F391750

General Info

Members Datasets Scaffolds Average Seq Length
293 160 586 185

Family's Representative Sequence

Representative Sequence 3300049582|Ga0501048_0275719|Ga0501048_0275719_588_1151
Length 187
Sequence MNRPLFIPVILGTPRQGRLSAHAAALLTAELGKRVETELVDVAALPIPVDDAGESCKLPAFAETMNRADALVLVTPEYNHGYPGLLKHVLDTNLQEYVHKAAGVVGVSAGVFGGARGIQNLLPVLRELGLVTIFWDVNFTTVRRRFDESGTLVDDSFLAIDKFLDELLWMAETLRYGRENVPIGGPS

Samples

Sample ID Description Type Environment
1 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
99 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
100 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
101 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
106 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
114 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
115 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
158 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 27.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501048_0275719 3300049582 Bacteria 1196
2 JGI25405J52794_10003170 3300003911 Bacteria 2866
3 Ga0065707_10233739 3300005295 Bacteria 1179
4 Ga0070690_100106138 3300005330 Bacteria 1868
5 Ga0070666_10042964 3300005335 Unclassified 3025
6 Ga0070689_100094915 3300005340 Bacteria 2355
7 Ga0070689_100277255 3300005340 Bacteria 1390
8 Ga0070669_100139723 3300005353 Bacteria 1866
9 Ga0070675_100000953 3300005354 Bacteria 20630
10 Ga0070675_100388637 3300005354 Bacteria 1243
11 Ga0070671_100039665 3300005355 Unclassified 3909
12 Ga0070674_100033338 3300005356 Bacteria 3427
13 Ga0070688_100010105 3300005365 Bacteria 5190
14 Ga0070667_100006983 3300005367 Bacteria 9383
15 Ga0070694_100608178 3300005444 Bacteria 881
16 Ga0070678_100100976 3300005456 Bacteria 2236
17 Ga0068867_101009034 3300005459 Unclassified 755
18 Ga0070685_10010251 3300005466 Bacteria 4864
19 Ga0070698_100280120 3300005471 Bacteria 1599
20 Ga0070697_100928769 3300005536 Unclassified 772
21 Ga0070672_100046443 3300005543 Bacteria 3365
22 Ga0070672_100655504 3300005543 Bacteria 917
23 Ga0070695_100102154 3300005545 Bacteria 1933
24 Ga0070704_100349808 3300005549 Bacteria 1247
25 Ga0070664_100035267 3300005564 Bacteria 4200
26 Ga0070702_100049866 3300005615 Bacteria 2389
27 Ga0070702_100246745 3300005615 Unclassified 1208
28 Ga0068859_100002452 3300005617 Bacteria 18896
29 Ga0068864_100190400 3300005618 Bacteria 1880
30 Ga0068864_100545233 3300005618 Unclassified 1120
31 Ga0068863_100031449 3300005841 Bacteria 5063
32 Ga0068860_100031502 3300005843 Bacteria 5097
33 Ga0081455_10000569 3300005937 Bacteria 48060
34 Ga0081455_10158849 3300005937 Bacteria 1735
35 Ga0081538_10044005 3300005981 Unclassified 2792
36 Ga0081539_10051175 3300005985 Unclassified 2330
37 Ga0075427_10030180 3300006194 Unclassified 888
38 Ga0097621_100015564 3300006237 Bacteria 5728
39 Ga0097621_100224174 3300006237 Bacteria 1639
40 Ga0068871_100046664 3300006358 Unclassified 3490
41 Ga0068871_100847123 3300006358 Unclassified 845
42 Ga0075428_100095758 3300006844 Bacteria 3236
43 Ga0075428_100151491 3300006844 Unclassified 2519
44 Ga0075428_100489999 3300006844 Unclassified 1315
45 Ga0075428_100545406 3300006844 Bacteria 1240
46 Ga0075430_100049469 3300006846 Bacteria 3548
47 Ga0075430_100115875 3300006846 Unclassified 2233
48 Ga0075431_100212481 3300006847 Bacteria 1976
49 Ga0075431_100387428 3300006847 Unclassified 1401
50 Ga0075431_100505879 3300006847 Bacteria 1199
51 Ga0075431_100651421 3300006847 Bacteria 1034
52 Ga0075431_100762457 3300006847 Unclassified 942
53 Ga0075433_10001464 3300006852 Bacteria 17463
54 Ga0075433_10066699 3300006852 Bacteria 3158
55 Ga0075433_10086905 3300006852 Unclassified 2761
56 Ga0075433_10236985 3300006852 Bacteria 1620
57 Ga0075433_10380421 3300006852 Unclassified 1246
58 Ga0075433_10404993 3300006852 Unclassified 1203
59 Ga0075434_100001615 3300006871 Bacteria 19147
60 Ga0075434_100001858 3300006871 Bacteria 18237
61 Ga0075434_100007598 3300006871 Bacteria 10037
62 Ga0075434_100027077 3300006871 Bacteria 5627
63 Ga0075434_100042196 3300006871 Bacteria 4522
64 Ga0075434_100265070 3300006871 Unclassified 1737
65 Ga0075434_100292027 3300006871 Bacteria 1650
66 Ga0075434_101183676 3300006871 Unclassified 776
67 Ga0068865_100079171 3300006881 Bacteria 2353
68 Ga0075436_100077343 3300006914 Unclassified 2305
69 Ga0075436_100126726 3300006914 Unclassified 1789
70 Ga0075436_100481823 3300006914 Unclassified 906
71 Ga0097620_100002452 3300006931 Bacteria 18896
72 Ga0097620_100173346 3300006931 Bacteria 2239
73 Ga0075435_100010750 3300007076 Bacteria 6704
74 Ga0075435_100025712 3300007076 Bacteria 4584
75 Ga0075435_100030893 3300007076 Bacteria 4216
76 Ga0075435_100175896 3300007076 Bacteria 1807
77 Ga0111539_10335114 3300009094 Bacteria 1761
78 Ga0111539_10430627 3300009094 Bacteria 1536
79 Ga0111539_10761830 3300009094 Unclassified 1127
80 Ga0105247_10040336 3300009101 Bacteria 2854
81 Ga0114129_10002857 3300009147 Bacteria 24163
82 Ga0114129_10091351 3300009147 Bacteria 4218
83 Ga0114129_10258445 3300009147 Unclassified 2336
84 Ga0114129_10440584 3300009147 Unclassified 1710
85 Ga0114129_10501340 3300009147 Bacteria 1586
86 Ga0114129_10563817 3300009147 Unclassified 1479
87 Ga0114129_11802063 3300009147 Bacteria 744
88 Ga0105243_10820621 3300009148 Bacteria 918
89 Ga0105242_10036057 3300009176 Bacteria 3966
90 Ga0105248_10004002 3300009177 Bacteria 16291
91 Ga0105248_10010838 3300009177 Bacteria 10065
92 Ga0105246_11424804 3300011119 Unclassified 647
93 Ga0157378_10042068 3300013297 Bacteria 4054
94 Ga0163162_10090355 3300013306 Bacteria 3144
95 Ga0157375_10001302 3300013308 Bacteria 21488
96 Ga0157375_11419799 3300013308 Bacteria 818
97 Ga0163163_10000871 3300014325 Bacteria 25708
98 Ga0163163_10045005 3300014325 Bacteria 4331
99 Ga0163163_11168530 3300014325 Unclassified 832
100 Ga0157377_10063848 3300014745 Bacteria 2110
101 Ga0157379_10000470 3300014968 Bacteria 32717
102 Ga0163161_10010926 3300017792 Bacteria 6292
103 Ga0207680_10352777 3300025903 Unclassified 1033
104 Ga0207643_10240660 3300025908 Unclassified 1112
105 Ga0207659_10070599 3300025926 Bacteria 2547
106 Ga0207659_11000409 3300025926 Unclassified 719
107 Ga0207644_10042632 3300025931 Bacteria 3217
108 Ga0207670_10107284 3300025936 Bacteria 2005
109 Ga0207670_10580216 3300025936 Bacteria 919
110 Ga0207669_10002005 3300025937 Bacteria 8641
111 Ga0207704_10084330 3300025938 Bacteria 2065
112 Ga0207704_10409365 3300025938 Unclassified 1072
113 Ga0207691_10046582 3300025940 Bacteria 3983
114 Ga0207691_10472408 3300025940 Bacteria 1066
115 Ga0207711_10003759 3300025941 Bacteria 13072
116 Ga0207711_10025149 3300025941 Bacteria 4996
117 Ga0207679_10023478 3300025945 Bacteria 4219
118 Ga0207658_10006627 3300025986 Bacteria 7886
119 Ga0207641_10001122 3300026088 Bacteria 26901
120 Ga0207676_10014114 3300026095 Bacteria 5739
121 Ga0207676_10933158 3300026095 Bacteria 853
122 Ga0207683_10141553 3300026121 Bacteria 2168
123 Ga0209973_1001958 3300027252 Bacteria 1866
124 Ga0209996_1006642 3300027395 Bacteria 1498
125 Ga0210000_1003686 3300027462 Unclassified 2211
126 Ga0209999_1054192 3300027543 Unclassified 760
127 Ga0209982_1006986 3300027552 Bacteria 1649
128 Ga0209983_1020678 3300027665 Bacteria 1372
129 Ga0209971_1021083 3300027682 Bacteria 1550
130 Ga0209998_10012244 3300027717 Unclassified 1781
131 Ga0209974_10005772 3300027876 Bacteria 4339
132 Ga0268265_10928957 3300028380 Unclassified 856
133 Ga0268264_10014376 3300028381 Bacteria 6506
134 Ga0307408_100705575 3300031548 Bacteria 907
135 Ga0307413_10265732 3300031824 Bacteria 1282
136 Ga0307410_10168259 3300031852 Bacteria 1649
137 Ga0307407_10137318 3300031903 Bacteria 1573
138 Ga0307409_100509739 3300031995 Bacteria 1173
139 Ga0307416_100706890 3300032002 Bacteria 1097
140 Ga0307414_10059548 3300032004 Bacteria 2697
141 Ga0307411_10113814 3300032005 Bacteria 1942
142 Ga0373956_0118072 3300035119 Bacteria 1238
143 Ga0373956_0153489 3300035119 Bacteria 1084
144 Ga0373960_0040978 3300035121 Bacteria 1339
145 Ga0373943_0030956 3300035170 Bacteria 2537
146 Ga0373935_0152327 3300035692 Bacteria 1570
147 Ga0373933_0345511 3300035724 Unclassified 966
148 Ga0373947_0083316 3300035725 Bacteria 1983
149 Ga0373937_0131852 3300036401 Bacteria 2334
150 Ga0373937_0157102 3300036401 Bacteria 2132
151 Ga0373937_0198230 3300036401 Unclassified 1887
152 Ga0373925_0067570 3300037068 Bacteria 2696
153 Ga0439456_034386 3300042013 Unclassified 1091
154 Ga0450907_016754 3300042146 Bacteria 1222
155 Ga0439435_0008836 3300042436 Unclassified 2347
156 Ga0439435_0044967 3300042436 Bacteria 1247
157 Ga0439460_0082017 3300042461 Unclassified 1013
158 Ga0453683_0060743 3300044673 Bacteria 2363
159 Ga0495592_0025608 3300046454 Bacteria 4477
160 Ga0495639_0400946 3300046475 Unclassified 693
161 Ga0495587_0310809 3300046536 Bacteria 881
162 Ga0495667_0011850 3300046559 Bacteria 5907
163 Ga0495588_0347701 3300046674 Unclassified 779
164 Ga0495657_0002280 3300046675 Bacteria 16206
165 Ga0495658_0347042 3300046683 Bacteria 943
166 Ga0495613_0065272 3300046689 Bacteria 2660
167 Ga0495581_0360137 3300047315 Bacteria 849
168 Ga0495680_0535719 3300047322 Bacteria 791
169 Ga0495684_0172555 3300047471 Unclassified 1607
170 Ga0501298_062574 3300049521 Bacteria 791
171 Ga0501317_000452 3300049533 Bacteria 2861
172 Ga0501031_0180368 3300049568 Bacteria 1379
173 Ga0501032_0108887 3300049569 Unclassified 1834
174 Ga0501033_0063697 3300049570 Unclassified 2713
175 Ga0501036_0062552 3300049572 Unclassified 3152
176 Ga0501036_0125646 3300049572 Bacteria 2166
177 Ga0501037_0049192 3300049573 Bacteria 3087
178 Ga0501037_0487323 3300049573 Unclassified 837
179 Ga0501038_0020782 3300049574 Bacteria 5900
180 Ga0501038_0021960 3300049574 Bacteria 5724
181 Ga0501039_0002532 3300049575 Bacteria 13643
182 Ga0501039_0223357 3300049575 Bacteria 1480
183 Ga0501039_0228816 3300049575 Bacteria 1462
184 Ga0501040_0003941 3300049576 Bacteria 9634
185 Ga0501040_0137282 3300049576 Bacteria 1722
186 Ga0501041_0000037 3300049577 Bacteria 44326
187 Ga0501041_0123888 3300049577 Bacteria 1608
188 Ga0501041_0160429 3300049577 Bacteria 1406
189 Ga0501042_0000876 3300049578 Bacteria 16828
190 Ga0501042_0303491 3300049578 Bacteria 1154
191 Ga0501042_0505555 3300049578 Bacteria 877
192 Ga0501043_0032081 3300049579 Bacteria 4129
193 Ga0501043_0051335 3300049579 Bacteria 3240
194 Ga0501046_0014107 3300049580 Bacteria 6747
195 Ga0501048_0002869 3300049582 Bacteria 13150
196 Ga0501068_0143829 3300049584 Bacteria 1496
197 Ga0501068_0144121 3300049584 Unclassified 1494
198 Ga0501068_1023767 3300049584 Unclassified 545
199 Ga0501069_0381637 3300049585 Bacteria 832
200 Ga0501070_0101828 3300049586 Bacteria 2375
201 Ga0501070_0143678 3300049586 Bacteria 1970
202 Ga0501071_0084262 3300049587 Unclassified 2329
203 Ga0501071_0097605 3300049587 Bacteria 2163
204 Ga0501071_0842452 3300049587 Bacteria 707
205 Ga0501072_0000314 3300049588 Bacteria 34441
206 Ga0501072_0280780 3300049588 Bacteria 1325
207 Ga0501072_0368159 3300049588 Bacteria 1141
208 Ga0501072_0566590 3300049588 Bacteria 896
209 Ga0501073_0344101 3300049589 Bacteria 1029
210 Ga0501074_0021251 3300049590 Bacteria 4713
211 Ga0501075_0001173 3300049591 Bacteria 16948
212 Ga0501075_0166136 3300049591 Unclassified 1684
213 Ga0501075_0280114 3300049591 Bacteria 1270
214 Ga0501075_0388732 3300049591 Bacteria 1063
215 Ga0501076_0005481 3300049592 Bacteria 9135
216 Ga0501076_0657585 3300049592 Bacteria 865
217 Ga0501077_0000210 3300049593 Bacteria 34104
218 Ga0501077_0157511 3300049593 Bacteria 1442
219 Ga0501077_0652643 3300049593 Bacteria 676
220 Ga0501209_068462 3300049656 Bacteria 1005
221 Ga0501079_0000228 3300049741 Bacteria 33621
222 Ga0501079_0145802 3300049741 Unclassified 1845
223 Ga0501079_0774875 3300049741 Unclassified 755
224 Ga0501080_0002897 3300049742 Bacteria 15089
225 Ga0501080_0122932 3300049742 Unclassified 2404
226 Ga0501081_0000513 3300049743 Bacteria 21769
227 Ga0501081_0119406 3300049743 Unclassified 1876
228 Ga0501081_0205449 3300049743 Bacteria 1429
229 Ga0501083_0090527 3300049744 Unclassified 2020
230 Ga0501035_0034390 3300049822 Bacteria 4605
231 Ga0501035_0041014 3300049822 Unclassified 4180
232 Ga0501044_0549325 3300049823 Bacteria 1052
233 Ga0501044_0833075 3300049823 Unclassified 800
234 Ga0501045_0001724 3300049824 Bacteria 14729
235 Ga0501045_0256366 3300049824 Bacteria 1302
236 Ga0501045_0487265 3300049824 Unclassified 916
237 Ga0501045_0627997 3300049824 Bacteria 794
238 nmdc:mga05p37_1234621_c1 3300050507 Unclassified 769
239 nmdc:mga05p37_1380_c1 3300050507 Bacteria 28243
240 nmdc:mga05p37_314647_c1 3300050507 Bacteria 1855
241 nmdc:mga05p37_33906_c1 3300050507 Bacteria 6255
242 nmdc:mga05p37_463060_c1 3300050507 Bacteria 1464
243 nmdc:mga05p37_7857_c1 3300050507 Bacteria 12591
244 nmdc:mga09592_110894_c1 3300050508 Bacteria 2354
245 nmdc:mga09592_276854_c1 3300050508 Bacteria 1455
246 nmdc:mga0qj67_202026_c1 3300050509 Bacteria 1615
247 nmdc:mga0qj67_456517_c1 3300050509 Unclassified 1029
248 nmdc:mga0qj67_962029_c1 3300050509 Bacteria 671
249 nmdc:mga06r32_193150_c1 3300050510 Bacteria 2023
250 nmdc:mga06r32_209199_c1 3300050510 Unclassified 1939
251 nmdc:mga06r32_245547_c1 3300050510 Unclassified 1778
252 nmdc:mga06r32_379567_c1 3300050510 Unclassified 1396
253 nmdc:mga06r32_40427_c1 3300050510 Bacteria 4427
254 nmdc:mga06r32_524142_c1 3300050510 Bacteria 1160
255 nmdc:mga06r32_621867_c1 3300050510 Bacteria 1050
256 nmdc:mga08y16_133915_c1 3300050511 Bacteria 2575
257 nmdc:mga08y16_439783_c1 3300050511 Bacteria 1331
258 nmdc:mga08y16_821308_c1 3300050511 Bacteria 921
259 nmdc:mga08y16_908735_c1 3300050511 Bacteria 866
260 nmdc:mga08y16_995555_c1 3300050511 Unclassified 818
261 nmdc:mga0n895_1046349_c1 3300050512 Unclassified 796
262 nmdc:mga0n895_120041_c1 3300050512 Bacteria 2650
263 nmdc:mga0n895_196074_c1 3300050512 Bacteria 2051
264 nmdc:mga0n895_3323_c1 3300050512 Bacteria 12926
265 nmdc:mga0n895_408198_c1 3300050512 Unclassified 1374
266 nmdc:mga0n895_416683_c1 3300050512 Bacteria 1358
267 nmdc:mga0n895_58771_c1 3300050512 Bacteria 3792
268 nmdc:mga0rr50_103483_c1 3300050513 Unclassified 2241
269 nmdc:mga0rr50_116349_c1 3300050513 Bacteria 2123
270 nmdc:mga0rr50_140262_c1 3300050513 Bacteria 1944
271 nmdc:mga0rr50_200937_c1 3300050513 Bacteria 1638
272 nmdc:mga08x19_111544_c1 3300050514 Unclassified 1825
273 nmdc:mga08x19_127013_c1 3300050514 Unclassified 1713
274 nmdc:mga08x19_286711_c1 3300050514 Bacteria 1142
275 nmdc:mga0a205_140220_c1 3300050515 Unclassified 2318
276 nmdc:mga0a205_192230_c1 3300050515 Bacteria 1933
277 nmdc:mga0a205_326172_c1 3300050515 Bacteria 1406
278 nmdc:mga0a205_373161_c1 3300050515 Unclassified 1292
279 nmdc:mga0a205_598661_c1 3300050515 Unclassified 956
280 nmdc:mga0a205_77703_c1 3300050515 Bacteria 3207
281 Ga0495619_0191098 3300053085 Unclassified 1417
282 Ga0501084_0000162 3300054114 Bacteria 51385
283 Ga0501084_0121986 3300054114 Unclassified 2191
284 Ga0501084_0378882 3300054114 Bacteria 1196
285 Ga0501084_0598366 3300054114 Unclassified 932
286 Ga0590074_004976 3300059423 Bacteria 2196
287 Ga0590077_009731 3300059426 Bacteria 1976
288 Ga0501082_0011638 3300060353 Bacteria 7564
289 Ga0501082_0046250 3300060353 Bacteria 3751
290 Ga0530510_0054418 3300061734 Unclassified 2891
291 Ga0530510_0104167 3300061734 Bacteria 2076
292 Ga0530510_0134704 3300061734 Bacteria 1818
293 Ga0530510_0158369 3300061734 Bacteria 1674
294 Ga0501048_0275719
295 JGI25405J52794_10003170
296 Ga0065707_10233739
297 Ga0070690_100106138
298 Ga0070666_10042964
299 Ga0070689_100094915
300 Ga0070689_100277255
301 Ga0070669_100139723
302 Ga0070675_100000953
303 Ga0070675_100388637
304 Ga0070671_100039665
305 Ga0070674_100033338
306 Ga0070688_100010105
307 Ga0070667_100006983
308 Ga0070694_100608178
309 Ga0070678_100100976
310 Ga0068867_101009034
311 Ga0070685_10010251
312 Ga0070698_100280120
313 Ga0070697_100928769
314 Ga0070672_100046443
315 Ga0070672_100655504
316 Ga0070695_100102154
317 Ga0070704_100349808
318 Ga0070664_100035267
319 Ga0070702_100049866
320 Ga0070702_100246745
321 Ga0068859_100002452
322 Ga0068864_100190400
323 Ga0068864_100545233
324 Ga0068863_100031449
325 Ga0068860_100031502
326 Ga0081455_10000569
327 Ga0081455_10158849
328 Ga0081538_10044005
329 Ga0081539_10051175
330 Ga0075427_10030180
331 Ga0097621_100015564
332 Ga0097621_100224174
333 Ga0068871_100046664
334 Ga0068871_100847123
335 Ga0075428_100095758
336 Ga0075428_100151491
337 Ga0075428_100489999
338 Ga0075428_100545406
339 Ga0075430_100049469
340 Ga0075430_100115875
341 Ga0075431_100212481
342 Ga0075431_100387428
343 Ga0075431_100505879
344 Ga0075431_100651421
345 Ga0075431_100762457
346 Ga0075433_10001464
347 Ga0075433_10066699
348 Ga0075433_10086905
349 Ga0075433_10236985
350 Ga0075433_10380421
351 Ga0075433_10404993
352 Ga0075434_100001615
353 Ga0075434_100001858
354 Ga0075434_100007598
355 Ga0075434_100027077
356 Ga0075434_100042196
357 Ga0075434_100265070
358 Ga0075434_100292027
359 Ga0075434_101183676
360 Ga0068865_100079171
361 Ga0075436_100077343
362 Ga0075436_100126726
363 Ga0075436_100481823
364 Ga0097620_100002452
365 Ga0097620_100173346
366 Ga0075435_100010750
367 Ga0075435_100025712
368 Ga0075435_100030893
369 Ga0075435_100175896
370 Ga0111539_10335114
371 Ga0111539_10430627
372 Ga0111539_10761830
373 Ga0105247_10040336
374 Ga0114129_10002857
375 Ga0114129_10091351
376 Ga0114129_10258445
377 Ga0114129_10440584
378 Ga0114129_10501340
379 Ga0114129_10563817
380 Ga0114129_11802063
381 Ga0105243_10820621
382 Ga0105242_10036057
383 Ga0105248_10004002
384 Ga0105248_10010838
385 Ga0105246_11424804
386 Ga0157378_10042068
387 Ga0163162_10090355
388 Ga0157375_10001302
389 Ga0157375_11419799
390 Ga0163163_10000871
391 Ga0163163_10045005
392 Ga0163163_11168530
393 Ga0157377_10063848
394 Ga0157379_10000470
395 Ga0163161_10010926
396 Ga0207680_10352777
397 Ga0207643_10240660
398 Ga0207659_10070599
399 Ga0207659_11000409
400 Ga0207644_10042632
401 Ga0207670_10107284
402 Ga0207670_10580216
403 Ga0207669_10002005
404 Ga0207704_10084330
405 Ga0207704_10409365
406 Ga0207691_10046582
407 Ga0207691_10472408
408 Ga0207711_10003759
409 Ga0207711_10025149
410 Ga0207679_10023478
411 Ga0207658_10006627
412 Ga0207641_10001122
413 Ga0207676_10014114
414 Ga0207676_10933158
415 Ga0207683_10141553
416 Ga0209973_1001958
417 Ga0209996_1006642
418 Ga0210000_1003686
419 Ga0209999_1054192
420 Ga0209982_1006986
421 Ga0209983_1020678
422 Ga0209971_1021083
423 Ga0209998_10012244
424 Ga0209974_10005772
425 Ga0268265_10928957
426 Ga0268264_10014376
427 Ga0307408_100705575
428 Ga0307413_10265732
429 Ga0307410_10168259
430 Ga0307407_10137318
431 Ga0307409_100509739
432 Ga0307416_100706890
433 Ga0307414_10059548
434 Ga0307411_10113814
435 Ga0373956_0118072
436 Ga0373956_0153489
437 Ga0373960_0040978
438 Ga0373943_0030956
439 Ga0373935_0152327
440 Ga0373933_0345511
441 Ga0373947_0083316
442 Ga0373937_0131852
443 Ga0373937_0157102
444 Ga0373937_0198230
445 Ga0373925_0067570
446 Ga0439456_034386
447 Ga0450907_016754
448 Ga0439435_0008836
449 Ga0439435_0044967
450 Ga0439460_0082017
451 Ga0453683_0060743
452 Ga0495592_0025608
453 Ga0495639_0400946
454 Ga0495587_0310809
455 Ga0495667_0011850
456 Ga0495588_0347701
457 Ga0495657_0002280
458 Ga0495658_0347042
459 Ga0495613_0065272
460 Ga0495581_0360137
461 Ga0495680_0535719
462 Ga0495684_0172555
463 Ga0501298_062574
464 Ga0501317_000452
465 Ga0501031_0180368
466 Ga0501032_0108887
467 Ga0501033_0063697
468 Ga0501036_0062552
469 Ga0501036_0125646
470 Ga0501037_0049192
471 Ga0501037_0487323
472 Ga0501038_0020782
473 Ga0501038_0021960
474 Ga0501039_0002532
475 Ga0501039_0223357
476 Ga0501039_0228816
477 Ga0501040_0003941
478 Ga0501040_0137282
479 Ga0501041_0000037
480 Ga0501041_0123888
481 Ga0501041_0160429
482 Ga0501042_0000876
483 Ga0501042_0303491
484 Ga0501042_0505555
485 Ga0501043_0032081
486 Ga0501043_0051335
487 Ga0501046_0014107
488 Ga0501048_0002869
489 Ga0501068_0143829
490 Ga0501068_0144121
491 Ga0501068_1023767
492 Ga0501069_0381637
493 Ga0501070_0101828
494 Ga0501070_0143678
495 Ga0501071_0084262
496 Ga0501071_0097605
497 Ga0501071_0842452
498 Ga0501072_0000314
499 Ga0501072_0280780
500 Ga0501072_0368159
501 Ga0501072_0566590
502 Ga0501073_0344101
503 Ga0501074_0021251
504 Ga0501075_0001173
505 Ga0501075_0166136
506 Ga0501075_0280114
507 Ga0501075_0388732
508 Ga0501076_0005481
509 Ga0501076_0657585
510 Ga0501077_0000210
511 Ga0501077_0157511
512 Ga0501077_0652643
513 Ga0501209_068462
514 Ga0501079_0000228
515 Ga0501079_0145802
516 Ga0501079_0774875
517 Ga0501080_0002897
518 Ga0501080_0122932
519 Ga0501081_0000513
520 Ga0501081_0119406
521 Ga0501081_0205449
522 Ga0501083_0090527
523 Ga0501035_0034390
524 Ga0501035_0041014
525 Ga0501044_0549325
526 Ga0501044_0833075
527 Ga0501045_0001724
528 Ga0501045_0256366
529 Ga0501045_0487265
530 Ga0501045_0627997
531 nmdc:mga05p37_1234621_c1
532 nmdc:mga05p37_1380_c1
533 nmdc:mga05p37_314647_c1
534 nmdc:mga05p37_33906_c1
535 nmdc:mga05p37_463060_c1
536 nmdc:mga05p37_7857_c1
537 nmdc:mga09592_110894_c1
538 nmdc:mga09592_276854_c1
539 nmdc:mga0qj67_202026_c1
540 nmdc:mga0qj67_456517_c1
541 nmdc:mga0qj67_962029_c1
542 nmdc:mga06r32_193150_c1
543 nmdc:mga06r32_209199_c1
544 nmdc:mga06r32_245547_c1
545 nmdc:mga06r32_379567_c1
546 nmdc:mga06r32_40427_c1
547 nmdc:mga06r32_524142_c1
548 nmdc:mga06r32_621867_c1
549 nmdc:mga08y16_133915_c1
550 nmdc:mga08y16_439783_c1
551 nmdc:mga08y16_821308_c1
552 nmdc:mga08y16_908735_c1
553 nmdc:mga08y16_995555_c1
554 nmdc:mga0n895_1046349_c1
555 nmdc:mga0n895_120041_c1
556 nmdc:mga0n895_196074_c1
557 nmdc:mga0n895_3323_c1
558 nmdc:mga0n895_408198_c1
559 nmdc:mga0n895_416683_c1
560 nmdc:mga0n895_58771_c1
561 nmdc:mga0rr50_103483_c1
562 nmdc:mga0rr50_116349_c1
563 nmdc:mga0rr50_140262_c1
564 nmdc:mga0rr50_200937_c1
565 nmdc:mga08x19_111544_c1
566 nmdc:mga08x19_127013_c1
567 nmdc:mga08x19_286711_c1
568 nmdc:mga0a205_140220_c1
569 nmdc:mga0a205_192230_c1
570 nmdc:mga0a205_326172_c1
571 nmdc:mga0a205_373161_c1
572 nmdc:mga0a205_598661_c1
573 nmdc:mga0a205_77703_c1
574 Ga0495619_0191098
575 Ga0501084_0000162
576 Ga0501084_0121986
577 Ga0501084_0378882
578 Ga0501084_0598366
579 Ga0590074_004976
580 Ga0590077_009731
581 Ga0501082_0011638
582 Ga0501082_0046250
583 Ga0530510_0054418
584 Ga0530510_0104167
585 Ga0530510_0134704
586 Ga0530510_0158369

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

6

141

0.93

PF02525

Flavodoxin_2

Flavodoxin-like fold

7

114

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bx9-assembly1.cif.gz_A purification, characterization and x-ray structure of yhda-type azoreductase from bacillus velezensis 0.8591 8 174
2gsw-assembly2.cif.gz_D crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 0.8583 9 177
3s2y-assembly1.cif.gz_A crystal structure of a chromate/uranium reductase from gluconacetobacter hansenii 0.8577 5 178
3gfq-assembly1.cif.gz_A structure of yhda, k109l variant 0.8572 9 176
1x77-assembly1.cif.gz_B crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn 0.8523 6 172
ID Description Score Start End Superfamily
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8523 6 172 3.40.50.360
2gswD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8475 10 177 3.40.50.360
2gswD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8333 10 177 3.40.50.360
af_Q2G0L7_1_184_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8268 6 176 3.40.50.360
af_Q2G135_1_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8185 8 179 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A2V8D3F2-F1-model_v4 NADPH-dependent FMN reductase 0.9608 2 188 GO:0005829
GO:0010181
GO:0016491
AF-A0A1Q8BKZ5-F1-model_v4 NADPH-dependent FMN reductase 0.9604 3 139 GO:0005829
GO:0010181
GO:0016491
AF-A0A1Y0RH12-F1-model_v4 NADPH-dependent FMN reductase 0.959 1 189 GO:0005829
GO:0010181
GO:0016491
AF-A0A534QA18-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9555 1 189 GO:0005829
GO:0010181
GO:0016491
AF-A0A1Y0RH12-F1-model_v4 NADPH-dependent FMN reductase 0.954 1 189 GO:0005829
GO:0010181
GO:0016491

Map