F391723

General Info

Members Datasets Scaffolds Average Seq Length
293 203 586 151

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0130695|Ga0496126_0130695_1311_1805
Length 164
Sequence LIEDSMSVQVSSAHLSPADNALTPAQRDDLRVIAGMMIPESAEYKVPGADDAAVQADILATMGRETDSVRAALEHLARLAGLPLAQLDDSRRDAVASEFRAGGGAPAATLIRVILQCYYRDDRVLRSLNLELRPPFPRGYELEQGDWSLLDPVKARPAMWRKAP

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
107 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
185 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
190 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
191 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
192 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
193 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
194 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
196 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
197 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
198 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
199 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
200 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
201 2904699407
202 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
203 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 0.68
Isolates 2.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.46
Nodule 1.71
Rhizoplane 3.41
Rhizosphere 75.43
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0130695 3300048929 Bacteria 2170
2 JGI25165J46597_1016746 3300003214 Bacteria 981
3 Ga0070658_11033260 3300005327 Bacteria 715
4 Ga0070683_100061473 3300005329 Bacteria 3493
5 Ga0070680_100158788 3300005336 Bacteria 1900
6 Ga0068868_101267202 3300005338 Bacteria 684
7 Ga0070660_100355468 3300005339 Bacteria 1207
8 Ga0070691_10535990 3300005341 Bacteria 682
9 Ga0070687_100741059 3300005343 Bacteria 690
10 Ga0070661_100380404 3300005344 Bacteria 1113
11 Ga0070667_100669765 3300005367 Bacteria 959
12 Ga0070709_10708802 3300005434 Bacteria 784
13 Ga0070714_100062540 3300005435 Bacteria 3200
14 Ga0070714_101019663 3300005435 Bacteria 805
15 Ga0070714_101656825 3300005435 Bacteria 625
16 Ga0070713_100310287 3300005436 Bacteria 1454
17 Ga0070713_101832172 3300005436 Bacteria 589
18 Ga0070710_10027282 3300005437 Bacteria 3043
19 Ga0070710_11180614 3300005437 Bacteria 565
20 Ga0070711_100235406 3300005439 Bacteria 1429
21 Ga0070711_100750024 3300005439 Bacteria 825
22 Ga0070681_10016845 3300005458 Bacteria 7299
23 Ga0070681_10243592 3300005458 Bacteria 1711
24 Ga0070681_10666377 3300005458 Bacteria 956
25 Ga0070698_100084421 3300005471 Bacteria 3164
26 Ga0070699_100567631 3300005518 Bacteria 1033
27 Ga0070679_100015869 3300005530 Bacteria 7248
28 Ga0070679_100150453 3300005530 Bacteria 2304
29 Ga0070684_100111571 3300005535 Bacteria 2452
30 Ga0070684_100155374 3300005535 Bacteria 2074
31 Ga0070697_101174147 3300005536 Unclassified 684
32 Ga0068853_100408540 3300005539 Bacteria 1272
33 Ga0068853_100685434 3300005539 Bacteria 977
34 Ga0070665_102057632 3300005548 Bacteria 576
35 Ga0068855_100105898 3300005563 Bacteria 3233
36 Ga0068855_100394993 3300005563 Bacteria 1516
37 Ga0068857_100095777 3300005577 Bacteria 2660
38 Ga0068852_100372266 3300005616 Bacteria 1400
39 Ga0068859_100319363 3300005617 Bacteria 1647
40 Ga0068864_100267292 3300005618 Bacteria 1593
41 Ga0068863_100212331 3300005841 Bacteria 1864
42 Ga0068863_100518603 3300005841 Bacteria 1175
43 Ga0068858_101577653 3300005842 Bacteria 648
44 Ga0068860_100000101 3300005843 Bacteria 142856
45 Ga0081540_1052813 3300005983 Bacteria 1997
46 Ga0070717_10645369 3300006028 Bacteria 961
47 Ga0070715_10156421 3300006163 Bacteria 1122
48 Ga0070716_100135105 3300006173 Bacteria 1565
49 Ga0070716_101473302 3300006173 Bacteria 555
50 Ga0070712_100396778 3300006175 Bacteria 1138
51 Ga0068871_101009922 3300006358 Bacteria 775
52 Ga0075434_100784014 3300006871 Bacteria 970
53 Ga0097620_100319351 3300006931 Bacteria 1647
54 Ga0099794_10125266 3300007265 Bacteria 1295
55 Ga0099794_10167301 3300007265 Bacteria 1120
56 Ga0099795_10030850 3300007788 Bacteria 1842
57 Ga0099795_10097792 3300007788 Bacteria 1147
58 Ga0105240_10309475 3300009093 Bacteria 1804
59 Ga0105240_10656922 3300009093 Bacteria 1148
60 Ga0105245_10431881 3300009098 Bacteria 1322
61 Ga0105241_10018703 3300009174 Bacteria 5101
62 Ga0105241_10293482 3300009174 Bacteria 1393
63 Ga0105242_10085863 3300009176 Bacteria 2640
64 Ga0105237_10075786 3300009545 Bacteria 3354
65 Ga0105237_10110014 3300009545 Bacteria 2747
66 Ga0105237_10247400 3300009545 Bacteria 1785
67 Ga0105238_10005265 3300009551 Bacteria 12792
68 Ga0105238_10143886 3300009551 Bacteria 2361
69 Ga0105238_10193068 3300009551 Bacteria 2012
70 Ga0105249_10763704 3300009553 Bacteria 1029
71 Ga0105249_11370817 3300009553 Bacteria 779
72 Ga0099796_10012416 3300010159 Bacteria 2405
73 Ga0099796_10120466 3300010159 Bacteria 1008
74 Ga0105239_10012069 3300010375 Bacteria 9634
75 Ga0105239_10559058 3300010375 Bacteria 1303
76 Ga0105239_12216233 3300010375 Bacteria 639
77 Ga0157343_1022161 3300012488 Bacteria 584
78 Ga0157370_10248385 3300013104 Bacteria 1646
79 Ga0157369_10007166 3300013105 Bacteria 12850
80 Ga0157369_11071064 3300013105 Bacteria 824
81 Ga0157378_10003223 3300013297 Bacteria 14514
82 Ga0157372_10068401 3300013307 Bacteria 3993
83 Ga0157372_10718490 3300013307 Bacteria 1162
84 Ga0157372_11813100 3300013307 Bacteria 702
85 Ga0163163_11230556 3300014325 Bacteria 811
86 Ga0157379_10297885 3300014968 Bacteria 1469
87 Ga0197907_11380685 3300020069 Bacteria 1421
88 Ga0206356_10677032 3300020070 Bacteria 793
89 Ga0213876_10089838 3300021384 Bacteria 1627
90 Ga0213876_10146057 3300021384 Bacteria 1258
91 Ga0213876_10153589 3300021384 Bacteria 1224
92 Ga0213871_10026773 3300021441 Bacteria 1478
93 Ga0209148_1004720 3300025254 Bacteria 3279
94 Ga0209233_1001744 3300025261 Bacteria 8396
95 Ga0209455_1004381 3300025272 Bacteria 4645
96 Ga0207692_11038291 3300025898 Bacteria 542
97 Ga0207647_10117650 3300025904 Bacteria 1568
98 Ga0207685_10212011 3300025905 Bacteria 916
99 Ga0207699_10074189 3300025906 Bacteria 2089
100 Ga0207654_10039941 3300025911 Bacteria 2642
101 Ga0207707_10000482 3300025912 Bacteria 41345
102 Ga0207707_10048886 3300025912 Bacteria 3685
103 Ga0207707_10062266 3300025912 Bacteria 3246
104 Ga0207695_10485806 3300025913 Bacteria 1117
105 Ga0207671_10034002 3300025914 Bacteria 3791
106 Ga0207671_10100673 3300025914 Bacteria 2188
107 Ga0207693_10132184 3300025915 Bacteria 1962
108 Ga0207663_10122600 3300025916 Bacteria 1782
109 Ga0207660_10064726 3300025917 Bacteria 2640
110 Ga0207652_10004341 3300025921 Bacteria 11553
111 Ga0207652_10011367 3300025921 Bacteria 7173
112 Ga0207652_10068238 3300025921 Bacteria 3085
113 Ga0207652_10308236 3300025921 Bacteria 1429
114 Ga0207646_10711798 3300025922 Bacteria 897
115 Ga0207694_10173468 3300025924 Bacteria 1747
116 Ga0207687_10972621 3300025927 Bacteria 727
117 Ga0207700_10365158 3300025928 Bacteria 1259
118 Ga0207700_11532495 3300025928 Bacteria 591
119 Ga0207664_10048814 3300025929 Bacteria 3330
120 Ga0207664_10559183 3300025929 Bacteria 1027
121 Ga0207686_10563071 3300025934 Bacteria 892
122 Ga0207665_10171050 3300025939 Bacteria 1569
123 Ga0207665_10416325 3300025939 Bacteria 1026
124 Ga0207711_10415784 3300025941 Bacteria 1250
125 Ga0207661_10006849 3300025944 Bacteria 8077
126 Ga0207661_10035383 3300025944 Bacteria 3891
127 Ga0207661_11218071 3300025944 Bacteria 692
128 Ga0207667_10362835 3300025949 Bacteria 1477
129 Ga0207667_10497230 3300025949 Bacteria 1237
130 Ga0207658_10394004 3300025986 Bacteria 1216
131 Ga0207703_10370388 3300026035 Bacteria 1323
132 Ga0207639_10108202 3300026041 Bacteria 2260
133 Ga0207639_10433377 3300026041 Bacteria 1191
134 Ga0207702_10000748 3300026078 Bacteria 34672
135 Ga0207702_10694821 3300026078 Bacteria 1002
136 Ga0207641_11976911 3300026088 Bacteria 584
137 Ga0207676_10550828 3300026095 Bacteria 1102
138 Ga0207674_10099022 3300026116 Bacteria 2898
139 Ga0207674_10213325 3300026116 Bacteria 1879
140 Ga0207674_10655230 3300026116 Bacteria 1014
141 Ga0207683_10853120 3300026121 Bacteria 845
142 Ga0207698_10673681 3300026142 Bacteria 1027
143 Ga0209179_1013392 3300027512 Bacteria 1489
144 Ga0209179_1037473 3300027512 Bacteria 1012
145 Ga0209179_1037598 3300027512 Bacteria 1011
146 Ga0209588_1000546 3300027671 Bacteria 9684
147 Ga0268264_10000030 3300028381 Bacteria 418542
148 Ga0268264_11596307 3300028381 Bacteria 663
149 Ga0307511_10196204 3300030521 Bacteria 1057
150 Ga0307509_10320358 3300031507 Bacteria 1287
151 Ga0307509_10371169 3300031507 Bacteria 1147
152 Ga0307509_10656506 3300031507 Bacteria 717
153 Ga0307408_100451758 3300031548 Bacteria 1115
154 Ga0307508_10001664 3300031616 Bacteria 24707
155 Ga0307508_10109789 3300031616 Bacteria 2358
156 Ga0307508_10609123 3300031616 Bacteria 694
157 Ga0307516_10015865 3300031730 Bacteria 7905
158 Ga0307516_10053680 3300031730 Bacteria 3940
159 Ga0307516_10192893 3300031730 Bacteria 1762
160 Ga0307516_10412285 3300031730 Bacteria 1009
161 Ga0307507_10014479 3300033179 Bacteria 9395
162 Ga0373926_0019834 3300035083 Bacteria 2320
163 Ga0373928_0008427 3300035084 Bacteria 2002
164 Ga0373923_0004617 3300035111 Bacteria 4586
165 Ga0373923_0161557 3300035111 Bacteria 1022
166 Ga0373939_0191918 3300035114 Bacteria 768
167 Ga0373945_0020686 3300035116 Bacteria 2255
168 Ga0373957_0012405 3300035120 Bacteria 2869
169 Ga0373955_0258043 3300035172 Bacteria 1046
170 Ga0373924_0364610 3300035410 Bacteria 644
171 Ga0373931_0003557 3300035691 Bacteria 7027
172 Ga0373935_0138441 3300035692 Bacteria 1642
173 Ga0373935_0191942 3300035692 Bacteria 1407
174 Ga0373927_0031613 3300035695 Bacteria 3448
175 Ga0373927_0048267 3300035695 Bacteria 2754
176 Ga0373927_0100111 3300035695 Bacteria 1885
177 Ga0373933_0015635 3300035724 Bacteria 4233
178 Ga0373947_0034017 3300035725 Bacteria 3013
179 Ga0373937_0436271 3300036401 Bacteria 1243
180 Ga0373925_0054462 3300037068 Bacteria 2992
181 Ga0373925_0168707 3300037068 Bacteria 1727
182 Ga0395900_0939186 3300037418 Bacteria 787
183 Ga0436364_0837410 3300037853 Bacteria 802
184 Ga0395901_0685384 3300038443 Bacteria 1024
185 Ga0436365_0730976 3300039437 Bacteria 1503
186 Ga0436365_1134139 3300039437 Bacteria 4626
187 Ga0436365_1151131 3300039437 Bacteria 2223
188 Ga0436365_1470648 3300039437 Bacteria 1198
189 Ga0436365_1542713 3300039437 Bacteria 1465
190 Ga0436360_1318296 3300039438 Bacteria 2614
191 Ga0436361_0078881 3300039447 Bacteria 1050
192 Ga0436361_0097046 3300039447 Bacteria 2084
193 Ga0436363_0065056 3300039450 Bacteria 3057
194 Ga0436363_0261509 3300039450 Bacteria 632
195 Ga0436362_1230501 3300039453 Bacteria 749
196 Ga0466965_0916965 3300044683 Bacteria 512
197 Ga0466963_0023239 3300044694 Bacteria 3934
198 Ga0466963_0058595 3300044694 Bacteria 2568
199 Ga0466964_0156694 3300044706 Bacteria 1061
200 Ga0466971_0287738 3300044719 Bacteria 787
201 Ga0466968_0489047 3300044735 Bacteria 612
202 Ga0466970_0435881 3300044765 Bacteria 750
203 Ga0466970_0474116 3300044765 Bacteria 719
204 Ga0466957_0154734 3300044842 Bacteria 1485
205 Ga0466959_0032238 3300045049 Bacteria 3879
206 Ga0466958_0059581 3300045836 Bacteria 2323
207 Ga0466967_0191568 3300045976 Bacteria 1933
208 Ga0466967_0353107 3300045976 Bacteria 1423
209 Ga0466967_1940509 3300045976 Bacteria 585
210 Ga0495603_0415436 3300046455 Bacteria 771
211 Ga0495580_0019507 3300046472 Bacteria 5038
212 Ga0495580_1104342 3300046472 Bacteria 501
213 Ga0495582_0017012 3300046473 Bacteria 3981
214 Ga0495664_0075228 3300046477 Bacteria 2020
215 Ga0495594_0197455 3300046499 Bacteria 1147
216 Ga0495606_0211303 3300046507 Bacteria 1099
217 Ga0495618_0023270 3300046514 Bacteria 3830
218 Ga0495628_0157077 3300046516 Bacteria 1730
219 Ga0495630_0223898 3300046517 Bacteria 1436
220 Ga0495665_0058142 3300046531 Bacteria 2042
221 Ga0495640_0095360 3300046533 Bacteria 1958
222 Ga0495645_0618777 3300046543 Bacteria 664
223 Ga0495645_0717976 3300046543 Bacteria 605
224 Ga0495622_0184182 3300046557 Bacteria 936
225 Ga0495634_0112329 3300046642 Bacteria 1751
226 Ga0495634_0843116 3300046642 Bacteria 521
227 Ga0495635_0047442 3300046663 Bacteria 2962
228 Ga0495599_0120518 3300046678 Bacteria 1631
229 Ga0495646_0054679 3300046680 Bacteria 2400
230 Ga0495658_0080027 3300046683 Bacteria 1916
231 Ga0495658_0488495 3300046683 Bacteria 787
232 Ga0495674_0042360 3300047319 Bacteria 4061
233 Ga0495674_0913128 3300047319 Bacteria 677
234 Ga0495680_0774956 3300047322 Bacteria 628
235 Ga0495684_0008125 3300047471 Bacteria 8114
236 Ga0495593_0020228 3300047673 Bacteria 3728
237 Ga0496100_0241760 3300048903 Bacteria 1332
238 Ga0496101_0190293 3300048904 Bacteria 1583
239 Ga0496102_0015804 3300048905 Bacteria 6580
240 Ga0496103_0054709 3300048906 Bacteria 2474
241 Ga0496105_0123069 3300048908 Bacteria 2138
242 Ga0496106_0001705 3300048909 Bacteria 16424
243 Ga0496106_0097418 3300048909 Bacteria 2277
244 Ga0496109_1023778 3300048912 Bacteria 763
245 Ga0496112_0177194 3300048915 Bacteria 2096
246 Ga0496113_0043994 3300048916 Bacteria 3306
247 Ga0496117_0038236 3300048920 Bacteria 3563
248 Ga0496118_0016702 3300048921 Bacteria 6721
249 Ga0496119_0056553 3300048922 Bacteria 2377
250 Ga0496121_0000089 3300048924 Bacteria 219007
251 Ga0496121_0070214 3300048924 Bacteria 2823
252 Ga0496121_0210365 3300048924 Bacteria 1378
253 Ga0496121_0212519 3300048924 Bacteria 1369
254 Ga0496121_0484903 3300048924 Bacteria 788
255 Ga0496121_0640574 3300048924 Bacteria 649
256 Ga0496124_0004464 3300048927 Bacteria 16323
257 Ga0496125_0099563 3300048928 Bacteria 2146
258 Ga0496126_0023325 3300048929 Bacteria 5997
259 Ga0496126_0139964 3300048929 Bacteria 2084
260 Ga0496126_1249143 3300048929 Bacteria 544
261 Ga0501047_0186692 3300049581 Bacteria 1938
262 Ga0501048_0409233 3300049582 Bacteria 970
263 Ga0501070_0024036 3300049586 Bacteria 5110
264 Ga0501074_0025839 3300049590 Bacteria 4261
265 Ga0501080_0023763 3300049742 Bacteria 5680
266 Ga0501044_0040017 3300049823 Bacteria 4888
267 Ga0495601_0106124 3300053077 Bacteria 1817
268 Ga0495601_0287935 3300053077 Bacteria 1071
269 Ga0495601_0460356 3300053077 Bacteria 822
270 Ga0495612_0021595 3300053078 Bacteria 2582
271 Ga0500635_0038942 3300053080 Bacteria 1579
272 Ga0495595_0082109 3300053084 Bacteria 1537
273 Ga0495619_0203208 3300053085 Bacteria 1372
274 Ga0500595_034365 3300053119 Bacteria 1677
275 Ga0500559_0019051 3300053136 Bacteria 2900
276 Ga0500573_0004501 3300053140 Bacteria 7360
277 Ga0500603_000103 3300053150 Bacteria 20164
278 Ga0500638_087669 3300053162 Bacteria 1470
279 Ga0500638_255648 3300053162 Bacteria 702
280 Ga0500636_0010678 3300053177 Bacteria 5361
281 Ga0500636_0090821 3300053177 Bacteria 1749
282 Ga0500637_0000306 3300053178 Bacteria 18307
283 Ga0500637_0129296 3300053178 Bacteria 1464
284 Ga0500552_013727 3300053733 Bacteria 1057
285 Ga0466962_0748351 3300061719 Bacteria 503
286 2513657169 2513237096 Bacteria 8722461
287 2513919177 2513237145 Bacteria 8979722
288 2517891130 2517572143 Bacteria 9484767
289 2874630104 2874628541 Bacteria 8630250
290 2903752248 2903748898 Bacteria 9972761
291 2904700993
292 8006939229 8006933436 Bacteria 10410654
293 8006978887 8006973647 Bacteria 10679141
294 Ga0496126_0130695
295 JGI25165J46597_1016746
296 Ga0070658_11033260
297 Ga0070683_100061473
298 Ga0070680_100158788
299 Ga0068868_101267202
300 Ga0070660_100355468
301 Ga0070691_10535990
302 Ga0070687_100741059
303 Ga0070661_100380404
304 Ga0070667_100669765
305 Ga0070709_10708802
306 Ga0070714_100062540
307 Ga0070714_101019663
308 Ga0070714_101656825
309 Ga0070713_100310287
310 Ga0070713_101832172
311 Ga0070710_10027282
312 Ga0070710_11180614
313 Ga0070711_100235406
314 Ga0070711_100750024
315 Ga0070681_10016845
316 Ga0070681_10243592
317 Ga0070681_10666377
318 Ga0070698_100084421
319 Ga0070699_100567631
320 Ga0070679_100015869
321 Ga0070679_100150453
322 Ga0070684_100111571
323 Ga0070684_100155374
324 Ga0070697_101174147
325 Ga0068853_100408540
326 Ga0068853_100685434
327 Ga0070665_102057632
328 Ga0068855_100105898
329 Ga0068855_100394993
330 Ga0068857_100095777
331 Ga0068852_100372266
332 Ga0068859_100319363
333 Ga0068864_100267292
334 Ga0068863_100212331
335 Ga0068863_100518603
336 Ga0068858_101577653
337 Ga0068860_100000101
338 Ga0081540_1052813
339 Ga0070717_10645369
340 Ga0070715_10156421
341 Ga0070716_100135105
342 Ga0070716_101473302
343 Ga0070712_100396778
344 Ga0068871_101009922
345 Ga0075434_100784014
346 Ga0097620_100319351
347 Ga0099794_10125266
348 Ga0099794_10167301
349 Ga0099795_10030850
350 Ga0099795_10097792
351 Ga0105240_10309475
352 Ga0105240_10656922
353 Ga0105245_10431881
354 Ga0105241_10018703
355 Ga0105241_10293482
356 Ga0105242_10085863
357 Ga0105237_10075786
358 Ga0105237_10110014
359 Ga0105237_10247400
360 Ga0105238_10005265
361 Ga0105238_10143886
362 Ga0105238_10193068
363 Ga0105249_10763704
364 Ga0105249_11370817
365 Ga0099796_10012416
366 Ga0099796_10120466
367 Ga0105239_10012069
368 Ga0105239_10559058
369 Ga0105239_12216233
370 Ga0157343_1022161
371 Ga0157370_10248385
372 Ga0157369_10007166
373 Ga0157369_11071064
374 Ga0157378_10003223
375 Ga0157372_10068401
376 Ga0157372_10718490
377 Ga0157372_11813100
378 Ga0163163_11230556
379 Ga0157379_10297885
380 Ga0197907_11380685
381 Ga0206356_10677032
382 Ga0213876_10089838
383 Ga0213876_10146057
384 Ga0213876_10153589
385 Ga0213871_10026773
386 Ga0209148_1004720
387 Ga0209233_1001744
388 Ga0209455_1004381
389 Ga0207692_11038291
390 Ga0207647_10117650
391 Ga0207685_10212011
392 Ga0207699_10074189
393 Ga0207654_10039941
394 Ga0207707_10000482
395 Ga0207707_10048886
396 Ga0207707_10062266
397 Ga0207695_10485806
398 Ga0207671_10034002
399 Ga0207671_10100673
400 Ga0207693_10132184
401 Ga0207663_10122600
402 Ga0207660_10064726
403 Ga0207652_10004341
404 Ga0207652_10011367
405 Ga0207652_10068238
406 Ga0207652_10308236
407 Ga0207646_10711798
408 Ga0207694_10173468
409 Ga0207687_10972621
410 Ga0207700_10365158
411 Ga0207700_11532495
412 Ga0207664_10048814
413 Ga0207664_10559183
414 Ga0207686_10563071
415 Ga0207665_10171050
416 Ga0207665_10416325
417 Ga0207711_10415784
418 Ga0207661_10006849
419 Ga0207661_10035383
420 Ga0207661_11218071
421 Ga0207667_10362835
422 Ga0207667_10497230
423 Ga0207658_10394004
424 Ga0207703_10370388
425 Ga0207639_10108202
426 Ga0207639_10433377
427 Ga0207702_10000748
428 Ga0207702_10694821
429 Ga0207641_11976911
430 Ga0207676_10550828
431 Ga0207674_10099022
432 Ga0207674_10213325
433 Ga0207674_10655230
434 Ga0207683_10853120
435 Ga0207698_10673681
436 Ga0209179_1013392
437 Ga0209179_1037473
438 Ga0209179_1037598
439 Ga0209588_1000546
440 Ga0268264_10000030
441 Ga0268264_11596307
442 Ga0307511_10196204
443 Ga0307509_10320358
444 Ga0307509_10371169
445 Ga0307509_10656506
446 Ga0307408_100451758
447 Ga0307508_10001664
448 Ga0307508_10109789
449 Ga0307508_10609123
450 Ga0307516_10015865
451 Ga0307516_10053680
452 Ga0307516_10192893
453 Ga0307516_10412285
454 Ga0307507_10014479
455 Ga0373926_0019834
456 Ga0373928_0008427
457 Ga0373923_0004617
458 Ga0373923_0161557
459 Ga0373939_0191918
460 Ga0373945_0020686
461 Ga0373957_0012405
462 Ga0373955_0258043
463 Ga0373924_0364610
464 Ga0373931_0003557
465 Ga0373935_0138441
466 Ga0373935_0191942
467 Ga0373927_0031613
468 Ga0373927_0048267
469 Ga0373927_0100111
470 Ga0373933_0015635
471 Ga0373947_0034017
472 Ga0373937_0436271
473 Ga0373925_0054462
474 Ga0373925_0168707
475 Ga0395900_0939186
476 Ga0436364_0837410
477 Ga0395901_0685384
478 Ga0436365_0730976
479 Ga0436365_1134139
480 Ga0436365_1151131
481 Ga0436365_1470648
482 Ga0436365_1542713
483 Ga0436360_1318296
484 Ga0436361_0078881
485 Ga0436361_0097046
486 Ga0436363_0065056
487 Ga0436363_0261509
488 Ga0436362_1230501
489 Ga0466965_0916965
490 Ga0466963_0023239
491 Ga0466963_0058595
492 Ga0466964_0156694
493 Ga0466971_0287738
494 Ga0466968_0489047
495 Ga0466970_0435881
496 Ga0466970_0474116
497 Ga0466957_0154734
498 Ga0466959_0032238
499 Ga0466958_0059581
500 Ga0466967_0191568
501 Ga0466967_0353107
502 Ga0466967_1940509
503 Ga0495603_0415436
504 Ga0495580_0019507
505 Ga0495580_1104342
506 Ga0495582_0017012
507 Ga0495664_0075228
508 Ga0495594_0197455
509 Ga0495606_0211303
510 Ga0495618_0023270
511 Ga0495628_0157077
512 Ga0495630_0223898
513 Ga0495665_0058142
514 Ga0495640_0095360
515 Ga0495645_0618777
516 Ga0495645_0717976
517 Ga0495622_0184182
518 Ga0495634_0112329
519 Ga0495634_0843116
520 Ga0495635_0047442
521 Ga0495599_0120518
522 Ga0495646_0054679
523 Ga0495658_0080027
524 Ga0495658_0488495
525 Ga0495674_0042360
526 Ga0495674_0913128
527 Ga0495680_0774956
528 Ga0495684_0008125
529 Ga0495593_0020228
530 Ga0496100_0241760
531 Ga0496101_0190293
532 Ga0496102_0015804
533 Ga0496103_0054709
534 Ga0496105_0123069
535 Ga0496106_0001705
536 Ga0496106_0097418
537 Ga0496109_1023778
538 Ga0496112_0177194
539 Ga0496113_0043994
540 Ga0496117_0038236
541 Ga0496118_0016702
542 Ga0496119_0056553
543 Ga0496121_0000089
544 Ga0496121_0070214
545 Ga0496121_0210365
546 Ga0496121_0212519
547 Ga0496121_0484903
548 Ga0496121_0640574
549 Ga0496124_0004464
550 Ga0496125_0099563
551 Ga0496126_0023325
552 Ga0496126_0139964
553 Ga0496126_1249143
554 Ga0501047_0186692
555 Ga0501048_0409233
556 Ga0501070_0024036
557 Ga0501074_0025839
558 Ga0501080_0023763
559 Ga0501044_0040017
560 Ga0495601_0106124
561 Ga0495601_0287935
562 Ga0495601_0460356
563 Ga0495612_0021595
564 Ga0500635_0038942
565 Ga0495595_0082109
566 Ga0495619_0203208
567 Ga0500595_034365
568 Ga0500559_0019051
569 Ga0500573_0004501
570 Ga0500603_000103
571 Ga0500638_087669
572 Ga0500638_255648
573 Ga0500636_0010678
574 Ga0500636_0090821
575 Ga0500637_0000306
576 Ga0500637_0129296
577 Ga0500552_013727
578 Ga0466962_0748351
579 2513657169
580 2513919177
581 2517891130
582 2874630104
583 2903752248
584 2904700993
585 8006939229
586 8006978887

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hxy-assembly3.cif.gz_C crystal structure of xera recombinase 0.4702 49 126
2iml-assembly2.cif.gz_B crystal structure of a hypothetical protein from archaeoglobus fulgidus binding riboflavin 5'-phosphate 0.4259 49 101
6nen-assembly1.cif.gz_A catalytic domain of proteus mirabilis scsc 0.3684 43 116
5l8g-assembly3.cif.gz_X crystal structure of rhodospirillum rubrum rru_a0973 mutant h65a 0.354 44 122
2fu2-assembly1.cif.gz_A crystal structure of protein spy2152 from streptococcus pyogenes 0.3481 54 120
ID Description Score Start End Superfamily
af_Q8CC88_621_757_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.3632 3 86 1.10.8.80
5l89X00 Special;Helix non-globular;Helix Hairpins; 0.3525 44 122 6.10.140.1960
5da5H00 Special;Helix non-globular;Helix Hairpins; 0.3458 42 122 6.10.140.1960
5da5M00 Special;Helix non-globular;Helix Hairpins; 0.3457 42 120 6.10.140.1960
5l8fB00 Special;Helix non-globular;Helix Hairpins; 0.3436 42 122 6.10.140.1960
ID Description Score Start End GO Terms
AF-A0A258CPN5-F1-model_v4 Uncharacterized protein 0.8911 1 128
AF-A0A258CPN5-F1-model_v4 Uncharacterized protein 0.8497 1 128
AF-A0A0R3CW43-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.7878 1 149
AF-A0A7C2S700-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.7839 6 124 GO:0051536
AF-A0A2U3Q640-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.7772 1 149

Map