F391204

General Info

Members Datasets Scaffolds Average Seq Length
292 180 584 192

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_43437_c1|nmdc:mga0qj67_43437_c1_25_699
Length 224
Sequence VCPGPEEQPEDAFRPVRRACYVPQDPEAPMPMEYDHQFIPPDAVPRARLPLLQHLLDTYASESSKTAAIWTELADTQLEFRPHARSSTVRHILVHQILSERRFFAEFIGLTEPAVETLLPPGEAPGVAAYVERLVALSRARLAPLAAGDEAFWLAEVPFFDVRRQRVWVFWRRVLHTAHHRAQVGLCLRLLEDRVPPTYGPTADVSWTGADPTVTLDAARRRGT

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
99 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
100 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
101 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
114 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
119 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
120 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
121 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
122 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
146 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
147 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
148 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
149 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
150 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
151 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
152 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
153 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
154 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
155 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
156 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
157 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
162 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 3.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 11.3
Rhizosphere 82.88
Stem 0
Stem Tuber 0
Unclassified 20.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_43437_c1 3300050509 Bacteria 3539
2 rootH2_10079551 3300003320 Bacteria 2311
3 rootH2_10181915 3300003320 Bacteria 6096
4 rootH2_10214100 3300003320 Bacteria 1369
5 Ga0058861_10064927 3300004800 Unclassified 1064
6 Ga0058861_11910510 3300004800 Unclassified 780
7 Ga0058862_12390648 3300004803 Unclassified 1005
8 Ga0070658_10334675 3300005327 Bacteria 1294
9 Ga0070683_100180921 3300005329 Bacteria 2001
10 Ga0070680_100002888 3300005336 Bacteria 12779
11 Ga0070680_100028882 3300005336 Bacteria 4451
12 Ga0070680_100779318 3300005336 Unclassified 824
13 Ga0070661_100982417 3300005344 Bacteria 700
14 Ga0070673_100276270 3300005364 Unclassified 1472
15 Ga0070709_10064103 3300005434 Unclassified 2349
16 Ga0070714_100005438 3300005435 Bacteria 9722
17 Ga0070705_100407092 3300005440 Bacteria 1009
18 Ga0070705_100635512 3300005440 Unclassified 830
19 Ga0070705_100924726 3300005440 Bacteria 703
20 Ga0070694_101143130 3300005444 Unclassified 651
21 Ga0070708_100255966 3300005445 Bacteria 1645
22 Ga0070708_100696650 3300005445 Bacteria 956
23 Ga0070678_101205376 3300005456 Bacteria 702
24 Ga0070662_100151841 3300005457 Bacteria 1804
25 Ga0070681_10008513 3300005458 Bacteria 10043
26 Ga0070681_10026613 3300005458 Bacteria 5814
27 Ga0070681_10047319 3300005458 Bacteria 4299
28 Ga0070706_100059936 3300005467 Bacteria 3513
29 Ga0070706_100174093 3300005467 Bacteria 2009
30 Ga0070707_100075641 3300005468 Bacteria 3248
31 Ga0070707_100093049 3300005468 Bacteria 2918
32 Ga0070707_100587913 3300005468 Unclassified 1076
33 Ga0070699_100119175 3300005518 Bacteria 2320
34 Ga0070679_100055143 3300005530 Unclassified 3958
35 Ga0070679_100355017 3300005530 Bacteria 1413
36 Ga0070679_100373663 3300005530 Bacteria 1372
37 Ga0070697_100401515 3300005536 Unclassified 1189
38 Ga0068853_100030288 3300005539 Bacteria 4570
39 Ga0070695_100112573 3300005545 Bacteria 1849
40 Ga0070696_100100083 3300005546 Bacteria 2076
41 Ga0070696_100476755 3300005546 Bacteria 989
42 Ga0070696_100669436 3300005546 Bacteria 843
43 Ga0070665_100637052 3300005548 Unclassified 1079
44 Ga0068855_100000589 3300005563 Bacteria 44536
45 Ga0068855_100009021 3300005563 Bacteria 12051
46 Ga0068854_100573008 3300005578 Bacteria 960
47 Ga0068856_100127913 3300005614 Bacteria 2544
48 Ga0068852_100000025 3300005616 Bacteria 115410
49 Ga0068852_100002368 3300005616 Bacteria 12987
50 Ga0068864_100068462 3300005618 Bacteria 3084
51 Ga0068864_100865701 3300005618 Unclassified 891
52 Ga0068863_100048336 3300005841 Bacteria 4034
53 Ga0068863_100417746 3300005841 Bacteria 1314
54 Ga0068858_100347668 3300005842 Bacteria 1420
55 Ga0068862_100560550 3300005844 Bacteria 1092
56 Ga0081455_10127457 3300005937 Unclassified 1995
57 Ga0070717_10061543 3300006028 Bacteria 3111
58 Ga0070715_10140656 3300006163 Bacteria 1172
59 Ga0075367_10028066 3300006178 Bacteria 3208
60 Ga0075428_100006021 3300006844 Bacteria 13469
61 Ga0075430_100068998 3300006846 Bacteria 2966
62 Ga0075431_100081318 3300006847 Bacteria 3345
63 Ga0075431_100165953 3300006847 Bacteria 2270
64 Ga0075431_101135529 3300006847 Bacteria 745
65 Ga0075433_10021753 3300006852 Bacteria 5380
66 Ga0075433_10070340 3300006852 Bacteria 3075
67 Ga0075433_10122113 3300006852 Bacteria 2313
68 Ga0075434_100552858 3300006871 Bacteria 1171
69 Ga0075429_100068356 3300006880 Bacteria 3092
70 Ga0075436_100409629 3300006914 Unclassified 983
71 Ga0105240_10000280 3300009093 Bacteria 100888
72 Ga0105240_10000837 3300009093 Bacteria 55378
73 Ga0105240_11201983 3300009093 Unclassified 803
74 Ga0111539_10096493 3300009094 Bacteria 3472
75 Ga0111539_10476448 3300009094 Bacteria 1454
76 Ga0105245_10511496 3300009098 Bacteria 1218
77 Ga0114129_10026267 3300009147 Bacteria 8247
78 Ga0114129_11536373 3300009147 Bacteria 817
79 Ga0105248_10192610 3300009177 Bacteria 2297
80 Ga0105237_10014085 3300009545 Bacteria 8366
81 Ga0105239_12021581 3300010375 Bacteria 669
82 Ga0157373_10395249 3300013100 Unclassified 990
83 Ga0157370_10000012 3300013104 Bacteria 201181
84 Ga0157370_10022382 3300013104 Bacteria 6288
85 Ga0157370_10734776 3300013104 Bacteria 900
86 Ga0157369_10000096 3300013105 Bacteria 121542
87 Ga0157369_10001551 3300013105 Bacteria 28112
88 Ga0157369_10149532 3300013105 Bacteria 2468
89 Ga0157372_10000066 3300013307 Bacteria 113120
90 Ga0157372_10019668 3300013307 Bacteria 7276
91 Ga0157372_11286054 3300013307 Unclassified 844
92 Ga0163163_10391518 3300014325 Unclassified 1448
93 Ga0182008_10410929 3300014497 Bacteria 729
94 Ga0154015_1683423 3300020610 Bacteria 659
95 Ga0213876_10001260 3300021384 Bacteria 15980
96 Ga0213876_10176392 3300021384 Bacteria 1137
97 Ga0213875_10026341 3300021388 Bacteria 2766
98 Ga0224712_10179068 3300022467 Unclassified 954
99 Ga0224712_10188161 3300022467 Bacteria 933
100 Ga0207656_10016930 3300025321 Bacteria 2847
101 Ga0207647_10339568 3300025904 Unclassified 851
102 Ga0207684_10229826 3300025910 Bacteria 1601
103 Ga0207707_10002576 3300025912 Bacteria 16243
104 Ga0207707_10005367 3300025912 Bacteria 11203
105 Ga0207707_10045196 3300025912 Bacteria 3838
106 Ga0207707_10478285 3300025912 Bacteria 1064
107 Ga0207695_10000028 3300025913 Bacteria 551835
108 Ga0207695_10003257 3300025913 Bacteria 23077
109 Ga0207671_10001338 3300025914 Bacteria 28821
110 Ga0207671_10076966 3300025914 Bacteria 2497
111 Ga0207663_10392289 3300025916 Bacteria 1060
112 Ga0207660_10003226 3300025917 Bacteria 10674
113 Ga0207660_10018764 3300025917 Bacteria 4616
114 Ga0207662_10257141 3300025918 Bacteria 1148
115 Ga0207652_10015282 3300025921 Bacteria 6232
116 Ga0207652_10044463 3300025921 Bacteria 3783
117 Ga0207646_10092192 3300025922 Bacteria 2712
118 Ga0207646_10549699 3300025922 Unclassified 1038
119 Ga0207690_10302184 3300025932 Bacteria 1252
120 Ga0207706_10164805 3300025933 Bacteria 1948
121 Ga0207669_10962591 3300025937 Unclassified 716
122 Ga0207667_10001049 3300025949 Bacteria 35167
123 Ga0207667_10010168 3300025949 Bacteria 11021
124 Ga0207651_10161297 3300025960 Unclassified 1758
125 Ga0207651_10726736 3300025960 Unclassified 876
126 Ga0207639_10451436 3300026041 Bacteria 1167
127 Ga0207678_10287989 3300026067 Bacteria 1410
128 Ga0207702_10173750 3300026078 Bacteria 1978
129 Ga0207641_10105479 3300026088 Bacteria 2489
130 Ga0207698_10000029 3300026142 Bacteria 116462
131 Ga0207698_10002824 3300026142 Bacteria 10396
132 Ga0207698_10320310 3300026142 Unclassified 1452
133 Ga0209995_1015436 3300027471 Bacteria 1252
134 Ga0268264_10530990 3300028381 Bacteria 1151
135 Ga0307408_100013148 3300031548 Bacteria 5493
136 Ga0307408_100117136 3300031548 Bacteria 2057
137 Ga0307408_100346881 3300031548 Bacteria 1258
138 Ga0307408_100432193 3300031548 Bacteria 1138
139 Ga0307405_10075960 3300031731 Bacteria 2178
140 Ga0307405_10326363 3300031731 Bacteria 1174
141 Ga0307413_10002992 3300031824 Bacteria 7006
142 Ga0307413_10198687 3300031824 Bacteria 1446
143 Ga0307410_10037076 3300031852 Bacteria 3181
144 Ga0307410_10310772 3300031852 Unclassified 1247
145 Ga0307410_10531890 3300031852 Bacteria 972
146 Ga0307406_10001998 3300031901 Bacteria 11134
147 Ga0307406_10168334 3300031901 Bacteria 1583
148 Ga0307407_10071453 3300031903 Bacteria 2066
149 Ga0307412_10042965 3300031911 Bacteria 2941
150 Ga0307412_10617370 3300031911 Bacteria 920
151 Ga0307409_100015405 3300031995 Bacteria 5018
152 Ga0307409_100235415 3300031995 Bacteria 1663
153 Ga0307416_100148347 3300032002 Bacteria 2146
154 Ga0307416_100246795 3300032002 Bacteria 1734
155 Ga0307414_10148894 3300032004 Bacteria 1843
156 Ga0307414_10195670 3300032004 Bacteria 1640
157 Ga0307411_10009564 3300032005 Bacteria 5108
158 Ga0307411_10025590 3300032005 Bacteria 3539
159 Ga0307415_100001367 3300032126 Bacteria 11619
160 Ga0307415_100001701 3300032126 Bacteria 10692
161 Ga0307415_100076150 3300032126 Bacteria 2378
162 Ga0307415_100735008 3300032126 Unclassified 894
163 Ga0373930_0019853 3300034816 Unclassified 1304
164 Ga0373939_0041525 3300035114 Bacteria 1387
165 Ga0373941_0046090 3300035115 Bacteria 1368
166 Ga0373941_0100057 3300035115 Bacteria 1008
167 Ga0373960_0025535 3300035121 Bacteria 1607
168 Ga0373960_0148056 3300035121 Bacteria 800
169 Ga0373943_0010647 3300035170 Unclassified 4127
170 Ga0373946_0085297 3300035171 Unclassified 1390
171 Ga0373962_0051491 3300035242 Bacteria 1188
172 Ga0373931_0075297 3300035691 Bacteria 1851
173 Ga0373931_0185329 3300035691 Unclassified 1235
174 Ga0373927_0000746 3300035695 Bacteria 24846
175 Ga0373947_0490068 3300035725 Unclassified 835
176 Ga0373925_0000708 3300037068 Bacteria 31211
177 Ga0395898_0267343 3300037466 Bacteria 1631
178 Ga0395905_0173151 3300037471 Bacteria 2027
179 Ga0395905_0173474 3300037471 Bacteria 2025
180 Ga0395905_0717531 3300037471 Bacteria 902
181 Ga0436364_0045331 3300037853 Bacteria 11242
182 Ga0436364_0212190 3300037853 Bacteria 6082
183 Ga0436364_0570258 3300037853 Bacteria 2665
184 Ga0395901_0203635 3300038443 Bacteria 2074
185 Ga0395901_0766077 3300038443 Bacteria 957
186 Ga0242419_001367 3300038698 Bacteria 1492
187 Ga0242420_017552 3300038996 Bacteria 1253
188 Ga0436365_0642687 3300039437 Unclassified 800
189 Ga0436365_1031778 3300039437 Bacteria 2890
190 Ga0436365_1265461 3300039437 Bacteria 2899
191 Ga0436365_1383196 3300039437 Unclassified 805
192 Ga0436365_1930386 3300039437 Bacteria 16089
193 Ga0436360_0424054 3300039438 Bacteria 5991
194 Ga0436363_1129514 3300039450 Bacteria 1814
195 Ga0436362_0086504 3300039453 Bacteria 3292
196 Ga0439448_0021767 3300042005 Unclassified 1989
197 Ga0439458_0068983 3300042157 Unclassified 891
198 Ga0439458_0074098 3300042157 Unclassified 863
199 Ga0439435_0068001 3300042436 Bacteria 1050
200 Ga0453683_0210692 3300044673 Bacteria 1235
201 Ga0466963_0102527 3300044694 Bacteria 1959
202 Ga0466963_0212324 3300044694 Bacteria 1354
203 Ga0453684_1186856 3300044712 Unclassified 802
204 Ga0466958_0358849 3300045836 Unclassified 939
205 Ga0466967_0008186 3300045976 Bacteria 7634
206 Ga0466967_0184155 3300045976 Bacteria 1971
207 Ga0466967_0985226 3300045976 Unclassified 839
208 Ga0466967_1186487 3300045976 Bacteria 761
209 Ga0495667_0120096 3300046559 Unclassified 1697
210 Ga0496102_0050173 3300048905 Bacteria 3799
211 Ga0496104_0008797 3300048907 Bacteria 8976
212 Ga0496104_0078864 3300048907 Bacteria 3138
213 Ga0496104_0125453 3300048907 Unclassified 2465
214 Ga0496105_0402278 3300048908 Unclassified 1087
215 Ga0496105_0495366 3300048908 Bacteria 960
216 Ga0496107_0084971 3300048910 Unclassified 2309
217 Ga0496107_0418133 3300048910 Bacteria 997
218 Ga0496107_0665937 3300048910 Bacteria 767
219 Ga0496108_0015490 3300048911 Bacteria 6218
220 Ga0496108_0058414 3300048911 Bacteria 3242
221 Ga0496108_0792472 3300048911 Unclassified 818
222 Ga0496109_0003590 3300048912 Bacteria 12953
223 Ga0496109_0012623 3300048912 Bacteria 7296
224 Ga0496109_0031702 3300048912 Bacteria 4746
225 Ga0496109_0934097 3300048912 Unclassified 805
226 Ga0496110_0012716 3300048913 Bacteria 6927
227 Ga0496110_0065983 3300048913 Bacteria 3200
228 Ga0496111_0006587 3300048914 Bacteria 7555
229 Ga0496111_0058454 3300048914 Bacteria 2792
230 Ga0496111_0134660 3300048914 Bacteria 1830
231 Ga0496112_0002880 3300048915 Bacteria 13997
232 Ga0496112_0029426 3300048915 Bacteria 5312
233 Ga0496112_0173221 3300048915 Unclassified 2123
234 Ga0496112_0337314 3300048915 Unclassified 1451
235 Ga0496112_1033848 3300048915 Unclassified 741
236 Ga0496113_0000741 3300048916 Bacteria 16766
237 Ga0496113_0070984 3300048916 Bacteria 2648
238 Ga0496113_0085962 3300048916 Bacteria 2416
239 Ga0496113_0453792 3300048916 Unclassified 1030
240 Ga0496114_0500735 3300048917 Bacteria 1075
241 Ga0496115_0178991 3300048918 Bacteria 1753
242 Ga0496115_0303388 3300048918 Bacteria 1308
243 Ga0501298_028019 3300049521 Bacteria 1091
244 Ga0501031_0001409 3300049568 Bacteria 14865
245 Ga0501036_0024688 3300049572 Bacteria 5068
246 Ga0501067_0021860 3300049583 Bacteria 3540
247 Ga0501067_0068980 3300049583 Bacteria 1958
248 Ga0501068_0068798 3300049584 Bacteria 2158
249 Ga0501198_039217 3300049649 Bacteria 816
250 Ga0501199_030085 3300049650 Bacteria 666
251 Ga0501207_021286 3300049654 Bacteria 1041
252 Ga0501208_027316 3300049655 Bacteria 984
253 Ga0501217_007367 3300049661 Bacteria 2356
254 Ga0501223_014629 3300049663 Bacteria 1556
255 Ga0501227_019309 3300049665 Bacteria 1553
256 Ga0501235_000490 3300049669 Bacteria 7863
257 Ga0501236_043740 3300049670 Bacteria 749
258 Ga0501243_007003 3300049675 Bacteria 1717
259 Ga0501259_025946 3300049688 Bacteria 1076
260 Ga0501225_0006831 3300049705 Unclassified 3327
261 Ga0501234_044547 3300049707 Bacteria 731
262 Ga0501079_0297753 3300049741 Bacteria 1262
263 Ga0501081_0147626 3300049743 Bacteria 1688
264 Ga0501083_0466498 3300049744 Unclassified 822
265 Ga0501267_006385 3300049764 Bacteria 1133
266 Ga0501273_024049 3300049770 Bacteria 839
267 Ga0501035_0196378 3300049822 Bacteria 1733
268 Ga0501044_0093965 3300049823 Bacteria 3024
269 Ga0501044_0322517 3300049823 Bacteria 1469
270 Ga0501204_016130 3300049850 Bacteria 934
271 nmdc:mga06z11_439867_c1 3300050494 Unclassified 787
272 nmdc:mga05p37_110169_c1 3300050507 Bacteria 3387
273 nmdc:mga05p37_128143_c1 3300050507 Bacteria 3115
274 nmdc:mga09592_138103_c1 3300050508 Bacteria 2100
275 nmdc:mga0qj67_92487_c1 3300050509 Bacteria 2432
276 nmdc:mga06r32_212259_c1 3300050510 Bacteria 1923
277 nmdc:mga06r32_788327_c1 3300050510 Unclassified 912
278 nmdc:mga08y16_496562_c1 3300050511 Bacteria 1240
279 nmdc:mga0n895_16521_c1 3300050512 Bacteria 6774
280 nmdc:mga0n895_410832_c1 3300050512 Unclassified 1369
281 nmdc:mga0rr50_251013_c1 3300050513 Bacteria 1469
282 nmdc:mga0a205_101200_c1 3300050515 Bacteria 2780
283 nmdc:mga0a205_110496_c1 3300050515 Bacteria 2648
284 nmdc:mga0a205_23027_c1 3300050515 Bacteria 5906
285 nmdc:mga0a205_44085_c1 3300050515 Bacteria 4299
286 Ga0501084_0018097 3300054114 Bacteria 5867
287 Ga0587073_0004041 3300059492 Bacteria 2069
288 Ga0587080_053813 3300059503 Unclassified 767
289 Ga0587094_028685 3300059513 Unclassified 851
290 Ga0587067_055205 3300059640 Unclassified 816
291 Ga0587071_052714 3300060344 Bacteria 846
292 Ga0501082_0205133 3300060353 Unclassified 1715
293 nmdc:mga0qj67_43437_c1
294 rootH2_10079551
295 rootH2_10181915
296 rootH2_10214100
297 Ga0058861_10064927
298 Ga0058861_11910510
299 Ga0058862_12390648
300 Ga0070658_10334675
301 Ga0070683_100180921
302 Ga0070680_100002888
303 Ga0070680_100028882
304 Ga0070680_100779318
305 Ga0070661_100982417
306 Ga0070673_100276270
307 Ga0070709_10064103
308 Ga0070714_100005438
309 Ga0070705_100407092
310 Ga0070705_100635512
311 Ga0070705_100924726
312 Ga0070694_101143130
313 Ga0070708_100255966
314 Ga0070708_100696650
315 Ga0070678_101205376
316 Ga0070662_100151841
317 Ga0070681_10008513
318 Ga0070681_10026613
319 Ga0070681_10047319
320 Ga0070706_100059936
321 Ga0070706_100174093
322 Ga0070707_100075641
323 Ga0070707_100093049
324 Ga0070707_100587913
325 Ga0070699_100119175
326 Ga0070679_100055143
327 Ga0070679_100355017
328 Ga0070679_100373663
329 Ga0070697_100401515
330 Ga0068853_100030288
331 Ga0070695_100112573
332 Ga0070696_100100083
333 Ga0070696_100476755
334 Ga0070696_100669436
335 Ga0070665_100637052
336 Ga0068855_100000589
337 Ga0068855_100009021
338 Ga0068854_100573008
339 Ga0068856_100127913
340 Ga0068852_100000025
341 Ga0068852_100002368
342 Ga0068864_100068462
343 Ga0068864_100865701
344 Ga0068863_100048336
345 Ga0068863_100417746
346 Ga0068858_100347668
347 Ga0068862_100560550
348 Ga0081455_10127457
349 Ga0070717_10061543
350 Ga0070715_10140656
351 Ga0075367_10028066
352 Ga0075428_100006021
353 Ga0075430_100068998
354 Ga0075431_100081318
355 Ga0075431_100165953
356 Ga0075431_101135529
357 Ga0075433_10021753
358 Ga0075433_10070340
359 Ga0075433_10122113
360 Ga0075434_100552858
361 Ga0075429_100068356
362 Ga0075436_100409629
363 Ga0105240_10000280
364 Ga0105240_10000837
365 Ga0105240_11201983
366 Ga0111539_10096493
367 Ga0111539_10476448
368 Ga0105245_10511496
369 Ga0114129_10026267
370 Ga0114129_11536373
371 Ga0105248_10192610
372 Ga0105237_10014085
373 Ga0105239_12021581
374 Ga0157373_10395249
375 Ga0157370_10000012
376 Ga0157370_10022382
377 Ga0157370_10734776
378 Ga0157369_10000096
379 Ga0157369_10001551
380 Ga0157369_10149532
381 Ga0157372_10000066
382 Ga0157372_10019668
383 Ga0157372_11286054
384 Ga0163163_10391518
385 Ga0182008_10410929
386 Ga0154015_1683423
387 Ga0213876_10001260
388 Ga0213876_10176392
389 Ga0213875_10026341
390 Ga0224712_10179068
391 Ga0224712_10188161
392 Ga0207656_10016930
393 Ga0207647_10339568
394 Ga0207684_10229826
395 Ga0207707_10002576
396 Ga0207707_10005367
397 Ga0207707_10045196
398 Ga0207707_10478285
399 Ga0207695_10000028
400 Ga0207695_10003257
401 Ga0207671_10001338
402 Ga0207671_10076966
403 Ga0207663_10392289
404 Ga0207660_10003226
405 Ga0207660_10018764
406 Ga0207662_10257141
407 Ga0207652_10015282
408 Ga0207652_10044463
409 Ga0207646_10092192
410 Ga0207646_10549699
411 Ga0207690_10302184
412 Ga0207706_10164805
413 Ga0207669_10962591
414 Ga0207667_10001049
415 Ga0207667_10010168
416 Ga0207651_10161297
417 Ga0207651_10726736
418 Ga0207639_10451436
419 Ga0207678_10287989
420 Ga0207702_10173750
421 Ga0207641_10105479
422 Ga0207698_10000029
423 Ga0207698_10002824
424 Ga0207698_10320310
425 Ga0209995_1015436
426 Ga0268264_10530990
427 Ga0307408_100013148
428 Ga0307408_100117136
429 Ga0307408_100346881
430 Ga0307408_100432193
431 Ga0307405_10075960
432 Ga0307405_10326363
433 Ga0307413_10002992
434 Ga0307413_10198687
435 Ga0307410_10037076
436 Ga0307410_10310772
437 Ga0307410_10531890
438 Ga0307406_10001998
439 Ga0307406_10168334
440 Ga0307407_10071453
441 Ga0307412_10042965
442 Ga0307412_10617370
443 Ga0307409_100015405
444 Ga0307409_100235415
445 Ga0307416_100148347
446 Ga0307416_100246795
447 Ga0307414_10148894
448 Ga0307414_10195670
449 Ga0307411_10009564
450 Ga0307411_10025590
451 Ga0307415_100001367
452 Ga0307415_100001701
453 Ga0307415_100076150
454 Ga0307415_100735008
455 Ga0373930_0019853
456 Ga0373939_0041525
457 Ga0373941_0046090
458 Ga0373941_0100057
459 Ga0373960_0025535
460 Ga0373960_0148056
461 Ga0373943_0010647
462 Ga0373946_0085297
463 Ga0373962_0051491
464 Ga0373931_0075297
465 Ga0373931_0185329
466 Ga0373927_0000746
467 Ga0373947_0490068
468 Ga0373925_0000708
469 Ga0395898_0267343
470 Ga0395905_0173151
471 Ga0395905_0173474
472 Ga0395905_0717531
473 Ga0436364_0045331
474 Ga0436364_0212190
475 Ga0436364_0570258
476 Ga0395901_0203635
477 Ga0395901_0766077
478 Ga0242419_001367
479 Ga0242420_017552
480 Ga0436365_0642687
481 Ga0436365_1031778
482 Ga0436365_1265461
483 Ga0436365_1383196
484 Ga0436365_1930386
485 Ga0436360_0424054
486 Ga0436363_1129514
487 Ga0436362_0086504
488 Ga0439448_0021767
489 Ga0439458_0068983
490 Ga0439458_0074098
491 Ga0439435_0068001
492 Ga0453683_0210692
493 Ga0466963_0102527
494 Ga0466963_0212324
495 Ga0453684_1186856
496 Ga0466958_0358849
497 Ga0466967_0008186
498 Ga0466967_0184155
499 Ga0466967_0985226
500 Ga0466967_1186487
501 Ga0495667_0120096
502 Ga0496102_0050173
503 Ga0496104_0008797
504 Ga0496104_0078864
505 Ga0496104_0125453
506 Ga0496105_0402278
507 Ga0496105_0495366
508 Ga0496107_0084971
509 Ga0496107_0418133
510 Ga0496107_0665937
511 Ga0496108_0015490
512 Ga0496108_0058414
513 Ga0496108_0792472
514 Ga0496109_0003590
515 Ga0496109_0012623
516 Ga0496109_0031702
517 Ga0496109_0934097
518 Ga0496110_0012716
519 Ga0496110_0065983
520 Ga0496111_0006587
521 Ga0496111_0058454
522 Ga0496111_0134660
523 Ga0496112_0002880
524 Ga0496112_0029426
525 Ga0496112_0173221
526 Ga0496112_0337314
527 Ga0496112_1033848
528 Ga0496113_0000741
529 Ga0496113_0070984
530 Ga0496113_0085962
531 Ga0496113_0453792
532 Ga0496114_0500735
533 Ga0496115_0178991
534 Ga0496115_0303388
535 Ga0501298_028019
536 Ga0501031_0001409
537 Ga0501036_0024688
538 Ga0501067_0021860
539 Ga0501067_0068980
540 Ga0501068_0068798
541 Ga0501198_039217
542 Ga0501199_030085
543 Ga0501207_021286
544 Ga0501208_027316
545 Ga0501217_007367
546 Ga0501223_014629
547 Ga0501227_019309
548 Ga0501235_000490
549 Ga0501236_043740
550 Ga0501243_007003
551 Ga0501259_025946
552 Ga0501225_0006831
553 Ga0501234_044547
554 Ga0501079_0297753
555 Ga0501081_0147626
556 Ga0501083_0466498
557 Ga0501267_006385
558 Ga0501273_024049
559 Ga0501035_0196378
560 Ga0501044_0093965
561 Ga0501044_0322517
562 Ga0501204_016130
563 nmdc:mga06z11_439867_c1
564 nmdc:mga05p37_110169_c1
565 nmdc:mga05p37_128143_c1
566 nmdc:mga09592_138103_c1
567 nmdc:mga0qj67_92487_c1
568 nmdc:mga06r32_212259_c1
569 nmdc:mga06r32_788327_c1
570 nmdc:mga08y16_496562_c1
571 nmdc:mga0n895_16521_c1
572 nmdc:mga0n895_410832_c1
573 nmdc:mga0rr50_251013_c1
574 nmdc:mga0a205_101200_c1
575 nmdc:mga0a205_110496_c1
576 nmdc:mga0a205_23027_c1
577 nmdc:mga0a205_44085_c1
578 Ga0501084_0018097
579 Ga0587073_0004041
580 Ga0587080_053813
581 Ga0587094_028685
582 Ga0587067_055205
583 Ga0587071_052714
584 Ga0501082_0205133

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05163

DinB

DinB family

47

210

0.9

PF12867

DinB_2

DinB superfamily

59

184

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8399 31 173
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.8302 30 168
3dka-assembly1.cif.gz_B crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.8193 30 170
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.8069 31 173
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.7994 31 173
ID Description Score Start End Superfamily
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8117 29 173 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8075 30 164 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.787 29 173 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7854 30 164 1.20.120.450
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.748 30 158 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7C5UV12-F1-model_v4 DinB-like domain-containing protein 0.9918 8 150
AF-A0A7C5UV12-F1-model_v4 DinB-like domain-containing protein 0.9782 8 150
AF-A0A321M0X4-F1-model_v4 Damage-inducible protein DinB 0.9647 8 196
AF-A0A2V9YB97-F1-model_v4 Damage-inducible protein DinB 0.9617 33 196
AF-A0A7W1JRJ8-F1-model_v4 DinB family protein 0.9567 8 152

Map