F390250

General Info

Members Datasets Scaffolds Average Seq Length
291 174 582 159

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100134701|Ga0068863_1001347013
Length 162
Sequence MSEDLNIVTGTKAEQYESLLPQIKALLEGEPDLIANLANVVGALKEQFGWLWVGFYLVKPALDKGDELVLAPFQGPVACTRIKKGRGVCGTSWAKAQTLIVPDVEKFPGHIACSSLSRSEIVIPIIKNDEVIAVLDVDSENPAHFDETDQYYLEQILKLVSF

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
124 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 0.34
Rhizosphere 93.47
Stem 0
Stem Tuber 0
Unclassified 21.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100134701 3300005841 Bacteria 2360
2 JGI24740J21852_10017081 3300001979 Bacteria 2605
3 rootH2_10140737 3300003320 Bacteria 1834
4 rootL2_10148241 3300003322 Bacteria 1952
5 rootL2_10289925 3300003322 Unclassified 3353
6 Ga0065714_10126646 3300005288 Bacteria 1289
7 Ga0070658_10181004 3300005327 Unclassified 1773
8 Ga0070683_100043082 3300005329 Unclassified 4159
9 Ga0070683_100067008 3300005329 Bacteria 3343
10 Ga0070683_101328598 3300005329 Bacteria 691
11 Ga0070690_100106474 3300005330 Bacteria 1865
12 Ga0070670_100086554 3300005331 Unclassified 2692
13 Ga0070670_100774704 3300005331 Unclassified 865
14 Ga0068869_100003368 3300005334 Bacteria 9760
15 Ga0068869_100023753 3300005334 Bacteria 4240
16 Ga0068869_100063145 3300005334 Unclassified 2720
17 Ga0068869_100343234 3300005334 Bacteria 1216
18 Ga0070689_100979611 3300005340 Bacteria 751
19 Ga0070691_10014400 3300005341 Bacteria 3628
20 Ga0070687_100019458 3300005343 Unclassified 3159
21 Ga0070661_100796873 3300005344 Bacteria 775
22 Ga0070675_100093620 3300005354 Unclassified 2520
23 Ga0070671_100015798 3300005355 Bacteria 6098
24 Ga0070674_100043225 3300005356 Bacteria 3064
25 Ga0070674_101531134 3300005356 Bacteria 600
26 Ga0070701_10847982 3300005438 Bacteria 627
27 Ga0070700_100446281 3300005441 Bacteria 983
28 Ga0070678_100827846 3300005456 Bacteria 842
29 Ga0070662_100068962 3300005457 Unclassified 2601
30 Ga0070681_10277952 3300005458 Bacteria 1585
31 Ga0068867_100030473 3300005459 Bacteria 3892
32 Ga0068867_100062520 3300005459 Bacteria 2766
33 Ga0070679_100150358 3300005530 Unclassified 2305
34 Ga0070679_100327897 3300005530 Bacteria 1479
35 Ga0070684_100001987 3300005535 Bacteria 15036
36 Ga0068853_100087753 3300005539 Bacteria 2730
37 Ga0070672_100117956 3300005543 Bacteria 2170
38 Ga0070693_100537225 3300005547 Unclassified 835
39 Ga0068855_100024022 3300005563 Bacteria 7298
40 Ga0068855_100544836 3300005563 Bacteria 1256
41 Ga0070664_101655903 3300005564 Bacteria 606
42 Ga0068857_100121370 3300005577 Bacteria 2353
43 Ga0068857_100428930 3300005577 Bacteria 1233
44 Ga0068857_100613445 3300005577 Unclassified 1029
45 Ga0068857_100951868 3300005577 Unclassified 825
46 Ga0068854_100185863 3300005578 Bacteria 1626
47 Ga0068854_101633798 3300005578 Bacteria 588
48 Ga0068856_100045458 3300005614 Bacteria 4324
49 Ga0070702_100327706 3300005615 Bacteria 1070
50 Ga0068852_100245808 3300005616 Bacteria 1712
51 Ga0068852_100408694 3300005616 Bacteria 1337
52 Ga0068852_100809829 3300005616 Unclassified 951
53 Ga0068852_101349061 3300005616 Bacteria 735
54 Ga0068852_101510584 3300005616 Bacteria 694
55 Ga0068859_100170179 3300005617 Bacteria 2259
56 Ga0068859_100329831 3300005617 Unclassified 1620
57 Ga0068859_100381226 3300005617 Unclassified 1505
58 Ga0068864_100246562 3300005618 Bacteria 1657
59 Ga0068864_100372095 3300005618 Bacteria 1352
60 Ga0068864_100412288 3300005618 Bacteria 1286
61 Ga0068864_100435252 3300005618 Bacteria 1252
62 Ga0068864_100822819 3300005618 Unclassified 914
63 Ga0068866_10051887 3300005718 Bacteria 2090
64 Ga0068861_100073697 3300005719 Bacteria 2653
65 Ga0068861_100109271 3300005719 Bacteria 2213
66 Ga0068861_100542043 3300005719 Bacteria 1059
67 Ga0068870_10190288 3300005840 Unclassified 1238
68 Ga0068863_100074923 3300005841 Bacteria 3202
69 Ga0068863_100710791 3300005841 Bacteria 999
70 Ga0068858_100096029 3300005842 Unclassified 2762
71 Ga0068858_100282166 3300005842 Unclassified 1582
72 Ga0068860_100049527 3300005843 Bacteria 4001
73 Ga0068860_100110432 3300005843 Bacteria 2628
74 Ga0068860_100188789 3300005843 Bacteria 1994
75 Ga0068860_100355914 3300005843 Bacteria 1441
76 Ga0068862_100286398 3300005844 Bacteria 1512
77 Ga0068862_101151394 3300005844 Bacteria 772
78 Ga0081540_1068703 3300005983 Unclassified 1649
79 Ga0075366_10102938 3300006195 Bacteria 1714
80 Ga0097621_100464472 3300006237 Unclassified 1142
81 Ga0097621_100713780 3300006237 Unclassified 924
82 Ga0097620_100170190 3300006931 Bacteria 2259
83 Ga0097620_100329817 3300006931 Unclassified 1620
84 Ga0097620_100381271 3300006931 Unclassified 1505
85 Ga0105240_10000008 3300009093 Bacteria 618862
86 Ga0105240_10000059 3300009093 Bacteria 219860
87 Ga0105240_10000448 3300009093 Bacteria 75837
88 Ga0105247_10005014 3300009101 Bacteria 8410
89 Ga0105247_10624449 3300009101 Bacteria 802
90 Ga0105241_10058227 3300009174 Bacteria 2967
91 Ga0105241_10084883 3300009174 Unclassified 2487
92 Ga0105241_10264704 3300009174 Bacteria 1462
93 Ga0105242_10045894 3300009176 Bacteria 3543
94 Ga0105242_10073936 3300009176 Bacteria 2835
95 Ga0105237_10072832 3300009545 Bacteria 3429
96 Ga0105237_10332922 3300009545 Bacteria 1522
97 Ga0105237_11234285 3300009545 Bacteria 754
98 Ga0105249_10004791 3300009553 Bacteria 11679
99 Ga0105249_10012249 3300009553 Bacteria 7554
100 Ga0105249_10025627 3300009553 Bacteria 5311
101 Ga0105239_10017342 3300010375 Bacteria 7965
102 Ga0105239_10048144 3300010375 Unclassified 4674
103 Ga0105239_11113797 3300010375 Bacteria 909
104 Ga0157373_10099981 3300013100 Bacteria 2041
105 Ga0157371_10071891 3300013102 Bacteria 2449
106 Ga0157371_10080458 3300013102 Bacteria 2307
107 Ga0157371_10119298 3300013102 Bacteria 1875
108 Ga0157370_10009065 3300013104 Bacteria 10672
109 Ga0157370_10019899 3300013104 Bacteria 6715
110 Ga0157370_10202860 3300013104 Bacteria 1839
111 Ga0157370_10424606 3300013104 Unclassified 1223
112 Ga0157370_11285401 3300013104 Bacteria 659
113 Ga0157374_10159605 3300013296 Bacteria 2196
114 Ga0157374_10160341 3300013296 Bacteria 2191
115 Ga0157374_10194339 3300013296 Bacteria 1985
116 Ga0157378_10010656 3300013297 Bacteria 8032
117 Ga0157378_10040743 3300013297 Bacteria 4120
118 Ga0157378_10455270 3300013297 Bacteria 1271
119 Ga0163162_10144762 3300013306 Bacteria 2492
120 Ga0163162_10367494 3300013306 Unclassified 1572
121 Ga0157372_10037350 3300013307 Bacteria 5357
122 Ga0157372_10046077 3300013307 Bacteria 4839
123 Ga0157372_10052650 3300013307 Unclassified 4533
124 Ga0157372_10089092 3300013307 Bacteria 3505
125 Ga0157372_10195442 3300013307 Bacteria 2343
126 Ga0157372_10216805 3300013307 Bacteria 2218
127 Ga0157372_10223480 3300013307 Bacteria 2183
128 Ga0157372_10274850 3300013307 Bacteria 1958
129 Ga0157372_10726438 3300013307 Bacteria 1155
130 Ga0157375_10234444 3300013308 Bacteria 1994
131 Ga0157375_10820945 3300013308 Bacteria 1078
132 Ga0157375_11206210 3300013308 Unclassified 888
133 Ga0157380_10209010 3300014326 Unclassified 1738
134 Ga0157380_11533226 3300014326 Bacteria 720
135 Ga0157377_10740472 3300014745 Bacteria 718
136 Ga0157377_11117216 3300014745 Unclassified 605
137 Ga0157376_11793456 3300014969 Unclassified 650
138 Ga0163161_10209662 3300017792 Unclassified 1505
139 Ga0163161_10511467 3300017792 Unclassified 979
140 Ga0213876_10008875 3300021384 Bacteria 5423
141 Ga0213876_10021020 3300021384 Bacteria 3451
142 Ga0213876_10441588 3300021384 Bacteria 692
143 Ga0207642_10117211 3300025899 Bacteria 1367
144 Ga0207710_10006198 3300025900 Bacteria 5117
145 Ga0207645_10019569 3300025907 Bacteria 4437
146 Ga0207643_10146385 3300025908 Unclassified 1413
147 Ga0207705_10018862 3300025909 Bacteria 4932
148 Ga0207695_10000021 3300025913 Bacteria 679399
149 Ga0207695_10000039 3300025913 Bacteria 454801
150 Ga0207695_10000073 3300025913 Bacteria 312565
151 Ga0207671_10037445 3300025914 Bacteria 3597
152 Ga0207671_10081186 3300025914 Bacteria 2431
153 Ga0207662_10013984 3300025918 Unclassified 4495
154 Ga0207662_10180344 3300025918 Bacteria 1359
155 Ga0207649_10250233 3300025920 Bacteria 1276
156 Ga0207652_10198118 3300025921 Unclassified 1807
157 Ga0207650_10277658 3300025925 Bacteria 1363
158 Ga0207659_10029730 3300025926 Bacteria 3727
159 Ga0207659_10124432 3300025926 Bacteria 1981
160 Ga0207659_10845828 3300025926 Unclassified 786
161 Ga0207706_10061323 3300025933 Unclassified 3312
162 Ga0207670_10889953 3300025936 Unclassified 745
163 Ga0207669_11346701 3300025937 Bacteria 607
164 Ga0207704_10194421 3300025938 Bacteria 1478
165 Ga0207704_10241764 3300025938 Bacteria 1349
166 Ga0207691_10261424 3300025940 Bacteria 1492
167 Ga0207691_11178933 3300025940 Bacteria 635
168 Ga0207689_10002999 3300025942 Bacteria 15566
169 Ga0207689_10063547 3300025942 Bacteria 3037
170 Ga0207689_10111503 3300025942 Unclassified 2248
171 Ga0207689_10607090 3300025942 Bacteria 920
172 Ga0207661_10029905 3300025944 Unclassified 4188
173 Ga0207661_11476905 3300025944 Bacteria 623
174 Ga0207679_10624190 3300025945 Bacteria 973
175 Ga0207667_10002679 3300025949 Bacteria 22020
176 Ga0207667_10443153 3300025949 Bacteria 1320
177 Ga0207651_11373795 3300025960 Bacteria 635
178 Ga0207712_10003315 3300025961 Bacteria 10203
179 Ga0207712_10010327 3300025961 Bacteria 5928
180 Ga0207668_10124897 3300025972 Bacteria 1955
181 Ga0207640_10333473 3300025981 Bacteria 1212
182 Ga0207677_10287498 3300026023 Unclassified 1352
183 Ga0207639_10079299 3300026041 Bacteria 2595
184 Ga0207639_10132998 3300026041 Bacteria 2062
185 Ga0207639_10467914 3300026041 Unclassified 1147
186 Ga0207678_10392039 3300026067 Bacteria 1201
187 Ga0207678_10746920 3300026067 Bacteria 862
188 Ga0207708_10577543 3300026075 Bacteria 950
189 Ga0207702_10118140 3300026078 Bacteria 2369
190 Ga0207641_10014131 3300026088 Bacteria 6543
191 Ga0207648_10005370 3300026089 Bacteria 12915
192 Ga0207648_10011316 3300026089 Bacteria 8410
193 Ga0207676_10316259 3300026095 Bacteria 1431
194 Ga0207676_10400370 3300026095 Unclassified 1283
195 Ga0207676_10593457 3300026095 Unclassified 1063
196 Ga0207674_10073659 3300026116 Bacteria 3428
197 Ga0207674_10785410 3300026116 Bacteria 919
198 Ga0207674_11103232 3300026116 Unclassified 763
199 Ga0207675_100051486 3300026118 Bacteria 3842
200 Ga0207675_100080790 3300026118 Bacteria 3048
201 Ga0207675_100233507 3300026118 Bacteria 1775
202 Ga0207683_10120369 3300026121 Unclassified 2356
203 Ga0207683_10814696 3300026121 Bacteria 867
204 Ga0207698_10451253 3300026142 Unclassified 1241
205 Ga0207698_11998260 3300026142 Bacteria 594
206 Ga0268265_10475655 3300028380 Unclassified 1172
207 Ga0268265_10769841 3300028380 Bacteria 936
208 Ga0268264_10029933 3300028381 Bacteria 4464
209 Ga0268264_10382166 3300028381 Bacteria 1349
210 Ga0307517_10045586 3300028786 Unclassified 4600
211 Ga0265332_10004290 3300031238 Bacteria 6730
212 Ga0307513_10265801 3300031456 Bacteria 1502
213 Ga0265342_10115146 3300031712 Bacteria 1518
214 Ga0307516_10001143 3300031730 Bacteria 37055
215 Ga0307414_10419545 3300032004 Bacteria 1167
216 Ga0307510_10000869 3300033180 Bacteria 31741
217 Ga0373923_0088919 3300035111 Bacteria 1349
218 Ga0373943_0635390 3300035170 Bacteria 630
219 Ga0373955_0024229 3300035172 Bacteria 3102
220 Ga0373947_0133403 3300035725 Bacteria 1587
221 Ga0395900_0285052 3300037418 Bacteria 1642
222 Ga0395901_0295280 3300038443 Bacteria 1681
223 Ga0436365_0083254 3300039437 Bacteria 1589
224 Ga0436365_1116409 3300039437 Unclassified 1893
225 Ga0436365_1423724 3300039437 Bacteria 1101
226 Ga0436365_1473972 3300039437 Bacteria 28177
227 Ga0451795_0978166 3300041456 Bacteria 1659
228 Ga0451853_2882759 3300041512 Unclassified 947
229 Ga0439454_084167 3300042011 Unclassified 580
230 Ga0450894_016138 3300042131 Bacteria 991
231 Ga0466965_0596622 3300044683 Unclassified 627
232 Ga0466964_0070537 3300044706 Unclassified 1477
233 Ga0453684_0063075 3300044712 Bacteria 4743
234 Ga0453684_0549399 3300044712 Bacteria 1272
235 Ga0466971_0053558 3300044719 Bacteria 1818
236 Ga0466968_0251320 3300044735 Bacteria 840
237 Ga0466959_0045077 3300045049 Bacteria 3248
238 Ga0466958_0171425 3300045836 Bacteria 1374
239 Ga0466967_0525409 3300045976 Bacteria 1163
240 Ga0495580_0022715 3300046472 Bacteria 4612
241 Ga0495582_0022838 3300046473 Bacteria 3422
242 Ga0495639_0259874 3300046475 Bacteria 860
243 Ga0495662_0148287 3300046476 Bacteria 1155
244 Ga0495630_0385701 3300046517 Bacteria 1073
245 Ga0495666_0299237 3300046526 Bacteria 728
246 Ga0495652_0269656 3300046529 Unclassified 1252
247 Ga0495587_0177385 3300046536 Bacteria 1209
248 Ga0495598_0390296 3300046537 Bacteria 542
249 Ga0495668_0000068 3300046616 Bacteria 176297
250 Ga0495634_0188662 3300046642 Bacteria 1287
251 Ga0495623_0033825 3300046679 Bacteria 3280
252 Ga0495658_0004084 3300046683 Bacteria 7190
253 Ga0495613_0290742 3300046689 Bacteria 1133
254 Ga0495674_0014216 3300047319 Bacteria 7455
255 Ga0495672_0061368 3300047320 Bacteria 2167
256 Ga0495686_0027572 3300047472 Bacteria 3707
257 Ga0495686_0140125 3300047472 Bacteria 1427
258 Ga0501032_0001405 3300049569 Bacteria 19148
259 Ga0501034_0026788 3300049571 Bacteria 5865
260 Ga0501034_0035899 3300049571 Bacteria 5025
261 Ga0501034_0111246 3300049571 Bacteria 2729
262 Ga0501036_0020420 3300049572 Bacteria 5564
263 Ga0501037_0131408 3300049573 Bacteria 1795
264 Ga0501037_0305579 3300049573 Bacteria 1104
265 Ga0501038_0031731 3300049574 Bacteria 4667
266 Ga0501039_0092407 3300049575 Bacteria 2358
267 Ga0501043_0001568 3300049579 Bacteria 19904
268 Ga0501043_0629674 3300049579 Unclassified 790
269 Ga0501046_0002385 3300049580 Bacteria 17657
270 Ga0501047_0003647 3300049581 Bacteria 14510
271 Ga0501047_0346812 3300049581 Bacteria 1322
272 Ga0501048_0060045 3300049582 Bacteria 2694
273 Ga0501069_0058389 3300049585 Bacteria 2152
274 Ga0501070_0208764 3300049586 Bacteria 1603
275 Ga0501073_0138056 3300049589 Bacteria 1689
276 Ga0501074_0000597 3300049590 Bacteria 22414
277 Ga0501198_144541 3300049649 Unclassified 519
278 Ga0501080_1113389 3300049742 Bacteria 681
279 Ga0501083_0022844 3300049744 Bacteria 4340
280 Ga0501035_0029792 3300049822 Bacteria 4978
281 Ga0501035_0105911 3300049822 Bacteria 2466
282 Ga0501044_0033592 3300049823 Bacteria 5389
283 Ga0501044_0056205 3300049823 Unclassified 4040
284 Ga0501044_0280270 3300049823 Bacteria 1601
285 Ga0501045_0240681 3300049824 Bacteria 1347
286 Ga0495619_0099715 3300053085 Bacteria 1976
287 Ga0500616_0001422 3300053153 Bacteria 23097
288 Ga0500616_0250325 3300053153 Bacteria 757
289 Ga0501084_1391367 3300054114 Bacteria 588
290 Ga0501082_0126970 3300060353 Bacteria 2212
291 Ga0466962_0142937 3300061719 Bacteria 1159
292 Ga0068863_100134701
293 JGI24740J21852_10017081
294 rootH2_10140737
295 rootL2_10148241
296 rootL2_10289925
297 Ga0065714_10126646
298 Ga0070658_10181004
299 Ga0070683_100043082
300 Ga0070683_100067008
301 Ga0070683_101328598
302 Ga0070690_100106474
303 Ga0070670_100086554
304 Ga0070670_100774704
305 Ga0068869_100003368
306 Ga0068869_100023753
307 Ga0068869_100063145
308 Ga0068869_100343234
309 Ga0070689_100979611
310 Ga0070691_10014400
311 Ga0070687_100019458
312 Ga0070661_100796873
313 Ga0070675_100093620
314 Ga0070671_100015798
315 Ga0070674_100043225
316 Ga0070674_101531134
317 Ga0070701_10847982
318 Ga0070700_100446281
319 Ga0070678_100827846
320 Ga0070662_100068962
321 Ga0070681_10277952
322 Ga0068867_100030473
323 Ga0068867_100062520
324 Ga0070679_100150358
325 Ga0070679_100327897
326 Ga0070684_100001987
327 Ga0068853_100087753
328 Ga0070672_100117956
329 Ga0070693_100537225
330 Ga0068855_100024022
331 Ga0068855_100544836
332 Ga0070664_101655903
333 Ga0068857_100121370
334 Ga0068857_100428930
335 Ga0068857_100613445
336 Ga0068857_100951868
337 Ga0068854_100185863
338 Ga0068854_101633798
339 Ga0068856_100045458
340 Ga0070702_100327706
341 Ga0068852_100245808
342 Ga0068852_100408694
343 Ga0068852_100809829
344 Ga0068852_101349061
345 Ga0068852_101510584
346 Ga0068859_100170179
347 Ga0068859_100329831
348 Ga0068859_100381226
349 Ga0068864_100246562
350 Ga0068864_100372095
351 Ga0068864_100412288
352 Ga0068864_100435252
353 Ga0068864_100822819
354 Ga0068866_10051887
355 Ga0068861_100073697
356 Ga0068861_100109271
357 Ga0068861_100542043
358 Ga0068870_10190288
359 Ga0068863_100074923
360 Ga0068863_100710791
361 Ga0068858_100096029
362 Ga0068858_100282166
363 Ga0068860_100049527
364 Ga0068860_100110432
365 Ga0068860_100188789
366 Ga0068860_100355914
367 Ga0068862_100286398
368 Ga0068862_101151394
369 Ga0081540_1068703
370 Ga0075366_10102938
371 Ga0097621_100464472
372 Ga0097621_100713780
373 Ga0097620_100170190
374 Ga0097620_100329817
375 Ga0097620_100381271
376 Ga0105240_10000008
377 Ga0105240_10000059
378 Ga0105240_10000448
379 Ga0105247_10005014
380 Ga0105247_10624449
381 Ga0105241_10058227
382 Ga0105241_10084883
383 Ga0105241_10264704
384 Ga0105242_10045894
385 Ga0105242_10073936
386 Ga0105237_10072832
387 Ga0105237_10332922
388 Ga0105237_11234285
389 Ga0105249_10004791
390 Ga0105249_10012249
391 Ga0105249_10025627
392 Ga0105239_10017342
393 Ga0105239_10048144
394 Ga0105239_11113797
395 Ga0157373_10099981
396 Ga0157371_10071891
397 Ga0157371_10080458
398 Ga0157371_10119298
399 Ga0157370_10009065
400 Ga0157370_10019899
401 Ga0157370_10202860
402 Ga0157370_10424606
403 Ga0157370_11285401
404 Ga0157374_10159605
405 Ga0157374_10160341
406 Ga0157374_10194339
407 Ga0157378_10010656
408 Ga0157378_10040743
409 Ga0157378_10455270
410 Ga0163162_10144762
411 Ga0163162_10367494
412 Ga0157372_10037350
413 Ga0157372_10046077
414 Ga0157372_10052650
415 Ga0157372_10089092
416 Ga0157372_10195442
417 Ga0157372_10216805
418 Ga0157372_10223480
419 Ga0157372_10274850
420 Ga0157372_10726438
421 Ga0157375_10234444
422 Ga0157375_10820945
423 Ga0157375_11206210
424 Ga0157380_10209010
425 Ga0157380_11533226
426 Ga0157377_10740472
427 Ga0157377_11117216
428 Ga0157376_11793456
429 Ga0163161_10209662
430 Ga0163161_10511467
431 Ga0213876_10008875
432 Ga0213876_10021020
433 Ga0213876_10441588
434 Ga0207642_10117211
435 Ga0207710_10006198
436 Ga0207645_10019569
437 Ga0207643_10146385
438 Ga0207705_10018862
439 Ga0207695_10000021
440 Ga0207695_10000039
441 Ga0207695_10000073
442 Ga0207671_10037445
443 Ga0207671_10081186
444 Ga0207662_10013984
445 Ga0207662_10180344
446 Ga0207649_10250233
447 Ga0207652_10198118
448 Ga0207650_10277658
449 Ga0207659_10029730
450 Ga0207659_10124432
451 Ga0207659_10845828
452 Ga0207706_10061323
453 Ga0207670_10889953
454 Ga0207669_11346701
455 Ga0207704_10194421
456 Ga0207704_10241764
457 Ga0207691_10261424
458 Ga0207691_11178933
459 Ga0207689_10002999
460 Ga0207689_10063547
461 Ga0207689_10111503
462 Ga0207689_10607090
463 Ga0207661_10029905
464 Ga0207661_11476905
465 Ga0207679_10624190
466 Ga0207667_10002679
467 Ga0207667_10443153
468 Ga0207651_11373795
469 Ga0207712_10003315
470 Ga0207712_10010327
471 Ga0207668_10124897
472 Ga0207640_10333473
473 Ga0207677_10287498
474 Ga0207639_10079299
475 Ga0207639_10132998
476 Ga0207639_10467914
477 Ga0207678_10392039
478 Ga0207678_10746920
479 Ga0207708_10577543
480 Ga0207702_10118140
481 Ga0207641_10014131
482 Ga0207648_10005370
483 Ga0207648_10011316
484 Ga0207676_10316259
485 Ga0207676_10400370
486 Ga0207676_10593457
487 Ga0207674_10073659
488 Ga0207674_10785410
489 Ga0207674_11103232
490 Ga0207675_100051486
491 Ga0207675_100080790
492 Ga0207675_100233507
493 Ga0207683_10120369
494 Ga0207683_10814696
495 Ga0207698_10451253
496 Ga0207698_11998260
497 Ga0268265_10475655
498 Ga0268265_10769841
499 Ga0268264_10029933
500 Ga0268264_10382166
501 Ga0307517_10045586
502 Ga0265332_10004290
503 Ga0307513_10265801
504 Ga0265342_10115146
505 Ga0307516_10001143
506 Ga0307414_10419545
507 Ga0307510_10000869
508 Ga0373923_0088919
509 Ga0373943_0635390
510 Ga0373955_0024229
511 Ga0373947_0133403
512 Ga0395900_0285052
513 Ga0395901_0295280
514 Ga0436365_0083254
515 Ga0436365_1116409
516 Ga0436365_1423724
517 Ga0436365_1473972
518 Ga0451795_0978166
519 Ga0451853_2882759
520 Ga0439454_084167
521 Ga0450894_016138
522 Ga0466965_0596622
523 Ga0466964_0070537
524 Ga0453684_0063075
525 Ga0453684_0549399
526 Ga0466971_0053558
527 Ga0466968_0251320
528 Ga0466959_0045077
529 Ga0466958_0171425
530 Ga0466967_0525409
531 Ga0495580_0022715
532 Ga0495582_0022838
533 Ga0495639_0259874
534 Ga0495662_0148287
535 Ga0495630_0385701
536 Ga0495666_0299237
537 Ga0495652_0269656
538 Ga0495587_0177385
539 Ga0495598_0390296
540 Ga0495668_0000068
541 Ga0495634_0188662
542 Ga0495623_0033825
543 Ga0495658_0004084
544 Ga0495613_0290742
545 Ga0495674_0014216
546 Ga0495672_0061368
547 Ga0495686_0027572
548 Ga0495686_0140125
549 Ga0501032_0001405
550 Ga0501034_0026788
551 Ga0501034_0035899
552 Ga0501034_0111246
553 Ga0501036_0020420
554 Ga0501037_0131408
555 Ga0501037_0305579
556 Ga0501038_0031731
557 Ga0501039_0092407
558 Ga0501043_0001568
559 Ga0501043_0629674
560 Ga0501046_0002385
561 Ga0501047_0003647
562 Ga0501047_0346812
563 Ga0501048_0060045
564 Ga0501069_0058389
565 Ga0501070_0208764
566 Ga0501073_0138056
567 Ga0501074_0000597
568 Ga0501198_144541
569 Ga0501080_1113389
570 Ga0501083_0022844
571 Ga0501035_0029792
572 Ga0501035_0105911
573 Ga0501044_0033592
574 Ga0501044_0056205
575 Ga0501044_0280270
576 Ga0501045_0240681
577 Ga0495619_0099715
578 Ga0500616_0001422
579 Ga0500616_0250325
580 Ga0501084_1391367
581 Ga0501082_0126970
582 Ga0466962_0142937

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01590

GAF

GAF domain

32

162

0.89

PF13185

GAF_2

GAF domain

28

162

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mmh-assembly1.cif.gz_B x-ray structure of free methionine-r-sulfoxide reductase from neisseria meningitidis in complex with its substrate 0.9731 1 155
3rfb-assembly1.cif.gz_A structure of frmsr 0.9714 16 155
5hl6-assembly1.cif.gz_A crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis 0.9644 10 155
3mmh-assembly1.cif.gz_B x-ray structure of free methionine-r-sulfoxide reductase from neisseria meningitidis in complex with its substrate 0.9549 1 155
3ksf-assembly3.cif.gz_F structure of frmsr of staphylococcus aureus (reduced form) 0.9471 9 155
ID Description Score Start End Superfamily
af_Q8MTJ7_3_158_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9767 3 157 3.30.450.40
3rfbA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9714 16 155 3.30.450.40
af_Q8MTJ7_3_158_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9645 3 157 3.30.450.40
af_Q4DSC2_14_185_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9531 11 154 3.30.450.40
1vhmA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9409 11 155 3.30.450.40
ID Description Score Start End GO Terms
AF-K1UMV7-F1-model_v4 GAF domain-containing protein 0.9972 53 135 GO:0005829
GO:0033745
AF-A0A4Q3D6Q4-F1-model_v4 GAF domain-containing protein 0.9955 31 157 GO:0005829
GO:0033745
AF-A0A520DHR9-F1-model_v4 GAF domain-containing protein 0.995 16 155 GO:0005829
GO:0033745
AF-A0A7Y2TF96-F1-model_v4 GAF domain-containing protein 0.9942 38 154 GO:0005829
GO:0033745
AF-A0A2M7RTV3-F1-model_v4 GAF domain-containing protein 0.9932 37 155 GO:0005829
GO:0033745

Map