F391786

General Info

Members Datasets Scaffolds Average Seq Length
293 193 586 157

Family's Representative Sequence

Representative Sequence 3300053103|Ga0500555_024059|Ga0500555_024059_1166_1705
Length 179
Sequence MASSAAHGHVEQHRKRKVEEAMYKSPSHLPEDTRVAVSNQLNARLADGLDLHSQIKVAHWNIKGPQFAALHPLFETFAVSLAAFNDSIAERAVTLGARAYGTIRHVAKASTLPDYPQDTSRDLEHVKLLAERFERYLDGVRESRSTGEKLGDADTVDLFTRIVTEFEKNAWFLRASLDS

Samples

Sample ID Description Type Environment
1 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
129 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
146 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
166 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
167 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
168 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
169 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
170 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
171 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
172 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
173 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.05
Nodule 0
Rhizoplane 3.07
Rhizosphere 92.83
Stem 0
Stem Tuber 0
Unclassified 4.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500555_024059 3300053103 Bacteria 1746
2 rootH2_10138333 3300003320 Bacteria 1453
3 rootH1_10098632 3300003323 Bacteria 2604
4 Ga0065715_10702512 3300005293 Bacteria 652
5 Ga0065707_10807721 3300005295 Bacteria 597
6 Ga0070676_10070268 3300005328 Bacteria 2100
7 Ga0070690_100051108 3300005330 Bacteria 2638
8 Ga0070690_100099330 3300005330 Bacteria 1928
9 Ga0070670_100005768 3300005331 Bacteria 10464
10 Ga0068869_100435136 3300005334 Bacteria 1085
11 Ga0068869_100442239 3300005334 Bacteria 1076
12 Ga0070666_10073198 3300005335 Bacteria 2334
13 Ga0070680_100967618 3300005336 Bacteria 735
14 Ga0070682_100001029 3300005337 Bacteria 16109
15 Ga0070682_100002689 3300005337 Bacteria 9833
16 Ga0070682_100094239 3300005337 Unclassified 1964
17 Ga0070682_100311271 3300005337 Bacteria 1159
18 Ga0070689_100016188 3300005340 Bacteria 5453
19 Ga0070689_100038307 3300005340 Bacteria 3667
20 Ga0070689_100149838 3300005340 Bacteria 1881
21 Ga0070689_100348255 3300005340 Bacteria 1242
22 Ga0070689_100450566 3300005340 Bacteria 1095
23 Ga0070687_100286705 3300005343 Bacteria 1039
24 Ga0070692_10358030 3300005345 Bacteria 909
25 Ga0070668_100023445 3300005347 Bacteria 4668
26 Ga0070669_100080231 3300005353 Bacteria 2428
27 Ga0070669_101095127 3300005353 Bacteria 686
28 Ga0070675_100743251 3300005354 Bacteria 895
29 Ga0070671_100456058 3300005355 Bacteria 1097
30 Ga0070671_100652776 3300005355 Bacteria 911
31 Ga0070674_100032507 3300005356 Bacteria 3465
32 Ga0070673_100008808 3300005364 Bacteria 6737
33 Ga0070673_100019245 3300005364 Bacteria 4900
34 Ga0070673_100202618 3300005364 Bacteria 1709
35 Ga0070673_100343544 3300005364 Bacteria 1323
36 Ga0070673_100568448 3300005364 Bacteria 1031
37 Ga0070688_100005642 3300005365 Bacteria 6606
38 Ga0070688_100007503 3300005365 Bacteria 5883
39 Ga0070688_100093759 3300005365 Bacteria 1967
40 Ga0070688_100107923 3300005365 Bacteria 1846
41 Ga0070667_100085144 3300005367 Bacteria 2711
42 Ga0070701_10010210 3300005438 Bacteria 4143
43 Ga0070701_10498763 3300005438 Bacteria 790
44 Ga0070700_100001035 3300005441 Bacteria 13758
45 Ga0070694_100170808 3300005444 Bacteria 1602
46 Ga0070694_100605303 3300005444 Bacteria 883
47 Ga0070694_100716447 3300005444 Bacteria 815
48 Ga0070708_100087900 3300005445 Bacteria 2825
49 Ga0070678_100451360 3300005456 Bacteria 1126
50 Ga0070678_100912350 3300005456 Bacteria 804
51 Ga0070681_10216616 3300005458 Bacteria 1830
52 Ga0070681_11335766 3300005458 Bacteria 640
53 Ga0068867_100012757 3300005459 Bacteria 5946
54 Ga0068867_100395523 3300005459 Bacteria 1164
55 Ga0070685_10310656 3300005466 Bacteria 1065
56 Ga0070706_100085989 3300005467 Bacteria 2914
57 Ga0070707_101027050 3300005468 Unclassified 790
58 Ga0070707_101350669 3300005468 Bacteria 679
59 Ga0070698_100030639 3300005471 Bacteria 5577
60 Ga0070679_100004321 3300005530 Bacteria 13119
61 Ga0070679_100116498 3300005530 Bacteria 2656
62 Ga0070684_100456063 3300005535 Bacteria 1182
63 Ga0070672_100013459 3300005543 Bacteria 5778
64 Ga0070672_100018943 3300005543 Bacteria 4987
65 Ga0070672_100039929 3300005543 Bacteria 3598
66 Ga0070672_100078379 3300005543 Bacteria 2643
67 Ga0070686_100002095 3300005544 Bacteria 11003
68 Ga0070695_100028289 3300005545 Bacteria 3478
69 Ga0070695_100124065 3300005545 Bacteria 1771
70 Ga0070693_101123631 3300005547 Bacteria 600
71 Ga0070704_100011638 3300005549 Bacteria 5401
72 Ga0070704_101006625 3300005549 Bacteria 754
73 Ga0070704_101516049 3300005549 Bacteria 617
74 Ga0068854_100357717 3300005578 Bacteria 1197
75 Ga0070702_101291150 3300005615 Bacteria 592
76 Ga0068852_100439923 3300005616 Bacteria 1289
77 Ga0068859_100107183 3300005617 Bacteria 2854
78 Ga0068859_100360517 3300005617 Bacteria 1549
79 Ga0068864_100622485 3300005618 Bacteria 1049
80 Ga0068864_101290212 3300005618 Bacteria 730
81 Ga0068866_10086088 3300005718 Bacteria 1700
82 Ga0068866_10215057 3300005718 Bacteria 1156
83 Ga0068861_100278103 3300005719 Bacteria 1440
84 Ga0068870_10206820 3300005840 Bacteria 1193
85 Ga0068863_100032616 3300005841 Bacteria 4963
86 Ga0068863_101190616 3300005841 Bacteria 768
87 Ga0068863_101245868 3300005841 Bacteria 750
88 Ga0068858_100312106 3300005842 Bacteria 1502
89 Ga0068860_101941598 3300005843 Bacteria 610
90 Ga0068862_100037882 3300005844 Bacteria 4088
91 Ga0068862_101358353 3300005844 Bacteria 713
92 Ga0075366_10144299 3300006195 Bacteria 1440
93 Ga0075366_10382719 3300006195 Bacteria 865
94 Ga0068871_100267697 3300006358 Bacteria 1492
95 Ga0068871_101322509 3300006358 Bacteria 678
96 Ga0075428_100000589 3300006844 Bacteria 37083
97 Ga0075428_100019299 3300006844 Bacteria 7546
98 Ga0075428_100540233 3300006844 Bacteria 1246
99 Ga0075428_100609410 3300006844 Bacteria 1166
100 Ga0075430_100206031 3300006846 Bacteria 1632
101 Ga0075430_100421896 3300006846 Bacteria 1101
102 Ga0075430_100467346 3300006846 Bacteria 1041
103 Ga0075431_100304328 3300006847 Bacteria 1610
104 Ga0075433_10037798 3300006852 Bacteria 4166
105 Ga0075433_10048933 3300006852 Bacteria 3677
106 Ga0075434_100003402 3300006871 Bacteria 14241
107 Ga0075429_100015491 3300006880 Bacteria 6607
108 Ga0075429_100130947 3300006880 Bacteria 2194
109 Ga0075429_100363053 3300006880 Bacteria 1268
110 Ga0075429_101287964 3300006880 Bacteria 637
111 Ga0068865_100001623 3300006881 Bacteria 13178
112 Ga0097620_100107187 3300006931 Bacteria 2854
113 Ga0097620_100360538 3300006931 Bacteria 1549
114 Ga0075435_100008415 3300007076 Bacteria 7400
115 Ga0075435_100814271 3300007076 Unclassified 813
116 Ga0111539_10002320 3300009094 Bacteria 25331
117 Ga0111539_10010826 3300009094 Bacteria 11484
118 Ga0105245_10727786 3300009098 Bacteria 1027
119 Ga0105245_10998020 3300009098 Bacteria 881
120 Ga0114129_10610681 3300009147 Bacteria 1412
121 Ga0114129_12200948 3300009147 Bacteria 663
122 Ga0105243_11874145 3300009148 Bacteria 632
123 Ga0105242_10788326 3300009176 Bacteria 939
124 Ga0105242_12613691 3300009176 Bacteria 554
125 Ga0157378_10049823 3300013297 Bacteria 3726
126 Ga0163162_10760261 3300013306 Bacteria 1088
127 Ga0157375_11297622 3300013308 Bacteria 856
128 Ga0157380_10227162 3300014326 Bacteria 1674
129 Ga0157380_10499434 3300014326 Bacteria 1181
130 Ga0157377_10540027 3300014745 Bacteria 822
131 Ga0157376_10278773 3300014969 Bacteria 1574
132 Ga0207653_10329007 3300025885 Unclassified 595
133 Ga0207682_10085442 3300025893 Bacteria 1359
134 Ga0207642_10040874 3300025899 Bacteria 2027
135 Ga0207642_10174610 3300025899 Bacteria 1165
136 Ga0207645_10013788 3300025907 Bacteria 5423
137 Ga0207645_10113053 3300025907 Bacteria 1759
138 Ga0207643_10101030 3300025908 Bacteria 1691
139 Ga0207643_10527718 3300025908 Bacteria 756
140 Ga0207684_10866706 3300025910 Bacteria 760
141 Ga0207684_10936963 3300025910 Bacteria 727
142 Ga0207707_10057485 3300025912 Bacteria 3385
143 Ga0207707_10859271 3300025912 Bacteria 752
144 Ga0207660_10084082 3300025917 Bacteria 2345
145 Ga0207662_10060707 3300025918 Bacteria 2268
146 Ga0207662_10072464 3300025918 Bacteria 2088
147 Ga0207657_10333461 3300025919 Bacteria 1198
148 Ga0207652_10013396 3300025921 Bacteria 6636
149 Ga0207652_10702667 3300025921 Bacteria 902
150 Ga0207646_11724762 3300025922 Bacteria 537
151 Ga0207681_10000136 3300025923 Bacteria 60437
152 Ga0207650_11568625 3300025925 Bacteria 559
153 Ga0207659_10120554 3300025926 Bacteria 2009
154 Ga0207687_10213956 3300025927 Bacteria 1514
155 Ga0207644_10514852 3300025931 Bacteria 988
156 Ga0207670_10009282 3300025936 Bacteria 5604
157 Ga0207670_10220006 3300025936 Bacteria 1453
158 Ga0207669_10005997 3300025937 Bacteria 5510
159 Ga0207669_10886794 3300025937 Bacteria 744
160 Ga0207704_10001232 3300025938 Bacteria 11392
161 Ga0207691_10008372 3300025940 Bacteria 9938
162 Ga0207691_10022892 3300025940 Bacteria 5889
163 Ga0207691_10023522 3300025940 Bacteria 5802
164 Ga0207691_10479874 3300025940 Bacteria 1057
165 Ga0207689_10125755 3300025942 Bacteria 2109
166 Ga0207689_10126146 3300025942 Bacteria 2105
167 Ga0207689_10396596 3300025942 Bacteria 1150
168 Ga0207661_10735647 3300025944 Bacteria 908
169 Ga0207667_10286469 3300025949 Bacteria 1683
170 Ga0207651_10002119 3300025960 Bacteria 9365
171 Ga0207651_10041382 3300025960 Bacteria 3058
172 Ga0207651_10380834 3300025960 Bacteria 1195
173 Ga0207712_10022421 3300025961 Bacteria 4157
174 Ga0207668_10047512 3300025972 Bacteria 2939
175 Ga0207640_10301979 3300025981 Bacteria 1267
176 Ga0207639_10176312 3300026041 Bacteria 1815
177 Ga0207639_11832353 3300026041 Bacteria 567
178 Ga0207708_10936782 3300026075 Bacteria 751
179 Ga0207702_10476600 3300026078 Bacteria 1214
180 Ga0207641_10012282 3300026088 Bacteria 7027
181 Ga0207648_10012927 3300026089 Bacteria 7795
182 Ga0207675_100371259 3300026118 Bacteria 1405
183 Ga0207683_10228795 3300026121 Bacteria 1695
184 Ga0207683_10624487 3300026121 Unclassified 998
185 Ga0210002_1072773 3300027617 Bacteria 608
186 Ga0209998_10038935 3300027717 Bacteria 1075
187 Ga0207428_10103569 3300027907 Bacteria 2197
188 Ga0207428_10117397 3300027907 Bacteria 2042
189 Ga0268265_10085060 3300028380 Bacteria 2509
190 Ga0268265_11048261 3300028380 Bacteria 807
191 Ga0268264_10055963 3300028381 Bacteria 3296
192 Ga0307513_10298142 3300031456 Bacteria 1380
193 Ga0307513_10470198 3300031456 Bacteria 979
194 Ga0307408_100528221 3300031548 Bacteria 1038
195 Ga0307408_100693901 3300031548 Unclassified 914
196 Ga0307406_10701778 3300031901 Bacteria 845
197 Ga0307407_10043549 3300031903 Bacteria 2524
198 Ga0307416_102560853 3300032002 Bacteria 608
199 Ga0373926_0238781 3300035083 Bacteria 703
200 Ga0373945_0381589 3300035116 Bacteria 615
201 Ga0373925_0726972 3300037068 Bacteria 818
202 Ga0395900_0033407 3300037418 Bacteria 5294
203 Ga0395898_0569805 3300037466 Bacteria 1075
204 Ga0395905_0373864 3300037471 Bacteria 1319
205 Ga0395901_0614520 3300038443 Bacteria 1094
206 Ga0451798_0484839 3300041458 Bacteria 796
207 Ga0451802_0825877 3300041460 Bacteria 765
208 Ga0451802_1081564 3300041460 Bacteria 742
209 Ga0451807_0077373 3300041486 Bacteria 1688
210 Ga0451807_0950361 3300041486 Bacteria 972
211 Ga0451833_0018329 3300041491 Bacteria 981
212 Ga0451853_4003188 3300041512 Bacteria 1360
213 Ga0466972_0114056 3300044658 Bacteria 1276
214 Ga0453684_0045498 3300044712 Bacteria 5854
215 Ga0451576_0076134 3300045051 Bacteria 3492
216 Ga0451576_0406943 3300045051 Bacteria 1427
217 Ga0495581_0047603 3300047315 Bacteria 2478
218 Ga0495636_0001310 3300047318 Bacteria 9437
219 Ga0495636_0011534 3300047318 Bacteria 3499
220 Ga0495672_0104097 3300047320 Bacteria 1534
221 Ga0495615_0001789 3300048090 Bacteria 3287
222 Ga0496100_0048686 3300048903 Bacteria 2737
223 Ga0496102_1338385 3300048905 Bacteria 635
224 Ga0496109_0325435 3300048912 Bacteria 1451
225 Ga0496115_0502543 3300048918 Bacteria 974
226 Ga0501310_004842 3300049130 Bacteria 1365
227 Ga0501292_002276 3300049515 Unclassified 2459
228 Ga0501299_013959 3300049522 Bacteria 1391
229 Ga0501032_0535970 3300049569 Bacteria 747
230 Ga0501034_0102329 3300049571 Bacteria 2858
231 Ga0501036_1024268 3300049572 Bacteria 675
232 Ga0501041_0646123 3300049577 Bacteria 676
233 Ga0501042_0131183 3300049578 Bacteria 1806
234 Ga0501042_0612152 3300049578 Bacteria 792
235 Ga0501043_0310013 3300049579 Bacteria 1205
236 Ga0501047_0021633 3300049581 Bacteria 6178
237 Ga0501048_0092840 3300049582 Bacteria 2129
238 Ga0501068_0569848 3300049584 Bacteria 737
239 Ga0501069_0186345 3300049585 Bacteria 1200
240 Ga0501070_0061319 3300049586 Bacteria 3116
241 Ga0501071_0061527 3300049587 Bacteria 2719
242 Ga0501072_0853530 3300049588 Bacteria 712
243 Ga0501073_0380375 3300049589 Bacteria 975
244 Ga0501074_0306643 3300049590 Bacteria 1128
245 Ga0501075_0533981 3300049591 Bacteria 895
246 Ga0501076_0151244 3300049592 Bacteria 1888
247 Ga0501076_0592682 3300049592 Bacteria 914
248 Ga0501076_0606763 3300049592 Bacteria 903
249 Ga0501076_0700098 3300049592 Bacteria 836
250 Ga0501076_0964194 3300049592 Bacteria 703
251 Ga0501077_0298850 3300049593 Bacteria 1026
252 Ga0501077_0378770 3300049593 Bacteria 904
253 Ga0501201_033766 3300049651 Unclassified 592
254 Ga0501217_020421 3300049661 Bacteria 1555
255 Ga0501227_006006 3300049665 Bacteria 2605
256 Ga0501230_003513 3300049667 Unclassified 2090
257 Ga0501233_003662 3300049668 Bacteria 2773
258 Ga0501235_024514 3300049669 Unclassified 1347
259 Ga0501221_081053 3300049704 Unclassified 781
260 Ga0501225_0016623 3300049705 Bacteria 2046
261 Ga0501229_000883 3300049706 Unclassified 3391
262 Ga0501079_1336939 3300049741 Bacteria 564
263 Ga0501080_0001745 3300049742 Bacteria 18623
264 Ga0501081_1363843 3300049743 Bacteria 538
265 Ga0501035_0000320 3300049822 Bacteria 55465
266 Ga0501044_0230076 3300049823 Bacteria 1802
267 Ga0501045_0063624 3300049824 Bacteria 2708
268 nmdc:mga03683_265005_c1 3300050489 Unclassified 800
269 nmdc:mga00v17_1018279_c1 3300050491 Bacteria 521
270 nmdc:mga0k408_234741_c1 3300050493 Bacteria 1095
271 nmdc:mga05p37_1854145_c1 3300050507 Bacteria 579
272 nmdc:mga05p37_465450_c1 3300050507 Bacteria 1460
273 nmdc:mga09592_1168105_c1 3300050508 Bacteria 637
274 nmdc:mga09592_12409_c1 3300050508 Bacteria 6941
275 nmdc:mga09592_294046_c1 3300050508 Bacteria 1408
276 nmdc:mga09592_608682_c1 3300050508 Bacteria 935
277 nmdc:mga0qj67_201122_c1 3300050509 Bacteria 1619
278 nmdc:mga06r32_110494_c1 3300050510 Bacteria 2704
279 nmdc:mga06r32_249830_c1 3300050510 Bacteria 1761
280 nmdc:mga08y16_3639_c1 3300050511 Bacteria 16017
281 nmdc:mga08y16_6514_c1 3300050511 Bacteria 12246
282 nmdc:mga0n895_374189_c1 3300050512 Bacteria 1442
283 nmdc:mga0rr50_28558_c1 3300050513 Bacteria 3922
284 nmdc:mga0rr50_750293_c1 3300050513 Unclassified 833
285 nmdc:mga0a205_22205_c1 3300050515 Bacteria 6007
286 nmdc:mga0a205_796556_c1 3300050515 Bacteria 793
287 Ga0501084_0630433 3300054114 Bacteria 905
288 Ga0501082_0084725 3300060353 Bacteria 2733
289 Ga0501082_0110686 3300060353 Bacteria 2377
290 Ga0501082_0310188 3300060353 Bacteria 1374
291 Ga0501082_0541094 3300060353 Bacteria 1018
292 Ga0501082_0788413 3300060353 Bacteria 831
293 Ga0530510_0910259 3300061734 Bacteria 672
294 Ga0500555_024059
295 rootH2_10138333
296 rootH1_10098632
297 Ga0065715_10702512
298 Ga0065707_10807721
299 Ga0070676_10070268
300 Ga0070690_100051108
301 Ga0070690_100099330
302 Ga0070670_100005768
303 Ga0068869_100435136
304 Ga0068869_100442239
305 Ga0070666_10073198
306 Ga0070680_100967618
307 Ga0070682_100001029
308 Ga0070682_100002689
309 Ga0070682_100094239
310 Ga0070682_100311271
311 Ga0070689_100016188
312 Ga0070689_100038307
313 Ga0070689_100149838
314 Ga0070689_100348255
315 Ga0070689_100450566
316 Ga0070687_100286705
317 Ga0070692_10358030
318 Ga0070668_100023445
319 Ga0070669_100080231
320 Ga0070669_101095127
321 Ga0070675_100743251
322 Ga0070671_100456058
323 Ga0070671_100652776
324 Ga0070674_100032507
325 Ga0070673_100008808
326 Ga0070673_100019245
327 Ga0070673_100202618
328 Ga0070673_100343544
329 Ga0070673_100568448
330 Ga0070688_100005642
331 Ga0070688_100007503
332 Ga0070688_100093759
333 Ga0070688_100107923
334 Ga0070667_100085144
335 Ga0070701_10010210
336 Ga0070701_10498763
337 Ga0070700_100001035
338 Ga0070694_100170808
339 Ga0070694_100605303
340 Ga0070694_100716447
341 Ga0070708_100087900
342 Ga0070678_100451360
343 Ga0070678_100912350
344 Ga0070681_10216616
345 Ga0070681_11335766
346 Ga0068867_100012757
347 Ga0068867_100395523
348 Ga0070685_10310656
349 Ga0070706_100085989
350 Ga0070707_101027050
351 Ga0070707_101350669
352 Ga0070698_100030639
353 Ga0070679_100004321
354 Ga0070679_100116498
355 Ga0070684_100456063
356 Ga0070672_100013459
357 Ga0070672_100018943
358 Ga0070672_100039929
359 Ga0070672_100078379
360 Ga0070686_100002095
361 Ga0070695_100028289
362 Ga0070695_100124065
363 Ga0070693_101123631
364 Ga0070704_100011638
365 Ga0070704_101006625
366 Ga0070704_101516049
367 Ga0068854_100357717
368 Ga0070702_101291150
369 Ga0068852_100439923
370 Ga0068859_100107183
371 Ga0068859_100360517
372 Ga0068864_100622485
373 Ga0068864_101290212
374 Ga0068866_10086088
375 Ga0068866_10215057
376 Ga0068861_100278103
377 Ga0068870_10206820
378 Ga0068863_100032616
379 Ga0068863_101190616
380 Ga0068863_101245868
381 Ga0068858_100312106
382 Ga0068860_101941598
383 Ga0068862_100037882
384 Ga0068862_101358353
385 Ga0075366_10144299
386 Ga0075366_10382719
387 Ga0068871_100267697
388 Ga0068871_101322509
389 Ga0075428_100000589
390 Ga0075428_100019299
391 Ga0075428_100540233
392 Ga0075428_100609410
393 Ga0075430_100206031
394 Ga0075430_100421896
395 Ga0075430_100467346
396 Ga0075431_100304328
397 Ga0075433_10037798
398 Ga0075433_10048933
399 Ga0075434_100003402
400 Ga0075429_100015491
401 Ga0075429_100130947
402 Ga0075429_100363053
403 Ga0075429_101287964
404 Ga0068865_100001623
405 Ga0097620_100107187
406 Ga0097620_100360538
407 Ga0075435_100008415
408 Ga0075435_100814271
409 Ga0111539_10002320
410 Ga0111539_10010826
411 Ga0105245_10727786
412 Ga0105245_10998020
413 Ga0114129_10610681
414 Ga0114129_12200948
415 Ga0105243_11874145
416 Ga0105242_10788326
417 Ga0105242_12613691
418 Ga0157378_10049823
419 Ga0163162_10760261
420 Ga0157375_11297622
421 Ga0157380_10227162
422 Ga0157380_10499434
423 Ga0157377_10540027
424 Ga0157376_10278773
425 Ga0207653_10329007
426 Ga0207682_10085442
427 Ga0207642_10040874
428 Ga0207642_10174610
429 Ga0207645_10013788
430 Ga0207645_10113053
431 Ga0207643_10101030
432 Ga0207643_10527718
433 Ga0207684_10866706
434 Ga0207684_10936963
435 Ga0207707_10057485
436 Ga0207707_10859271
437 Ga0207660_10084082
438 Ga0207662_10060707
439 Ga0207662_10072464
440 Ga0207657_10333461
441 Ga0207652_10013396
442 Ga0207652_10702667
443 Ga0207646_11724762
444 Ga0207681_10000136
445 Ga0207650_11568625
446 Ga0207659_10120554
447 Ga0207687_10213956
448 Ga0207644_10514852
449 Ga0207670_10009282
450 Ga0207670_10220006
451 Ga0207669_10005997
452 Ga0207669_10886794
453 Ga0207704_10001232
454 Ga0207691_10008372
455 Ga0207691_10022892
456 Ga0207691_10023522
457 Ga0207691_10479874
458 Ga0207689_10125755
459 Ga0207689_10126146
460 Ga0207689_10396596
461 Ga0207661_10735647
462 Ga0207667_10286469
463 Ga0207651_10002119
464 Ga0207651_10041382
465 Ga0207651_10380834
466 Ga0207712_10022421
467 Ga0207668_10047512
468 Ga0207640_10301979
469 Ga0207639_10176312
470 Ga0207639_11832353
471 Ga0207708_10936782
472 Ga0207702_10476600
473 Ga0207641_10012282
474 Ga0207648_10012927
475 Ga0207675_100371259
476 Ga0207683_10228795
477 Ga0207683_10624487
478 Ga0210002_1072773
479 Ga0209998_10038935
480 Ga0207428_10103569
481 Ga0207428_10117397
482 Ga0268265_10085060
483 Ga0268265_11048261
484 Ga0268264_10055963
485 Ga0307513_10298142
486 Ga0307513_10470198
487 Ga0307408_100528221
488 Ga0307408_100693901
489 Ga0307406_10701778
490 Ga0307407_10043549
491 Ga0307416_102560853
492 Ga0373926_0238781
493 Ga0373945_0381589
494 Ga0373925_0726972
495 Ga0395900_0033407
496 Ga0395898_0569805
497 Ga0395905_0373864
498 Ga0395901_0614520
499 Ga0451798_0484839
500 Ga0451802_0825877
501 Ga0451802_1081564
502 Ga0451807_0077373
503 Ga0451807_0950361
504 Ga0451833_0018329
505 Ga0451853_4003188
506 Ga0466972_0114056
507 Ga0453684_0045498
508 Ga0451576_0076134
509 Ga0451576_0406943
510 Ga0495581_0047603
511 Ga0495636_0001310
512 Ga0495636_0011534
513 Ga0495672_0104097
514 Ga0495615_0001789
515 Ga0496100_0048686
516 Ga0496102_1338385
517 Ga0496109_0325435
518 Ga0496115_0502543
519 Ga0501310_004842
520 Ga0501292_002276
521 Ga0501299_013959
522 Ga0501032_0535970
523 Ga0501034_0102329
524 Ga0501036_1024268
525 Ga0501041_0646123
526 Ga0501042_0131183
527 Ga0501042_0612152
528 Ga0501043_0310013
529 Ga0501047_0021633
530 Ga0501048_0092840
531 Ga0501068_0569848
532 Ga0501069_0186345
533 Ga0501070_0061319
534 Ga0501071_0061527
535 Ga0501072_0853530
536 Ga0501073_0380375
537 Ga0501074_0306643
538 Ga0501075_0533981
539 Ga0501076_0151244
540 Ga0501076_0592682
541 Ga0501076_0606763
542 Ga0501076_0700098
543 Ga0501076_0964194
544 Ga0501077_0298850
545 Ga0501077_0378770
546 Ga0501201_033766
547 Ga0501217_020421
548 Ga0501227_006006
549 Ga0501230_003513
550 Ga0501233_003662
551 Ga0501235_024514
552 Ga0501221_081053
553 Ga0501225_0016623
554 Ga0501229_000883
555 Ga0501079_1336939
556 Ga0501080_0001745
557 Ga0501081_1363843
558 Ga0501035_0000320
559 Ga0501044_0230076
560 Ga0501045_0063624
561 nmdc:mga03683_265005_c1
562 nmdc:mga00v17_1018279_c1
563 nmdc:mga0k408_234741_c1
564 nmdc:mga05p37_1854145_c1
565 nmdc:mga05p37_465450_c1
566 nmdc:mga09592_1168105_c1
567 nmdc:mga09592_12409_c1
568 nmdc:mga09592_294046_c1
569 nmdc:mga09592_608682_c1
570 nmdc:mga0qj67_201122_c1
571 nmdc:mga06r32_110494_c1
572 nmdc:mga06r32_249830_c1
573 nmdc:mga08y16_3639_c1
574 nmdc:mga08y16_6514_c1
575 nmdc:mga0n895_374189_c1
576 nmdc:mga0rr50_28558_c1
577 nmdc:mga0rr50_750293_c1
578 nmdc:mga0a205_22205_c1
579 nmdc:mga0a205_796556_c1
580 Ga0501084_0630433
581 Ga0501082_0084725
582 Ga0501082_0110686
583 Ga0501082_0310188
584 Ga0501082_0541094
585 Ga0501082_0788413
586 Ga0530510_0910259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

38

179

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o9r-assembly1.cif.gz_A the x-ray crystal structure of agrobacterium tumefaciens dps, a member of the family that protect dna without binding 0.978 3 158
3ge4-assembly1.cif.gz_E crystal structure of ferritin:dna-binding protein dps from brucella melitensis 0.9743 1 158
4m32-assembly1.cif.gz_D crystal structure of gated-pore mutant d138n of second dna-binding protein under starvation from mycobacterium smegmatis 0.9738 15 155
4m32-assembly1.cif.gz_C crystal structure of gated-pore mutant d138n of second dna-binding protein under starvation from mycobacterium smegmatis 0.9736 15 155
5ww5-assembly1.cif.gz_D crystal structure of the second dna-binding protein under starvation from mycobacterium smegmatis soaked with iron in the ratio of 100 iron atoms per dodecamer 0.9735 15 155
ID Description Score Start End Superfamily
1o9rA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.978 3 158 1.20.1260.10
2yw6A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9691 11 158 1.20.1260.10
6gcmf00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.967 4 156 1.20.1260.10
2yw7A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9653 11 156 1.20.1260.10
1velA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9646 3 158 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A7Y5LM16-F1-model_v4 DNA starvation/stationary phase protection protein Dps 0.9948 1 156 GO:0008199
GO:0016722
AF-A0A6P0Z278-F1-model_v4 DNA starvation/stationary phase protection protein Dps 0.9899 19 156 GO:0008199
GO:0016722
AF-Q09CY1-F1-model_v4 Starvation-inducible DNA-binding protein 0.9886 1 158 GO:0003677
GO:0008199
GO:0016722
AF-A0A520YLW8-F1-model_v4 DNA starvation/stationary phase protection protein Dps 0.9868 3 156 GO:0008199
AF-A0A2S8STH4-F1-model_v4 Starvation-inducible DNA-binding protein 0.9856 6 155 GO:0003677
GO:0008199

Map