000016326 | 102 |
| 123 | 3300025949 | Ga0207667_11297870 | Ga0207667_112978702 | 102 |
| 124 | 3300025961 | Ga0207712_10824633 | Ga0207712_108246331 | 102 |
| 125 | 3300025986 | Ga0207658_11571625 | Ga0207658_115716251 | 102 |
| 126 | 3300026023 | Ga0207677_10991446 | Ga0207677_109914462 | 102 |
| 127 | 3300026041 | Ga0207639_11085456 | Ga0207639_110854561 | 102 |
| 128 | 3300027695 | Ga0209966_1000307 | Ga0209966_100030717 | 102 |
| 129 | 3300028379 | Ga0268266_10027347 | Ga0268266_100273472 | 102 |
| 130 | 3300028556 | Ga0265337_1000274 | Ga0265337_100027425 | 102 |
| 131 | 3300028558 | Ga0265326_10000050 | Ga0265326_100000503 | 102 |
| 132 | 3300028573 | Ga0265334_10000472 | Ga0265334_1000047218 | 102 |
| 133 | 3300028573 | Ga0265334_10045717 | Ga0265334_100457172 | 102 |
| 134 | 3300028577 | Ga0265318_10096835 | Ga0265318_100968352 | 102 |
| 135 | 3300028654 | Ga0265322_10024963 | Ga0265322_100249633 | 102 |
| 136 | 3300028654 | Ga0265322_10069721 | Ga0265322_100697211 | 102 |
| 137 | 3300028666 | Ga0265336_10000020 | Ga0265336_10000020138 | 102 |
| 138 | 3300028800 | Ga0265338_10000093 | Ga0265338_10000093117 | 102 |
| 139 | 3300029957 | Ga0265324_10002131 | Ga0265324_1000213112 | 102 |
| 140 | 3300031240 | Ga0265320_10092471 | Ga0265320_100924712 | 102 |
| 141 | 3300031241 | Ga0265325_10006375 | Ga0265325_100063753 | 102 |
| 142 | 3300031251 | Ga0265327_10010105 | Ga0265327_100101055 | 102 |
| 143 | 3300031344 | Ga0265316_10069003 | Ga0265316_100690032 | 102 |
| 144 | 3300031595 | Ga0265313_10104938 | Ga0265313_101049382 | 102 |
| 145 | 3300031711 | Ga0265314_10050321 | Ga0265314_100503216 | 102 |
| 146 | 3300037418 | Ga0395900_0002606 | Ga0395900_0002606_4422_4730 | 102 |
| 147 | 3300037418 | Ga0395900_0195455 | Ga0395900_0195455_525_872 | 102 |
| 148 | 3300038443 | Ga0395901_0466372 | Ga0395901_0466372_67_375 | 102 |
| 149 | 3300039450 | Ga0436363_0756724 | Ga0436363_0756724_220_546 | 102 |
| 150 | 3300044712 | Ga0453684_0032502 | Ga0453684_0032502_2881_3189 | 102 |
| 151 | 3300044712 | Ga0453684_0085776 | Ga0453684_0085776_2573_2881 | 102 |
| 152 | 3300045051 | Ga0451576_0000067 | Ga0451576_0000067_41583_41891 | 102 |
| 153 | 3300049574 | Ga0501038_0762237 | Ga0501038_0762237_13_321 | 102 |
| 154 | 3300050513 | nmdc:mga0rr50_1840083_c1 | nmdc:mga0rr50_1840083_c1_27_335 | 102 |
| 155 | 3300005295 | Ga0065707_10773418 | Ga0065707_107734181 | 103 |
| 156 | 3300005327 | Ga0070658_11593357 | Ga0070658_115933572 | 103 |
| 157 | 3300005331 | Ga0070670_101718335 | Ga0070670_1017183351 | 103 |
| 158 | 3300005334 | Ga0068869_100000137 | Ga0068869_10000013725 | 103 |
| 159 | 3300005355 | Ga0070671_100512828 | Ga0070671_1005128282 | 103 |
| 160 | 3300005364 | Ga0070673_102273239 | Ga0070673_1022732391 | 103 |
| 161 | 3300005445 | Ga0070708_100000451 | Ga0070708_10000045111 | 103 |
| 162 | 3300005467 | Ga0070706_100000132 | Ga0070706_10000013294 | 103 |
| 163 | 3300005467 | Ga0070706_100996848 | Ga0070706_1009968481 | 103 |
| 164 | 3300005468 | Ga0070707_100253945 | Ga0070707_1002539452 | 103 |
| 165 | 3300005468 | Ga0070707_102078722 | Ga0070707_1020787222 | 103 |
| 166 | 3300005471 | Ga0070698_100766141 | Ga0070698_1007661411 | 103 |
| 167 | 3300005471 | Ga0070698_100909820 | Ga0070698_1009098202 | 103 |
| 168 | 3300005518 | Ga0070699_100050543 | Ga0070699_1000505433 | 103 |
| 169 | 3300005518 | Ga0070699_100868653 | Ga0070699_1008686531 | 103 |
| 170 | 3300005530 | Ga0070679_101769673 | Ga0070679_1017696731 | 103 |
| 171 | 3300005536 | Ga0070697_100048653 | Ga0070697_1000486535 | 103 |
| 172 | 3300005548 | Ga0070665_100229905 | Ga0070665_1002299052 | 103 |
| 173 | 3300005548 | Ga0070665_100485015 | Ga0070665_1004850151 | 103 |
| 174 | 3300005563 | Ga0068855_100347548 | Ga0068855_1003475482 | 103 |
| 175 | 3300005563 | Ga0068855_101862158 | Ga0068855_1018621582 | 103 |
| 176 | 3300005617 | Ga0068859_102341890 | Ga0068859_1023418901 | 103 |
| 177 | 3300005841 | Ga0068863_102018988 | Ga0068863_1020189882 | 103 |
| 178 | 3300006028 | Ga0070717_10000882 | Ga0070717_100008828 | 103 |
| 179 | 3300006358 | Ga0068871_101719425 | Ga0068871_1017194252 | 103 |
| 180 | 3300006844 | Ga0075428_101326463 | Ga0075428_1013264632 | 103 |
| 181 | 3300006880 | Ga0075429_100450659 | Ga0075429_1004506592 | 103 |
| 182 | 3300006931 | Ga0097620_102341619 | Ga0097620_1023416192 | 103 |
| 183 | 3300009093 | Ga0105240_10024231 | Ga0105240_100242313 | 103 |
| 184 | 3300009093 | Ga0105240_10144670 | Ga0105240_101446706 | 103 |
| 185 | 3300009093 | Ga0105240_10708966 | Ga0105240_107089662 | 103 |
| 186 | 3300009098 | Ga0105245_12824824 | Ga0105245_128248241 | 103 |
| 187 | 3300009148 | Ga0105243_10344009 | Ga0105243_103440091 | 103 |
| 188 | 3300009174 | Ga0105241_10205149 | Ga0105241_102051494 | 103 |
| 189 | 3300009174 | Ga0105241_10360351 | Ga0105241_103603513 | 103 |
| 190 | 3300009174 | Ga0105241_11896343 | Ga0105241_118963432 | 103 |
| 191 | 3300009545 | Ga0105237_10755789 | Ga0105237_107557891 | 103 |
| 192 | 3300009551 | Ga0105238_10845252 | Ga0105238_108452521 | 103 |
| 193 | 3300009553 | Ga0105249_10278094 | Ga0105249_102780942 | 103 |
| 194 | 3300010375 | Ga0105239_12068978 | Ga0105239_120689782 | 103 |
| 195 | 3300010375 | Ga0105239_12290054 | Ga0105239_122900541 | 103 |
| 196 | 3300013100 | Ga0157373_10066770 | Ga0157373_100667703 | 103 |
| 197 | 3300013297 | Ga0157378_12457291 | Ga0157378_124572911 | 103 |
| 198 | 3300013307 | Ga0157372_12907464 | Ga0157372_129074641 | 103 |
| 199 | 3300014325 | Ga0163163_10006016 | Ga0163163_1000601611 | 103 |
| 200 | 3300014325 | Ga0163163_10139599 | Ga0163163_101395991 | 103 |
| 201 | 3300014325 | Ga0163163_11576582 | Ga0163163_115765821 | 103 |
| 202 | 3300014745 | Ga0157377_10575939 | Ga0157377_105759391 | 103 |
| 203 | 3300021384 | Ga0213876_10007202 | Ga0213876_100072023 | 103 |
| 204 | 3300025909 | Ga0207705_11240982 | Ga0207705_112409822 | 103 |
| 205 | 3300025910 | Ga0207684_10000244 | Ga0207684_1000024431 | 103 |
| 206 | 3300025912 | Ga0207707_11533203 | Ga0207707_115332031 | 103 |
| 207 | 3300025913 | Ga0207695_10019297 | Ga0207695_100192978 | 103 |
| 208 | 3300025913 | Ga0207695_10379493 | Ga0207695_103794932 | 103 |
| 209 | 3300025914 | Ga0207671_10439258 | Ga0207671_104392582 | 103 |
| 210 | 3300025914 | Ga0207671_10471464 | Ga0207671_104714642 | 103 |
| 211 | 3300025914 | Ga0207671_11461032 | Ga0207671_114610321 | 103 |
| 212 | 3300025921 | Ga0207652_11383880 | Ga0207652_113838801 | 103 |
| 213 | 3300025922 | Ga0207646_10021254 | Ga0207646_100212547 | 103 |
| 214 | 3300025922 | Ga0207646_10730326 | Ga0207646_107303262 | 103 |
| 215 | 3300025925 | Ga0207650_10537473 | Ga0207650_105374732 | 103 |
| 216 | 3300025936 | Ga0207670_10403002 | Ga0207670_104030022 | 103 |
| 217 | 3300025942 | Ga0207689_10015621 | Ga0207689_100156218 | 103 |
| 218 | 3300025949 | Ga0207667_10133026 | Ga0207667_101330264 | 103 |
| 219 | 3300025949 | Ga0207667_11456134 | Ga0207667_114561342 | 103 |
| 220 | 3300025960 | Ga0207651_11624730 | Ga0207651_116247301 | 103 |
| 221 | 3300025961 | Ga0207712_10815146 | Ga0207712_108151461 | 103 |
| 222 | 3300025986 | Ga0207658_11105534 | Ga0207658_111055342 | 103 |
| 223 | 3300026035 | Ga0207703_10055429 | Ga0207703_100554293 | 103 |
| 224 | 3300026041 | Ga0207639_10251155 | Ga0207639_102511551 | 103 |
| 225 | 3300026116 | Ga0207674_11123494 | Ga0207674_111234941 | 103 |
| 226 | 3300028379 | Ga0268266_10257054 | Ga0268266_102570541 | 103 |
| 227 | 3300028380 | Ga0268265_10876906 | Ga0268265_108769062 | 103 |
| 228 | 3300028577 | Ga0265318_10008904 | Ga0265318_100089045 | 103 |
| 229 | 3300028577 | Ga0265318_10257214 | Ga0265318_102572141 | 103 |
| 230 | 3300028653 | Ga0265323_10163342 | Ga0265323_101633421 | 103 |
| 231 | 3300031595 | Ga0265313_10017432 | Ga0265313_100174324 | 103 |
| 232 | 3300031711 | Ga0265314_10033941 | Ga0265314_100339415 | 103 |
| 233 | 3300031911 | Ga0307412_10920122 | Ga0307412_109201221 | 103 |
| 234 | 3300032002 | Ga0307416_100996860 | Ga0307416_1009968602 | 103 |
| 235 | 3300037853 | Ga0436364_0009184 | Ga0436364_0009184_565_894 | 103 |
| 236 | 3300038443 | Ga0395901_0001031 | Ga0395901_0001031_28260_28571 | 103 |
| 237 | 3300039437 | Ga0436365_0994555 | Ga0436365_0994555_2989_3336 | 103 |
| 238 | 3300039450 | Ga0436363_0998545 | Ga0436363_0998545_712_1053 | 103 |
| 239 | 3300039453 | Ga0436362_0121625 | Ga0436362_0121625_414_743 | 103 |
| 240 | 3300049522 | Ga0501299_162918 | Ga0501299_162918_72_386 | 103 |
| 241 | 3300049570 | Ga0501033_0439601 | Ga0501033_0439601_347_661 | 103 |
| 242 | 3300049570 | Ga0501033_0795949 | Ga0501033_0795949_294_608 | 103 |
| 243 | 3300049579 | Ga0501043_0415115 | Ga0501043_0415115_208_522 | 103 |
| 244 | 3300049588 | Ga0501072_0979064 | Ga0501072_0979064_225_539 | 103 |
| 245 | 3300049591 | Ga0501075_0890763 | Ga0501075_0890763_309_623 | 103 |
| 246 | 3300049744 | Ga0501083_0384145 | Ga0501083_0384145_79_390 | 103 |
| 247 | 3300050508 | nmdc:mga09592_438910_c1 | nmdc:mga09592_438910_c1_407_718 | 103 |
| 248 | 3300053151 | Ga0500604_0082947 | Ga0500604_0082947_462_773 | 103 |
| 249 | 3300003323 | rootH1_10090752 | rootH1_100907522 | 104 |
| 250 | 3300005434 | Ga0070709_10186956 | Ga0070709_101869562 | 104 |
| 251 | 3300005434 | Ga0070709_11004272 | Ga0070709_110042721 | 104 |
| 252 | 3300005436 | Ga0070713_100426903 | Ga0070713_1004269031 | 104 |
| 253 | 3300005445 | Ga0070708_100032367 | Ga0070708_1000323672 | 104 |
| 254 | 3300005445 | Ga0070708_100292812 | Ga0070708_1002928123 | 104 |
| 255 | 3300005455 | Ga0070663_101645088 | Ga0070663_1016450881 | 104 |
| 256 | 3300005467 | Ga0070706_100002210 | Ga0070706_1000022107 | 104 |
| 257 | 3300005467 | Ga0070706_100733852 | Ga0070706_1007338522 | 104 |
| 258 | 3300005535 | Ga0070684_100548858 | Ga0070684_1005488581 | 104 |
| 259 | 3300005536 | Ga0070697_100165908 | Ga0070697_1001659082 | 104 |
| 260 | 3300005536 | Ga0070697_100792178 | Ga0070697_1007921781 | 104 |
| 261 | 3300005544 | Ga0070686_100197849 | Ga0070686_1001978491 | 104 |
| 262 | 3300006028 | Ga0070717_10124204 | Ga0070717_101242043 | 104 |
| 263 | 3300006173 | Ga0070716_100676292 | Ga0070716_1006762922 | 104 |
| 264 | 3300006175 | Ga0070712_101173411 | Ga0070712_1011734111 | 104 |
| 265 | 3300006914 | Ga0075436_100013421 | Ga0075436_1000134215 | 104 |
| 266 | 3300007076 | Ga0075435_101225895 | Ga0075435_1012258952 | 104 |
| 267 | 3300007788 | Ga0099795_10188346 | Ga0099795_101883462 | 104 |
| 268 | 3300025261 | Ga0209233_1004477 | Ga0209233_10044776 | 104 |
| 269 | 3300025898 | Ga0207692_10206498 | Ga0207692_102064982 | 104 |
| 270 | 3300025910 | Ga0207684_10000643 | Ga0207684_1000064341 | 104 |
| 271 | 3300025910 | Ga0207684_10252192 | Ga0207684_102521922 | 104 |
| 272 | 3300025910 | Ga0207684_11041042 | Ga0207684_110410422 | 104 |
| 273 | 3300025915 | Ga0207693_10133481 | Ga0207693_101334811 | 104 |
| 274 | 3300025939 | Ga0207665_10153270 | Ga0207665_101532702 | 104 |
| 275 | 3300025949 | Ga0207667_11109775 | Ga0207667_111097752 | 104 |
| 276 | 3300028558 | Ga0265326_10036762 | Ga0265326_100367622 | 104 |
| 277 | 3300031344 | Ga0265316_10000097 | Ga0265316_1000009781 | 104 |
| 278 | 3300034820 | Ga0373959_0000001 | Ga0373959_0000001_101715_102035 | 104 |
| 279 | 3300035118 | Ga0373954_0000426 | Ga0373954_0000426_9159_9473 | 104 |
| 280 | 3300035119 | Ga0373956_0000807 | Ga0373956_0000807_9122_9436 | 104 |
| 281 | 3300035119 | Ga0373956_0109069 | Ga0373956_0109069_591_911 | 104 |
| 282 | 3300035172 | Ga0373955_0626509 | Ga0373955_0626509_235_549 | 104 |
| 283 | 3300035724 | Ga0373933_0049411 | Ga0373933_0049411_307_621 | 104 |
| 284 | 3300035724 | Ga0373933_0223729 | Ga0373933_0223729_71_391 | 104 |
| 285 | 3300036401 | Ga0373937_0430028 | Ga0373937_0430028_149_463 | 104 |
| 286 | 3300039437 | Ga0436365_1636125 | Ga0436365_1636125_56_379 | 104 |
| 287 | 3300047315 | Ga0495581_0332785 | Ga0495581_0332785_307_627 | 104 |
| 288 | 3300049571 | Ga0501034_0682047 | Ga0501034_0682047_67_381 | 104 |
| 289 | 3300049584 | Ga0501068_0904570 | Ga0501068_0904570_143_457 | 104 |
| 290 | 3300050513 | nmdc:mga0rr50_1034396_c1 | nmdc:mga0rr50_1034396_c1_182_505 | 104 |
| 291 | 3300050514 | nmdc:mga08x19_6644_c1 | nmdc:mga08x19_6644_c1_3298_3612 | 104 |
| 292 | 3300053078 | Ga0495612_0066774 | Ga0495612_0066774_1107_1421 | 104 |
| 293 | 3300002067 | JGI24735J21928_10000115 | JGI24735J21928_1000011521 | 105 |
| 294 | 3300028666 | Ga0265336_10230573 | Ga0265336_102305731 | 105 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7w76-assembly2.cif.gz_F | crystal structure of the k. lactis bre1 rbd in complex with rad6, crystal form ii | 0.4818 | 17 | 69 |
| 6qaj-assembly1.cif.gz_A | structure of the tripartite motif of kap1/trim28 | 0.438 | 17 | 71 |
| 7z34-assembly1.cif.gz_b | structure of pre-60s particle bound to drg1(afg2). | 0.4352 | 15 | 97 |
| 5t1a-assembly1.cif.gz_A | structure of cc chemokine receptor 2 with orthosteric and allosteric antagonists | 0.4302 | 17 | 70 |
| 6a9j-assembly1.cif.gz_A | crystal structure of the pe-bound n-terminal domain of atg2 | 0.423 | 17 | 71 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FW95_606_682_1.20.58.90 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.5774 | 16 | 69 | 1.20.58.90 |
| af_Q2FXH4_657_733_1.20.58.90 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.556 | 18 | 74 | 1.20.58.90 |
| af_A0A1D6E4R1_1_104_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.5494 | 14 | 69 | 1.25.10.10 |
| af_Q2FXH4_1735_1811_1.10.8.10 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.5418 | 16 | 69 | 1.10.8.10 |
| af_Q2FW95_1530_1606_1.20.5.420 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C | 0.5405 | 17 | 74 | 1.20.5.420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4MCE8-F1-model_v4 | Bacteriocin-protection protein | 0.9753 | 14 | 69 |
|
| AF-A0A535WYN3-F1-model_v4 | DUF1905 domain-containing protein | 0.9725 | 12 | 67 |
|
| AF-A0A6L4A4V5-F1-model_v4 | deleted | 0.9716 | 3 | 67 |
|
| AF-A0A537ILI1-F1-model_v4 | Bacteriocin-protection protein | 0.971 | 13 | 69 |
|
| AF-A0A419GXD7-F1-model_v4 | Bacteriocin-protection protein | 0.9699 | 14 | 70 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar