F391610

General Info

Members Datasets Scaffolds Average Seq Length
293 173 586 130

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0041714|Ga0436364_0041714_4348_4782
Length 144
Sequence LIPRTHFIPEETMSLDVPVALLERAQHGEVDDNDFVECARHSLPYAWQVISSVVADLERAGDTAEFADHEIPPPSESERGQLLRALASDAIRGGLERHFGVKLAFQNCHRVAAFRPAATSGARYQAFISPRGQLLNQSPELRDC

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
83 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
86 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
87 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
105 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
106 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
111 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
153 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
156 2508501039 Frankia saprophytica CN3 Isolate Nodule
157 2517572101 Frankia sp. DC12 Isolate Nodule
158 2547132424 Nocardia nova SH22a Isolate Unclassified
159 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
160 2643221692 Nocardia sp. Root136 Isolate Unclassified
161 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
162 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
163 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
164 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
165 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
166 2858868258 Micromonospora sp. MH33 Isolate Unclassified
167 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
168 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
169 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
170 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
171 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
172 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
173 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.52
Metatranscriptomes 0.34
Isolates 6.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0.68
Rhizoplane 1.37
Rhizosphere 76.11
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0041714 3300037853 Bacteria 13550
2 JGI25406J46586_10048105 3300003203 Bacteria 1448
3 rootH2_10079632 3300003320 Bacteria 1723
4 rootL2_10009104 3300003322 Bacteria 2001
5 rootH1_10147012 3300003323 Bacteria 1009
6 Ga0070670_100603655 3300005331 Bacteria 982
7 Ga0070670_101277470 3300005331 Bacteria 672
8 Ga0068869_100197977 3300005334 Bacteria 1583
9 Ga0070682_100444043 3300005337 Bacteria 992
10 Ga0068868_101220579 3300005338 Bacteria 696
11 Ga0070689_100455090 3300005340 Bacteria 1090
12 Ga0070689_101515090 3300005340 Bacteria 608
13 Ga0070668_100003240 3300005347 Bacteria 11994
14 Ga0070668_100041359 3300005347 Bacteria 3531
15 Ga0070668_101145625 3300005347 Bacteria 703
16 Ga0070669_100993957 3300005353 Bacteria 720
17 Ga0070671_100573278 3300005355 Bacteria 974
18 Ga0070667_100397174 3300005367 Bacteria 1254
19 Ga0070667_101621579 3300005367 Bacteria 608
20 Ga0070709_11039048 3300005434 Bacteria 653
21 Ga0070709_11689761 3300005434 Bacteria 517
22 Ga0070714_100015137 3300005435 Bacteria 6202
23 Ga0070714_100058523 3300005435 Bacteria 3302
24 Ga0070714_100254077 3300005435 Bacteria 1626
25 Ga0070714_100412362 3300005435 Bacteria 1279
26 Ga0070713_100467108 3300005436 Bacteria 1187
27 Ga0070663_100006807 3300005455 Bacteria 6910
28 Ga0070663_100615939 3300005455 Bacteria 915
29 Ga0070678_100830253 3300005456 Bacteria 841
30 Ga0070678_102220183 3300005456 Bacteria 521
31 Ga0070681_10791864 3300005458 Bacteria 865
32 Ga0070685_10172359 3300005466 Bacteria 1387
33 Ga0070685_10304111 3300005466 Bacteria 1076
34 Ga0070684_101485023 3300005535 Bacteria 639
35 Ga0070695_100962774 3300005545 Bacteria 692
36 Ga0070665_100009285 3300005548 Bacteria 9955
37 Ga0070665_100017531 3300005548 Bacteria 7191
38 Ga0070665_100437175 3300005548 Bacteria 1318
39 Ga0068855_100411311 3300005563 Bacteria 1481
40 Ga0068852_100389268 3300005616 Bacteria 1369
41 Ga0068852_101322233 3300005616 Bacteria 743
42 Ga0068859_100013980 3300005617 Bacteria 8051
43 Ga0068863_100002554 3300005841 Bacteria 18067
44 Ga0068863_100426766 3300005841 Bacteria 1299
45 Ga0068863_100440116 3300005841 Bacteria 1278
46 Ga0068863_100953438 3300005841 Bacteria 859
47 Ga0068860_100040718 3300005843 Bacteria 4440
48 Ga0068862_100000087 3300005844 Bacteria 110040
49 Ga0068862_100382708 3300005844 Bacteria 1313
50 Ga0068862_100872369 3300005844 Bacteria 883
51 Ga0068862_101193659 3300005844 Bacteria 759
52 Ga0081455_10000424 3300005937 Bacteria 55362
53 Ga0081455_10330848 3300005937 Bacteria 1081
54 Ga0081538_10295159 3300005981 Bacteria 597
55 Ga0081540_1071895 3300005983 Bacteria 1596
56 Ga0081540_1163408 3300005983 Bacteria 860
57 Ga0081539_10000309 3300005985 Bacteria 109561
58 Ga0081539_10001575 3300005985 Bacteria 37703
59 Ga0081539_10004071 3300005985 Bacteria 16716
60 Ga0081539_10030327 3300005985 Bacteria 3359
61 Ga0081539_10268593 3300005985 Bacteria 748
62 Ga0075428_100606323 3300006844 Bacteria 1169
63 Ga0075430_100024983 3300006846 Bacteria 5082
64 Ga0075431_100030797 3300006847 Bacteria 5526
65 Ga0075429_100128171 3300006880 Bacteria 2219
66 Ga0097620_100000055 3300006931 Bacteria 119802
67 Ga0097620_100013980 3300006931 Bacteria 8051
68 Ga0097620_100998634 3300006931 Bacteria 919
69 Ga0105251_10252888 3300009011 Bacteria 794
70 Ga0105245_10131773 3300009098 Bacteria 2345
71 Ga0105245_11347649 3300009098 Bacteria 763
72 Ga0105247_10000037 3300009101 Bacteria 165929
73 Ga0114129_10045443 3300009147 Bacteria 6174
74 Ga0114129_10844267 3300009147 Bacteria 1165
75 Ga0105243_11353824 3300009148 Bacteria 731
76 Ga0105241_10955917 3300009174 Bacteria 799
77 Ga0105242_11855511 3300009176 Bacteria 642
78 Ga0105248_10031005 3300009177 Bacteria 5974
79 Ga0105248_10295466 3300009177 Bacteria 1824
80 Ga0105237_12395171 3300009545 Bacteria 538
81 Ga0105238_10714419 3300009551 Bacteria 1015
82 Ga0105249_10005001 3300009553 Bacteria 11440
83 Ga0105249_10738090 3300009553 Bacteria 1046
84 Ga0105249_12336270 3300009553 Bacteria 607
85 Ga0105246_10989789 3300011119 Bacteria 760
86 Ga0105246_11043474 3300011119 Bacteria 743
87 Ga0157371_10291520 3300013102 Bacteria 1180
88 Ga0157374_11077807 3300013296 Bacteria 824
89 Ga0157378_10159560 3300013297 Bacteria 2108
90 Ga0157372_12690398 3300013307 Bacteria 571
91 Ga0163163_10002239 3300014325 Bacteria 16288
92 Ga0163163_10009414 3300014325 Bacteria 8722
93 Ga0157379_10074665 3300014968 Bacteria 3035
94 Ga0157379_10135655 3300014968 Bacteria 2217
95 Ga0157379_10356443 3300014968 Bacteria 1340
96 Ga0213875_10001847 3300021388 Bacteria 13159
97 Ga0213875_10197759 3300021388 Bacteria 945
98 Ga0207710_10000059 3300025900 Bacteria 171838
99 Ga0207705_10245679 3300025909 Bacteria 1364
100 Ga0207650_10615419 3300025925 Bacteria 914
101 Ga0207650_10882016 3300025925 Bacteria 759
102 Ga0207687_11081256 3300025927 Bacteria 689
103 Ga0207664_10019471 3300025929 Bacteria 5017
104 Ga0207664_10272547 3300025929 Bacteria 1483
105 Ga0207711_10017587 3300025941 Bacteria 5939
106 Ga0207689_10606765 3300025942 Bacteria 921
107 Ga0207679_11410353 3300025945 Bacteria 639
108 Ga0207712_10068778 3300025961 Bacteria 2539
109 Ga0207668_10006539 3300025972 Bacteria 6887
110 Ga0207668_10062649 3300025972 Bacteria 2619
111 Ga0207668_10321039 3300025972 Bacteria 1285
112 Ga0207668_10498565 3300025972 Bacteria 1047
113 Ga0207668_11871775 3300025972 Bacteria 541
114 Ga0207658_10174718 3300025986 Bacteria 1773
115 Ga0207703_10032519 3300026035 Bacteria 4129
116 Ga0207678_10000540 3300026067 Bacteria 34528
117 Ga0207641_10002240 3300026088 Bacteria 18067
118 Ga0207641_10383856 3300026088 Bacteria 1346
119 Ga0207674_10484976 3300026116 Bacteria 1195
120 Ga0207675_100149458 3300026118 Bacteria 2222
121 Ga0207675_100855362 3300026118 Bacteria 925
122 Ga0207675_101817339 3300026118 Bacteria 628
123 Ga0207683_10463343 3300026121 Bacteria 1169
124 Ga0207683_10832065 3300026121 Bacteria 857
125 Ga0207698_10164472 3300026142 Bacteria 1945
126 Ga0268266_10006798 3300028379 Bacteria 10421
127 Ga0268266_10020112 3300028379 Bacteria 5691
128 Ga0268266_10249253 3300028379 Bacteria 1642
129 Ga0268265_10000020 3300028380 Bacteria 275575
130 Ga0268265_12205592 3300028380 Bacteria 558
131 Ga0268264_10026384 3300028381 Bacteria 4747
132 Ga0307517_10459128 3300028786 Bacteria 658
133 Ga0307515_10000647 3300028794 Bacteria 80499
134 Ga0307515_10035840 3300028794 Bacteria 8053
135 Ga0307515_10065567 3300028794 Bacteria 5050
136 Ga0307515_10157672 3300028794 Bacteria 2333
137 Ga0307515_10714089 3300028794 Unclassified 619
138 Ga0307511_10000494 3300030521 Bacteria 42578
139 Ga0307511_10004121 3300030521 Bacteria 14844
140 Ga0307511_10116166 3300030521 Bacteria 1678
141 Ga0307512_10020626 3300030522 Bacteria 5956
142 Ga0307512_10022329 3300030522 Bacteria 5689
143 Ga0307513_10016140 3300031456 Bacteria 9021
144 Ga0307513_10053032 3300031456 Bacteria 4362
145 Ga0307513_10088701 3300031456 Bacteria 3160
146 Ga0307513_10382743 3300031456 Bacteria 1146
147 Ga0307509_10009125 3300031507 Bacteria 12469
148 Ga0307509_10186062 3300031507 Bacteria 1935
149 Ga0307508_10007591 3300031616 Bacteria 10080
150 Ga0307508_10063920 3300031616 Bacteria 3246
151 Ga0307508_10251836 3300031616 Bacteria 1362
152 Ga0307508_10847525 3300031616 Bacteria 535
153 Ga0307514_10355035 3300031649 Bacteria 779
154 Ga0307516_10000186 3300031730 Bacteria 80753
155 Ga0307516_10248217 3300031730 Bacteria 1475
156 Ga0307516_10276070 3300031730 Bacteria 1364
157 Ga0307405_10172952 3300031731 Bacteria 1542
158 Ga0307405_10411439 3300031731 Bacteria 1062
159 Ga0307413_10724590 3300031824 Bacteria 829
160 Ga0307518_10000440 3300031838 Bacteria 31800
161 Ga0307518_10024170 3300031838 Bacteria 4381
162 Ga0307518_10314765 3300031838 Bacteria 940
163 Ga0307410_10054354 3300031852 Bacteria 2714
164 Ga0326468_10000176 3300031889 Bacteria 6361
165 Ga0307406_10024080 3300031901 Bacteria 3631
166 Ga0307406_10163250 3300031901 Bacteria 1604
167 Ga0307406_10750134 3300031901 Bacteria 819
168 Ga0307406_10858742 3300031901 Bacteria 770
169 Ga0307407_10110242 3300031903 Bacteria 1726
170 Ga0307407_10122611 3300031903 Bacteria 1650
171 Ga0307412_10323532 3300031911 Bacteria 1228
172 Ga0307409_100024394 3300031995 Bacteria 4217
173 Ga0307409_100103155 3300031995 Bacteria 2371
174 Ga0307409_100656374 3300031995 Bacteria 1043
175 Ga0307416_100085220 3300032002 Bacteria 2688
176 Ga0307416_100158035 3300032002 Bacteria 2090
177 Ga0307416_102590364 3300032002 Bacteria 605
178 Ga0307414_10360837 3300032004 Bacteria 1250
179 Ga0307414_11124555 3300032004 Bacteria 726
180 Ga0307411_10930861 3300032005 Bacteria 774
181 Ga0307415_100049391 3300032126 Bacteria 2844
182 Ga0307415_100161177 3300032126 Bacteria 1739
183 Ga0307415_101032469 3300032126 Bacteria 766
184 Ga0307415_101538529 3300032126 Bacteria 637
185 Ga0307507_10020120 3300033179 Bacteria 7487
186 Ga0307507_10429550 3300033179 Bacteria 738
187 Ga0307510_10276130 3300033180 Bacteria 1153
188 Ga0373932_0157763 3300035112 Bacteria 783
189 Ga0373942_0013259 3300035207 Bacteria 1980
190 Ga0373962_0002225 3300035242 Bacteria 4634
191 Ga0395900_0112755 3300037418 Bacteria 2792
192 Ga0395905_1575051 3300037471 Bacteria 562
193 Ga0436364_0356223 3300037853 Bacteria 973
194 Ga0436364_0398829 3300037853 Unclassified 1163
195 Ga0436364_0460529 3300037853 Bacteria 10223
196 Ga0436364_1121770 3300037853 Bacteria 948
197 Ga0436362_0280574 3300039453 Unclassified 761
198 Ga0451800_1460420 3300041459 Bacteria 828
199 Ga0451837_1084108 3300041494 Bacteria 619
200 Ga0466969_0038563 3300044656 Bacteria 2403
201 Ga0466969_0112526 3300044656 Bacteria 1273
202 Ga0466969_0400563 3300044656 Bacteria 623
203 Ga0466972_0009137 3300044658 Bacteria 4978
204 Ga0466972_0026347 3300044658 Bacteria 2881
205 Ga0466965_0001827 3300044683 Bacteria 8849
206 Ga0466966_0000869 3300044684 Bacteria 19293
207 Ga0466966_0771134 3300044684 Bacteria 580
208 Ga0466963_0005342 3300044694 Bacteria 7512
209 Ga0466963_0688967 3300044694 Bacteria 721
210 Ga0466963_1108301 3300044694 Bacteria 557
211 Ga0466964_0288714 3300044706 Bacteria 823
212 Ga0466971_0002019 3300044719 Bacteria 8586
213 Ga0466968_0088335 3300044735 Bacteria 1370
214 Ga0466968_0092248 3300044735 Bacteria 1344
215 Ga0466968_0127064 3300044735 Bacteria 1158
216 Ga0466970_0001792 3300044765 Bacteria 10349
217 Ga0466970_0059548 3300044765 Bacteria 2045
218 Ga0466970_0215798 3300044765 Bacteria 1070
219 Ga0466957_0002432 3300044842 Bacteria 9999
220 Ga0466957_0048442 3300044842 Bacteria 2583
221 Ga0466957_0087252 3300044842 Bacteria 1951
222 Ga0466957_0284812 3300044842 Bacteria 1107
223 Ga0466957_0912671 3300044842 Bacteria 628
224 Ga0466960_0001649 3300044901 Bacteria 8175
225 Ga0466960_0391062 3300044901 Bacteria 799
226 Ga0466959_0008737 3300045049 Bacteria 7173
227 Ga0466958_0000454 3300045836 Bacteria 17056
228 Ga0466958_0285234 3300045836 Bacteria 1059
229 Ga0466958_0389812 3300045836 Bacteria 899
230 Ga0466967_0001139 3300045976 Bacteria 14834
231 Ga0466967_0066971 3300045976 Bacteria 3202
232 Ga0466967_0110938 3300045976 Bacteria 2520
233 Ga0466967_0226486 3300045976 Bacteria 1779
234 Ga0466967_0358239 3300045976 Bacteria 1413
235 Ga0495607_0012172 3300046501 Bacteria 5689
236 Ga0495632_0066247 3300046519 Bacteria 1743
237 Ga0495632_0157652 3300046519 Bacteria 1047
238 Ga0495668_0000765 3300046616 Bacteria 37647
239 Ga0495625_0000730 3300046660 Bacteria 46115
240 Ga0495683_0001530 3300047323 Bacteria 14993
241 Ga0495626_0000241 3300048091 Bacteria 63323
242 Ga0496104_0441531 3300048907 Bacteria 1213
243 Ga0496107_0093916 3300048910 Bacteria 2194
244 Ga0496111_0312145 3300048914 Bacteria 1165
245 Ga0496117_0031183 3300048920 Bacteria 4074
246 Ga0496118_0027020 3300048921 Bacteria 4868
247 Ga0496119_0010389 3300048922 Bacteria 7840
248 Ga0496119_0046577 3300048922 Bacteria 2707
249 Ga0496120_0000934 3300048923 Bacteria 40221
250 Ga0496120_0075454 3300048923 Bacteria 1840
251 Ga0496120_0208616 3300048923 Bacteria 941
252 Ga0496121_0762793 3300048924 Bacteria 573
253 Ga0496121_0826147 3300048924 Bacteria 542
254 Ga0501318_074555 3300049534 Bacteria 541
255 Ga0501034_1173467 3300049571 Bacteria 647
256 Ga0501047_0039466 3300049581 Bacteria 4566
257 Ga0501047_0949165 3300049581 Bacteria 673
258 Ga0501074_0025649 3300049590 Bacteria 4278
259 Ga0501249_154773 3300049679 Bacteria 579
260 Ga0501044_0348168 3300049823 Bacteria 1402
261 Ga0501044_0991920 3300049823 Bacteria 712
262 Ga0501045_0419245 3300049824 Bacteria 996
263 nmdc:mga05p37_51488_c1 3300050507 Bacteria 5064
264 nmdc:mga09592_1033091_c1 3300050508 Bacteria 686
265 nmdc:mga09592_126552_c1 3300050508 Bacteria 2197
266 nmdc:mga0qj67_335140_c1 3300050509 Bacteria 1224
267 nmdc:mga0qj67_87897_c1 3300050509 Bacteria 2495
268 nmdc:mga06r32_28581_c1 3300050510 Bacteria 5221
269 Ga0495619_0037100 3300053085 Bacteria 3175
270 Ga0500651_0139358 3300053093 Bacteria 1463
271 Ga0500650_0155541 3300053098 Bacteria 1056
272 Ga0501084_0052707 3300054114 Bacteria 3403
273 Ga0466962_0001311 3300061719 Bacteria 11475
274 Ga0466962_0114725 3300061719 Bacteria 1298
275 Ga0466962_0203542 3300061719 Bacteria 968
276 2508672068 2508501039 Bacteria 9978592
277 2517762308 2517572101 Bacteria 6884336
278 2548693073 2547132424 Bacteria 8348532
279 2586057394 2585427649 Bacteria 9053857
280 2644515429 2643221692 Bacteria 7282860
281 2753271537 2751185782 Bacteria 11227053
282 2795794043 2795385472 Bacteria 6627535
283 2809585552 2808606522 Bacteria 9488490
284 2816506640 2816332139 Bacteria 9138787
285 2831938934 2831935698 Bacteria 5963223
286 2858873799 2858868258 Bacteria 7683772
287 2887481011 2887478801 Bacteria 8972725
288 2915359627 2915358134 Bacteria 6050864
289 2915774977 2915768154 Bacteria 8424322
290 2917744897 2917736166 Bacteria 9690793
291 2919717749 2919713450 Bacteria 7431245
292 8003314672 8003314358 Bacteria 10575343
293 8054472801 8054472261 Bacteria 7464355
294 Ga0436364_0041714
295 JGI25406J46586_10048105
296 rootH2_10079632
297 rootL2_10009104
298 rootH1_10147012
299 Ga0070670_100603655
300 Ga0070670_101277470
301 Ga0068869_100197977
302 Ga0070682_100444043
303 Ga0068868_101220579
304 Ga0070689_100455090
305 Ga0070689_101515090
306 Ga0070668_100003240
307 Ga0070668_100041359
308 Ga0070668_101145625
309 Ga0070669_100993957
310 Ga0070671_100573278
311 Ga0070667_100397174
312 Ga0070667_101621579
313 Ga0070709_11039048
314 Ga0070709_11689761
315 Ga0070714_100015137
316 Ga0070714_100058523
317 Ga0070714_100254077
318 Ga0070714_100412362
319 Ga0070713_100467108
320 Ga0070663_100006807
321 Ga0070663_100615939
322 Ga0070678_100830253
323 Ga0070678_102220183
324 Ga0070681_10791864
325 Ga0070685_10172359
326 Ga0070685_10304111
327 Ga0070684_101485023
328 Ga0070695_100962774
329 Ga0070665_100009285
330 Ga0070665_100017531
331 Ga0070665_100437175
332 Ga0068855_100411311
333 Ga0068852_100389268
334 Ga0068852_101322233
335 Ga0068859_100013980
336 Ga0068863_100002554
337 Ga0068863_100426766
338 Ga0068863_100440116
339 Ga0068863_100953438
340 Ga0068860_100040718
341 Ga0068862_100000087
342 Ga0068862_100382708
343 Ga0068862_100872369
344 Ga0068862_101193659
345 Ga0081455_10000424
346 Ga0081455_10330848
347 Ga0081538_10295159
348 Ga0081540_1071895
349 Ga0081540_1163408
350 Ga0081539_10000309
351 Ga0081539_10001575
352 Ga0081539_10004071
353 Ga0081539_10030327
354 Ga0081539_10268593
355 Ga0075428_100606323
356 Ga0075430_100024983
357 Ga0075431_100030797
358 Ga0075429_100128171
359 Ga0097620_100000055
360 Ga0097620_100013980
361 Ga0097620_100998634
362 Ga0105251_10252888
363 Ga0105245_10131773
364 Ga0105245_11347649
365 Ga0105247_10000037
366 Ga0114129_10045443
367 Ga0114129_10844267
368 Ga0105243_11353824
369 Ga0105241_10955917
370 Ga0105242_11855511
371 Ga0105248_10031005
372 Ga0105248_10295466
373 Ga0105237_12395171
374 Ga0105238_10714419
375 Ga0105249_10005001
376 Ga0105249_10738090
377 Ga0105249_12336270
378 Ga0105246_10989789
379 Ga0105246_11043474
380 Ga0157371_10291520
381 Ga0157374_11077807
382 Ga0157378_10159560
383 Ga0157372_12690398
384 Ga0163163_10002239
385 Ga0163163_10009414
386 Ga0157379_10074665
387 Ga0157379_10135655
388 Ga0157379_10356443
389 Ga0213875_10001847
390 Ga0213875_10197759
391 Ga0207710_10000059
392 Ga0207705_10245679
393 Ga0207650_10615419
394 Ga0207650_10882016
395 Ga0207687_11081256
396 Ga0207664_10019471
397 Ga0207664_10272547
398 Ga0207711_10017587
399 Ga0207689_10606765
400 Ga0207679_11410353
401 Ga0207712_10068778
402 Ga0207668_10006539
403 Ga0207668_10062649
404 Ga0207668_10321039
405 Ga0207668_10498565
406 Ga0207668_11871775
407 Ga0207658_10174718
408 Ga0207703_10032519
409 Ga0207678_10000540
410 Ga0207641_10002240
411 Ga0207641_10383856
412 Ga0207674_10484976
413 Ga0207675_100149458
414 Ga0207675_100855362
415 Ga0207675_101817339
416 Ga0207683_10463343
417 Ga0207683_10832065
418 Ga0207698_10164472
419 Ga0268266_10006798
420 Ga0268266_10020112
421 Ga0268266_10249253
422 Ga0268265_10000020
423 Ga0268265_12205592
424 Ga0268264_10026384
425 Ga0307517_10459128
426 Ga0307515_10000647
427 Ga0307515_10035840
428 Ga0307515_10065567
429 Ga0307515_10157672
430 Ga0307515_10714089
431 Ga0307511_10000494
432 Ga0307511_10004121
433 Ga0307511_10116166
434 Ga0307512_10020626
435 Ga0307512_10022329
436 Ga0307513_10016140
437 Ga0307513_10053032
438 Ga0307513_10088701
439 Ga0307513_10382743
440 Ga0307509_10009125
441 Ga0307509_10186062
442 Ga0307508_10007591
443 Ga0307508_10063920
444 Ga0307508_10251836
445 Ga0307508_10847525
446 Ga0307514_10355035
447 Ga0307516_10000186
448 Ga0307516_10248217
449 Ga0307516_10276070
450 Ga0307405_10172952
451 Ga0307405_10411439
452 Ga0307413_10724590
453 Ga0307518_10000440
454 Ga0307518_10024170
455 Ga0307518_10314765
456 Ga0307410_10054354
457 Ga0326468_10000176
458 Ga0307406_10024080
459 Ga0307406_10163250
460 Ga0307406_10750134
461 Ga0307406_10858742
462 Ga0307407_10110242
463 Ga0307407_10122611
464 Ga0307412_10323532
465 Ga0307409_100024394
466 Ga0307409_100103155
467 Ga0307409_100656374
468 Ga0307416_100085220
469 Ga0307416_100158035
470 Ga0307416_102590364
471 Ga0307414_10360837
472 Ga0307414_11124555
473 Ga0307411_10930861
474 Ga0307415_100049391
475 Ga0307415_100161177
476 Ga0307415_101032469
477 Ga0307415_101538529
478 Ga0307507_10020120
479 Ga0307507_10429550
480 Ga0307510_10276130
481 Ga0373932_0157763
482 Ga0373942_0013259
483 Ga0373962_0002225
484 Ga0395900_0112755
485 Ga0395905_1575051
486 Ga0436364_0356223
487 Ga0436364_0398829
488 Ga0436364_0460529
489 Ga0436364_1121770
490 Ga0436362_0280574
491 Ga0451800_1460420
492 Ga0451837_1084108
493 Ga0466969_0038563
494 Ga0466969_0112526
495 Ga0466969_0400563
496 Ga0466972_0009137
497 Ga0466972_0026347
498 Ga0466965_0001827
499 Ga0466966_0000869
500 Ga0466966_0771134
501 Ga0466963_0005342
502 Ga0466963_0688967
503 Ga0466963_1108301
504 Ga0466964_0288714
505 Ga0466971_0002019
506 Ga0466968_0088335
507 Ga0466968_0092248
508 Ga0466968_0127064
509 Ga0466970_0001792
510 Ga0466970_0059548
511 Ga0466970_0215798
512 Ga0466957_0002432
513 Ga0466957_0048442
514 Ga0466957_0087252
515 Ga0466957_0284812
516 Ga0466957_0912671
517 Ga0466960_0001649
518 Ga0466960_0391062
519 Ga0466959_0008737
520 Ga0466958_0000454
521 Ga0466958_0285234
522 Ga0466958_0389812
523 Ga0466967_0001139
524 Ga0466967_0066971
525 Ga0466967_0110938
526 Ga0466967_0226486
527 Ga0466967_0358239
528 Ga0495607_0012172
529 Ga0495632_0066247
530 Ga0495632_0157652
531 Ga0495668_0000765
532 Ga0495625_0000730
533 Ga0495683_0001530
534 Ga0495626_0000241
535 Ga0496104_0441531
536 Ga0496107_0093916
537 Ga0496111_0312145
538 Ga0496117_0031183
539 Ga0496118_0027020
540 Ga0496119_0010389
541 Ga0496119_0046577
542 Ga0496120_0000934
543 Ga0496120_0075454
544 Ga0496120_0208616
545 Ga0496121_0762793
546 Ga0496121_0826147
547 Ga0501318_074555
548 Ga0501034_1173467
549 Ga0501047_0039466
550 Ga0501047_0949165
551 Ga0501074_0025649
552 Ga0501249_154773
553 Ga0501044_0348168
554 Ga0501044_0991920
555 Ga0501045_0419245
556 nmdc:mga05p37_51488_c1
557 nmdc:mga09592_1033091_c1
558 nmdc:mga09592_126552_c1
559 nmdc:mga0qj67_335140_c1
560 nmdc:mga0qj67_87897_c1
561 nmdc:mga06r32_28581_c1
562 Ga0495619_0037100
563 Ga0500651_0139358
564 Ga0500650_0155541
565 Ga0501084_0052707
566 Ga0466962_0001311
567 Ga0466962_0114725
568 Ga0466962_0203542
569 2508672068
570 2517762308
571 2548693073
572 2586057394
573 2644515429
574 2753271537
575 2795794043
576 2809585552
577 2816506640
578 2831938934
579 2858873799
580 2887481011
581 2915359627
582 2915774977
583 2917744897
584 2919717749
585 8003314672
586 8054472801

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20704

NucS_shadow

NucS shadow ORF

13

144

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hf2-assembly1.cif.gz_A domain shifting confirms monomeric structure of escherichia sugar phosphatase suph 0.6139 52 102
3dnp-assembly1.cif.gz_A-2 crystal structure of stress response protein yhax from bacillus subtilis 0.6139 76 102
6qh2-assembly1.cif.gz_A solution nmr ensemble for a chimeric kh-s1 domain construct of exosomal polynucleotide phosphrylase at 298k compiled using the comand method 0.6132 52 114
6scq-assembly1.cif.gz_A cell division protein sepf in complex with c-terminal domain of ftsz 0.6021 36 101
3p04-assembly1.cif.gz_A crystal structure of the bcr protein from corynebacterium glutamicum. northeast structural genomics consortium target cgr8 0.5913 36 101
ID Description Score Start End Superfamily
af_Q54M63_54_230_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.7332 28 54 3.40.140.10
af_Q4DJP9_3_64_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.7094 54 102 3.30.1370.10
af_Q57885_14_94_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.6881 50 101 3.30.1370.10
af_Q9S7G6_609_671_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.6702 50 102 3.30.1370.10
af_Q9V9X7_601_667_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.6557 52 101 3.30.1370.10
ID Description Score Start End GO Terms
AF-A0A4R4LMA7-F1-model_v4 Uncharacterized protein 0.964 1 130
AF-A0A1H3UHL4-F1-model_v4 Uncharacterized protein 0.9596 1 130
AF-A0A3N2P9M4-F1-model_v4 DUF222 domain-containing protein 0.9537 1 130
AF-A0A6I2G011-F1-model_v4 DUF222 domain-containing protein 0.9513 1 130
AF-A0A850DMQ7-F1-model_v4 DUF222 domain-containing protein 0.9506 1 130

Map