F390197

General Info

Members Datasets Scaffolds Average Seq Length
291 207 268 267

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100028369|Ga0070667_1000283695
Length 301
Sequence VHWFSESYMTDGAGAGPAAAPAYHPRMPKRTSTLRQLQDGLGEIGRSGLRSSIGWSTSWWHVVKVGALILVLALSPSTYDRANRGALARHLYLGIMPILPWFALLSAVISVVLIRIVVVTALSYGLSQYALEMVIRVLVLELIPLTAALFVALQITVPSGAALIRMHARGEFATLLRAGGDPLRHELMPRVVAGVFAVLMLAAVSCLIATLLAYAAVYGFTLGAFAGFTRAMGQIFDPGVTLILALKTLFFGLAVALIPVAAFLRAGGPRAASGSPELDSLVRLFAAILVIEVVSLVGNYS

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
4 2643221570 Acidovorax sp. Root568 Isolate Unclassified
5 2643221596 Acidovorax sp. Root70 Isolate Unclassified
6 2643221609 Acidovorax sp. Root217 Isolate Unclassified
7 2643221611 Acidovorax sp. Root219 Isolate Unclassified
8 2643221652 Acidovorax sp. Root402 Isolate Unclassified
9 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
10 2643221717 Acidovorax sp. Root267 Isolate Unclassified
11 2738543012 Acidovorax sp. CF301 Isolate Unclassified
12 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
13 2816332133 Acidovorax radicis 2721A Isolate Unclassified
14 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
15 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
16 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
17 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
18 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
19 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
20 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
21 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
22 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
23 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
24 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
25 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
26 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
27 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
28 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
29 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
30 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
36 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
75 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
76 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
81 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
106 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
107 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
122 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
123 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
147 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
148 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
184 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
193 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
201 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
202 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
203 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
204 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
205 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
206 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.1
Metatranscriptomes 0
Isolates 7.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.24
Nodule 0.69
Rhizoplane 1.37
Rhizosphere 55.67
Stem 0
Stem Tuber 0
Unclassified 12.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000095 3300002704 Bacteria 49917
2 JGI25156J39149_1000025 3300002705 Bacteria 136287
3 JGI25154J39366_1000045 3300002738 Bacteria 136302
4 JGI25157J39369_1000034 3300002741 Bacteria 136301
5 JGI25150J39212_1006147 3300002774 Bacteria 2505
6 JGI25160J50197_1000207 3300003354 Bacteria 48664
7 JGI25161J50226_1000148 3300003374 Bacteria 48949
8 Ga0055526_1000306 3300003771 Bacteria 40960
9 Ga0055537_1000008 3300003773 Bacteria 142572
10 Ga0055524_1000075 3300003775 Bacteria 121897
11 Ga0055536_1001446 3300003781 Bacteria 14300
12 Ga0055534_1002376 3300003784 Bacteria 6556
13 Ga0055528_1001296 3300003790 Bacteria 15695
14 Ga0055530_10000152 3300003791 Bacteria 62435
15 Ga0055530_10049930 3300003791 Bacteria 977
16 Ga0055540_1000160 3300003792 Bacteria 66881
17 Ga0055531_10000366 3300003794 Bacteria 43612
18 Ga0055543_1000201 3300004625 Bacteria 48917
19 Ga0065165_1000870 3300005262 Bacteria 39287
20 Ga0065165_1006228 3300005262 Bacteria 6354
21 Ga0065165_1019795 3300005262 Bacteria 2390
22 Ga0065714_10099964 3300005288 Bacteria 1675
23 Ga0065714_10122010 3300005288 Bacteria 1322
24 Ga0065704_10219490 3300005289 Bacteria 1050
25 Ga0065707_10137732 3300005295 Bacteria 1816
26 Ga0070676_10083768 3300005328 Bacteria 1940
27 Ga0068868_100406179 3300005338 Bacteria 1176
28 Ga0070667_100028369 3300005367 Bacteria 4660
29 Ga0068867_100021676 3300005459 Bacteria 4585
30 Ga0070706_100260676 3300005467 Bacteria 1618
31 Ga0070699_100283387 3300005518 Bacteria 1484
32 Ga0070699_100681076 3300005518 Bacteria 939
33 Ga0070665_100137970 3300005548 Bacteria 2442
34 Ga0068860_100089474 3300005843 Bacteria 2931
35 Ga0070717_10136717 3300006028 Bacteria 2111
36 Ga0075365_10112022 3300006038 Bacteria 1876
37 Ga0075365_10260405 3300006038 Bacteria 1219
38 Ga0075365_10392205 3300006038 Bacteria 979
39 Ga0075364_10072849 3300006051 Bacteria 2264
40 Ga0075364_10144054 3300006051 Bacteria 1603
41 Ga0075364_10262198 3300006051 Bacteria 1175
42 Ga0075432_10026115 3300006058 Bacteria 2005
43 Ga0075362_10051571 3300006177 Bacteria 1842
44 Ga0075367_10001572 3300006178 Bacteria 9884
45 Ga0075367_10029078 3300006178 Bacteria 3158
46 Ga0075369_10046701 3300006186 Bacteria 1865
47 Ga0075366_10000851 3300006195 Bacteria 14704
48 Ga0075366_10008680 3300006195 Bacteria 5658
49 Ga0075366_10025801 3300006195 Bacteria 3437
50 Ga0075366_10077245 3300006195 Bacteria 1987
51 Ga0075370_10016313 3300006353 Bacteria 3995
52 Ga0075370_10028287 3300006353 Bacteria 3115
53 Ga0068865_100077308 3300006881 Bacteria 2378
54 Ga0079104_1010726 3300006946 Bacteria 2992
55 Ga0111539_10446380 3300009094 Bacteria 1506
56 Ga0105245_10277374 3300009098 Bacteria 1637
57 Ga0105245_10369921 3300009098 Bacteria 1425
58 Ga0105245_10425312 3300009098 Bacteria 1332
59 Ga0105243_10040357 3300009148 Bacteria 3645
60 Ga0105239_10097572 3300010375 Bacteria 3248
61 Ga0157326_1002912 3300012513 Bacteria 1808
62 Ga0157375_10081859 3300013308 Bacteria 3269
63 Ga0182008_10000413 3300014497 Bacteria 33054
64 Ga0157376_10276120 3300014969 Bacteria 1581
65 Ga0182006_1000002 3300015261 Bacteria 887990
66 Ga0182007_10000606 3300015262 Bacteria 20973
67 Ga0182005_1000002 3300015265 Bacteria 908499
68 Ga0209435_100001 3300025206 Bacteria 1424171
69 Ga0209436_112261 3300025208 Bacteria 1464
70 Ga0207425_1003160 3300025245 Bacteria 5389
71 Ga0209646_1000001 3300025246 Bacteria 3092932
72 Ga0209026_1000003 3300025250 Bacteria 1060571
73 Ga0209759_1000001 3300025256 Bacteria 2799452
74 Ga0209565_1000004 3300025263 Bacteria 983150
75 Ga0209565_1000563 3300025263 Bacteria 25520
76 Ga0209565_1019414 3300025263 Bacteria 1453
77 Ga0209673_1000275 3300025273 Bacteria 96728
78 Ga0209130_1000129 3300025284 Bacteria 123096
79 Ga0209130_1000299 3300025284 Bacteria 60368
80 Ga0209675_1000044 3300025291 Bacteria 230392
81 Ga0209675_1004528 3300025291 Bacteria 6148
82 Ga0209676_1000029 3300025292 Bacteria 520536
83 Ga0209676_1001100 3300025292 Bacteria 30000
84 Ga0209025_1001299 3300025294 Bacteria 34113
85 Ga0209025_1009536 3300025294 Bacteria 6743
86 Ga0209025_1019901 3300025294 Bacteria 3705
87 Ga0209564_1000356 3300025295 Bacteria 85562
88 Ga0209564_1002112 3300025295 Bacteria 16896
89 Ga0209050_1000003 3300025298 Bacteria 1609245
90 Ga0209050_1001447 3300025298 Bacteria 25496
91 Ga0209050_1016742 3300025298 Bacteria 2973
92 Ga0209256_1000001 3300025299 Bacteria 2166974
93 Ga0209256_1061377 3300025299 Bacteria 874
94 Ga0207426_1000071 3300025302 Bacteria 329539
95 Ga0209051_1000003 3300025303 Bacteria 1609245
96 Ga0209257_1000018 3300025304 Bacteria 836016
97 Ga0209257_1015706 3300025304 Bacteria 3127
98 Ga0209257_1019713 3300025304 Bacteria 2526
99 Ga0207645_10167880 3300025907 Bacteria 1437
100 Ga0207684_10010915 3300025910 Bacteria 7965
101 Ga0207695_10046804 3300025913 Bacteria 4582
102 Ga0207687_10127420 3300025927 Bacteria 1913
103 Ga0207706_10021297 3300025933 Bacteria 5824
104 Ga0207709_10097430 3300025935 Bacteria 1937
105 Ga0207704_10071196 3300025938 Bacteria 2206
106 Ga0207658_10016689 3300025986 Bacteria 5053
107 Ga0207658_10135201 3300025986 Bacteria 1987
108 Ga0207674_10008091 3300026116 Bacteria 12189
109 Ga0209971_1002072 3300027682 Bacteria 4884
110 Ga0209974_10008311 3300027876 Bacteria 3551
111 Ga0207428_10170721 3300027907 Bacteria 1647
112 Ga0316177_1210151 3300030731 Bacteria 3024
113 Ga0316180_1001672 3300030736 Bacteria 1921
114 Ga0316182_1289593 3300030745 Bacteria 1452
115 Ga0265330_10000032 3300031235 Bacteria 130592
116 Ga0265332_10000001 3300031238 Bacteria 863783
117 Ga0265325_10005927 3300031241 Bacteria 7489
118 Ga0307513_10000014 3300031456 Bacteria 303157
119 Ga0307408_100000284 3300031548 Bacteria 50374
120 Ga0307408_100001145 3300031548 Bacteria 20144
121 Ga0307408_100006612 3300031548 Bacteria 7689
122 Ga0265314_10000022 3300031711 Bacteria 297299
123 Ga0265314_10017945 3300031711 Bacteria 5538
124 Ga0307516_10051752 3300031730 Bacteria 4024
125 Ga0307516_10092494 3300031730 Bacteria 2851
126 Ga0307413_10589957 3300031824 Bacteria 908
127 Ga0307406_10000151 3300031901 Bacteria 41040
128 Ga0307416_100146343 3300032002 Bacteria 2158
129 Ga0307414_10189800 3300032004 Bacteria 1661
130 Ga0373925_0282799 3300037068 Bacteria 1336
131 Ga0395899_0001571 3300037312 Bacteria 19210
132 Ga0439436_0016429 3300041404 Bacteria 2220
133 Ga0439453_0005241 3300041408 Bacteria 1967
134 Ga0450897_000589 3300042128 Bacteria 2092
135 Ga0451577_0030529 3300042876 Bacteria 4869
136 Ga0453684_0135914 3300044712 Bacteria 2944
137 Ga0466970_0138816 3300044765 Bacteria 1338
138 Ga0495617_078456 3300046452 Bacteria 1083
139 Ga0495629_0003279 3300046459 Bacteria 12249
140 Ga0495638_0006397 3300046460 Bacteria 8575
141 Ga0495638_0129858 3300046460 Bacteria 1481
142 Ga0495653_0031065 3300046463 Bacteria 4248
143 Ga0495650_0000118 3300046471 Bacteria 187358
144 Ga0495650_0000224 3300046471 Bacteria 118058
145 Ga0495650_0001255 3300046471 Bacteria 26185
146 Ga0495650_0020500 3300046471 Bacteria 3221
147 Ga0495605_0024887 3300046474 Bacteria 3126
148 Ga0495605_0076343 3300046474 Bacteria 1574
149 Ga0495584_0001533 3300046491 Bacteria 13745
150 Ga0495585_0000102 3300046492 Bacteria 91414
151 Ga0495585_0028438 3300046492 Bacteria 3188
152 Ga0495596_0000779 3300046500 Bacteria 19389
153 Ga0495596_0004387 3300046500 Bacteria 6886
154 Ga0495607_0000552 3300046501 Bacteria 36630
155 Ga0495607_0167691 3300046501 Bacteria 1111
156 Ga0495606_0000011 3300046507 Bacteria 296816
157 Ga0495606_0003111 3300046507 Bacteria 18025
158 Ga0495606_0061468 3300046507 Bacteria 2402
159 Ga0495610_0012202 3300046512 Bacteria 5189
160 Ga0495616_0000184 3300046513 Bacteria 52694
161 Ga0495616_0008330 3300046513 Bacteria 6149
162 Ga0495616_0015364 3300046513 Bacteria 4257
163 Ga0495616_0056383 3300046513 Bacteria 1941
164 Ga0495631_0014700 3300046518 Bacteria 3771
165 Ga0495632_0007872 3300046519 Bacteria 6626
166 Ga0495632_0009760 3300046519 Bacteria 5754
167 Ga0495637_0018024 3300046520 Bacteria 3280
168 Ga0495643_0000411 3300046522 Bacteria 56229
169 Ga0495643_0000630 3300046522 Bacteria 41718
170 Ga0495643_0032503 3300046522 Bacteria 2896
171 Ga0495644_0019711 3300046523 Bacteria 2575
172 Ga0495644_0063650 3300046523 Bacteria 1386
173 Ga0495648_0052648 3300046524 Bacteria 2471
174 Ga0495648_0070946 3300046524 Bacteria 2022
175 Ga0495663_0033280 3300046525 Bacteria 1539
176 Ga0495642_0044497 3300046528 Bacteria 1812
177 Ga0495654_0036558 3300046530 Bacteria 2467
178 Ga0495609_0003836 3300046538 Bacteria 8458
179 Ga0495609_0017435 3300046538 Bacteria 3334
180 Ga0495622_0000028 3300046557 Bacteria 133197
181 Ga0495622_0033216 3300046557 Bacteria 2409
182 Ga0495633_0000250 3300046558 Bacteria 63561
183 Ga0495633_0000704 3300046558 Bacteria 30526
184 Ga0495633_0006585 3300046558 Bacteria 6860
185 Ga0495656_0130035 3300046615 Bacteria 1197
186 Ga0495668_0034847 3300046616 Bacteria 2822
187 Ga0495611_0006873 3300046648 Bacteria 4834
188 Ga0495611_0009711 3300046648 Bacteria 4068
189 Ga0495659_0009199 3300046664 Bacteria 3150
190 Ga0495661_0018893 3300046665 Bacteria 4524
191 Ga0495661_0030671 3300046665 Bacteria 3421
192 Ga0495661_0049963 3300046665 Bacteria 2534
193 Ga0495661_0172059 3300046665 Bacteria 1154
194 Ga0495588_0005834 3300046674 Bacteria 5510
195 Ga0495588_0139003 3300046674 Bacteria 1282
196 Ga0495670_0019979 3300046691 Bacteria 3300
197 Ga0495670_0026576 3300046691 Bacteria 2866
198 Ga0495671_0102673 3300046692 Bacteria 1397
199 Ga0495671_0216607 3300046692 Bacteria 927
200 Ga0495649_0005401 3300046694 Bacteria 8134
201 Ga0495589_0124303 3300046794 Bacteria 1241
202 Ga0495660_0018541 3300046810 Bacteria 4001
203 Ga0495636_0155257 3300047318 Bacteria 1029
204 Ga0495672_0000097 3300047320 Bacteria 141608
205 Ga0495672_0002147 3300047320 Bacteria 18438
206 Ga0495672_0127972 3300047320 Bacteria 1340
207 Ga0495676_0198340 3300047321 Bacteria 1396
208 Ga0495683_0005871 3300047323 Bacteria 6748
209 Ga0495683_0031589 3300047323 Bacteria 2699
210 Ga0495677_0014141 3300047445 Bacteria 2907
211 Ga0495673_0014333 3300047469 Bacteria 4124
212 Ga0495686_0001813 3300047472 Bacteria 21575
213 Ga0495626_0000821 3300048091 Bacteria 27909
214 Ga0495626_0030239 3300048091 Bacteria 2613
215 Ga0496106_0053685 3300048909 Bacteria 3044
216 Ga0496111_0210515 3300048914 Bacteria 1444
217 Ga0496115_0114853 3300048918 Bacteria 2213
218 Ga0496116_0024690 3300048919 Bacteria 4437
219 Ga0496117_0000001 3300048920 Bacteria 2526244
220 Ga0496118_0000002 3300048921 Bacteria 1690764
221 Ga0496121_0004101 3300048924 Bacteria 19986
222 Ga0496121_0087753 3300048924 Bacteria 2441
223 Ga0496121_0321831 3300048924 Bacteria 1041
224 Ga0496122_0000822 3300048925 Bacteria 59313
225 Ga0496123_0001379 3300048926 Bacteria 34024
226 Ga0496124_0138464 3300048927 Bacteria 1924
227 Ga0496125_0120731 3300048928 Bacteria 1870
228 Ga0496126_0405585 3300048929 Bacteria 1105
229 Ga0495678_004446 3300049459 Bacteria 8102
230 Ga0495678_008060 3300049459 Bacteria 5371
231 Ga0495682_0002675 3300049460 Bacteria 8315
232 Ga0501031_0000769 3300049568 Bacteria 19277
233 Ga0501034_0218640 3300049571 Bacteria 1858
234 Ga0501037_0299375 3300049573 Bacteria 1117
235 Ga0501048_0110834 3300049582 Bacteria 1938
236 Ga0501075_0249264 3300049591 Bacteria 1353
237 Ga0501076_0134271 3300049592 Bacteria 2009
238 Ga0501080_0111820 3300049742 Bacteria 2532
239 Ga0501279_014639 3300049775 Bacteria 1081
240 nmdc:mga03683_2515_c1 3300050489 Bacteria 5711
241 nmdc:mga03683_36276_c1 3300050489 Bacteria 2005
242 nmdc:mga03683_76245_c1 3300050489 Bacteria 1441
243 nmdc:mga00v17_38223_c1 3300050491 Bacteria 2869
244 nmdc:mga0yw44_108074_c1 3300050492 Bacteria 1779
245 nmdc:mga0k408_143574_c1 3300050493 Bacteria 1420
246 nmdc:mga0k408_409_c1 3300050493 Bacteria 23457
247 nmdc:mga0k408_41006_c1 3300050493 Bacteria 2665
248 nmdc:mga0k408_550_c1 3300050493 Bacteria 20658
249 nmdc:mga0k408_6314_c1 3300050493 Bacteria 6325
250 nmdc:mga06z11_277246_c1 3300050494 Bacteria 993
251 nmdc:mga06z11_354588_c1 3300050494 Bacteria 879
252 nmdc:mga06z11_44320_c1 3300050494 Bacteria 2243
253 nmdc:mga07m45_220359_c1 3300050496 Bacteria 1104
254 nmdc:mga07m45_3017_c1 3300050496 Bacteria 8023
255 nmdc:mga07m45_30471_c1 3300050496 Bacteria 2988
256 nmdc:mga07m45_59608_c1 3300050496 Bacteria 2160
257 nmdc:mga07m45_61062_c1 3300050496 Bacteria 2135
258 nmdc:mga07m45_6281_c1 3300050496 Bacteria 4483
259 nmdc:mga0sz30_15941_c1 3300050516 Bacteria 2975
260 Ga0500578_0205552 3300053086 Bacteria 1203
261 Ga0500644_0001001 3300053088 Bacteria 8728
262 Ga0500593_000850 3300053117 Bacteria 11363
263 Ga0500628_007790 3300053129 Bacteria 1845
264 Ga0500658_0047385 3300053134 Bacteria 1744
265 Ga0500645_008663 3300053730 Bacteria 3454
266 Ga0500645_012024 3300053730 Bacteria 2807
267 Ga0500661_000475 3300055283 Bacteria 7443
268 Ga0501082_0468555 3300060353 Bacteria 1101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030736 Ga0316180_1001672 Ga0316180_10016722 199
2 3300048918 Ga0496115_0114853 Ga0496115_0114853_769_1497 210
3 3300046471 Ga0495650_0000224 Ga0495650_0000224_95677_96474 216
4 3300006028 Ga0070717_10136717 Ga0070717_101367172 217
5 3300049592 Ga0501076_0134271 Ga0501076_0134271_1225_1953 220
6 3300005328 Ga0070676_10083768 Ga0070676_100837682 222
7 3300005518 Ga0070699_100283387 Ga0070699_1002833871 222
8 3300025304 Ga0209257_1019713 Ga0209257_10197132 222
9 3300025907 Ga0207645_10167880 Ga0207645_101678802 222
10 3300050493 nmdc:mga0k408_41006_c1 nmdc:mga0k408_41006_c1_1100_1906 222
11 3300050494 nmdc:mga06z11_354588_c1 nmdc:mga06z11_354588_c1_30_836 222
12 3300050496 nmdc:mga07m45_59608_c1 nmdc:mga07m45_59608_c1_41_847 222
13 3300006178 Ga0075367_10001572 Ga0075367_100015721 225
14 3300006195 Ga0075366_10025801 Ga0075366_100258012 225
15 3300006353 Ga0075370_10016313 Ga0075370_100163131 225
16 3300025910 Ga0207684_10010915 Ga0207684_100109158 225
17 3300005467 Ga0070706_100260676 Ga0070706_1002606762 228
18 3300005518 Ga0070699_100681076 Ga0070699_1006810761 228
19 3300006058 Ga0075432_10026115 Ga0075432_100261152 228
20 3300027907 Ga0207428_10170721 Ga0207428_101707212 228
21 3300049775 Ga0501279_014639 Ga0501279_014639_306_1067 229
22 3300046460 Ga0495638_0006397 Ga0495638_0006397_7432_8223 231
23 3300046471 Ga0495650_0020500 Ga0495650_0020500_1845_2630 231
24 3300046491 Ga0495584_0001533 Ga0495584_0001533_3065_3856 231
25 3300046492 Ga0495585_0028438 Ga0495585_0028438_1709_2500 231
26 3300046512 Ga0495610_0012202 Ga0495610_0012202_737_1528 231
27 3300046513 Ga0495616_0008330 Ga0495616_0008330_3605_4396 231
28 3300046557 Ga0495622_0033216 Ga0495622_0033216_1496_2287 231
29 3300046558 Ga0495633_0000704 Ga0495633_0000704_12787_13620 231
30 3300046558 Ga0495633_0006585 Ga0495633_0006585_3106_3897 231
31 3300046648 Ga0495611_0006873 Ga0495611_0006873_837_1628 231
32 3300046665 Ga0495661_0030671 Ga0495661_0030671_1671_2462 231
33 3300046691 Ga0495670_0019979 Ga0495670_0019979_799_1590 231
34 3300048924 Ga0496121_0087753 Ga0496121_0087753_662_1504 231
35 3300050493 nmdc:mga0k408_409_c1 nmdc:mga0k408_409_c1_22283_23077 231
36 3300050496 nmdc:mga07m45_3017_c1 nmdc:mga07m45_3017_c1_4054_4848 231
37 3300046525 Ga0495663_0033280 Ga0495663_0033280_659_1450 233
38 3300046615 Ga0495656_0130035 Ga0495656_0130035_46_837 233
39 3300046664 Ga0495659_0009199 Ga0495659_0009199_1745_2536 233
40 3300046674 Ga0495588_0139003 Ga0495588_0139003_233_1024 233
41 iso_pu_bacteria 2808606418 2809146759 233
42 3300002774 JGI25150J39212_1006147 JGI25150J39212_10061472 235
43 3300046507 Ga0495606_0061468 Ga0495606_0061468_744_1571 235
44 3300046557 Ga0495622_0000028 Ga0495622_0000028_126670_127473 235
45 3300046692 Ga0495671_0216607 Ga0495671_0216607_21_854 235
46 3300048909 Ga0496106_0053685 Ga0496106_0053685_1794_2621 235
47 3300048924 Ga0496121_0321831 Ga0496121_0321831_133_960 235
48 3300049459 Ga0495678_004446 Ga0495678_004446_3990_4790 235
49 3300049459 Ga0495678_008060 Ga0495678_008060_1146_1943 235
50 3300053730 Ga0500645_008663 Ga0500645_008663_1069_1896 235
51 3300030731 Ga0316177_1210151 Ga0316177_12101512 236
52 3300030745 Ga0316182_1289593 Ga0316182_12895932 236
53 3300037312 Ga0395899_0001571 Ga0395899_0001571_16456_17298 236
54 3300044765 Ga0466970_0138816 Ga0466970_0138816_48_881 236
55 3300046513 Ga0495616_0056383 Ga0495616_0056383_452_1270 236
56 3300046524 Ga0495648_0052648 Ga0495648_0052648_38_841 236
57 3300046459 Ga0495629_0003279 Ga0495629_0003279_2936_3823 237
58 3300046460 Ga0495638_0129858 Ga0495638_0129858_644_1450 237
59 3300046463 Ga0495653_0031065 Ga0495653_0031065_2082_2888 237
60 3300046471 Ga0495650_0001255 Ga0495650_0001255_7609_8415 237
61 3300046474 Ga0495605_0024887 Ga0495605_0024887_905_1711 237
62 3300046492 Ga0495585_0000102 Ga0495585_0000102_8624_9430 237
63 3300046500 Ga0495596_0000779 Ga0495596_0000779_8297_9103 237
64 3300046500 Ga0495596_0004387 Ga0495596_0004387_3885_4691 237
65 3300046513 Ga0495616_0000184 Ga0495616_0000184_13067_13873 237
66 3300046518 Ga0495631_0014700 Ga0495631_0014700_518_1324 237
67 3300046520 Ga0495637_0018024 Ga0495637_0018024_838_1803 237
68 3300046522 Ga0495643_0000630 Ga0495643_0000630_27870_28682 237
69 3300046522 Ga0495643_0032503 Ga0495643_0032503_142_948 237
70 3300046523 Ga0495644_0019711 Ga0495644_0019711_565_1371 237
71 3300046523 Ga0495644_0063650 Ga0495644_0063650_83_889 237
72 3300046528 Ga0495642_0044497 Ga0495642_0044497_22_843 237
73 3300046538 Ga0495609_0003836 Ga0495609_0003836_5868_6674 237
74 3300046538 Ga0495609_0017435 Ga0495609_0017435_2054_2860 237
75 3300046616 Ga0495668_0034847 Ga0495668_0034847_967_1773 237
76 3300046648 Ga0495611_0009711 Ga0495611_0009711_1062_1868 237
77 3300046665 Ga0495661_0049963 Ga0495661_0049963_192_1010 237
78 3300046665 Ga0495661_0172059 Ga0495661_0172059_91_897 237
79 3300046674 Ga0495588_0005834 Ga0495588_0005834_1103_1909 237
80 3300046691 Ga0495670_0026576 Ga0495670_0026576_1899_2705 237
81 3300046794 Ga0495589_0124303 Ga0495589_0124303_365_1171 237
82 3300047318 Ga0495636_0155257 Ga0495636_0155257_13_819 237
83 3300047320 Ga0495672_0002147 Ga0495672_0002147_11768_12574 237
84 3300047321 Ga0495676_0198340 Ga0495676_0198340_128_934 237
85 3300047323 Ga0495683_0005871 Ga0495683_0005871_3501_4307 237
86 3300047323 Ga0495683_0031589 Ga0495683_0031589_1160_1966 237
87 3300047469 Ga0495673_0014333 Ga0495673_0014333_1239_2045 237
88 3300048091 Ga0495626_0000821 Ga0495626_0000821_22647_23612 237
89 3300048091 Ga0495626_0030239 Ga0495626_0030239_1588_2394 237
90 3300049568 Ga0501031_0000769 Ga0501031_0000769_4794_5573 237
91 3300046501 Ga0495607_0000552 Ga0495607_0000552_1615_2433 238
92 3300046513 Ga0495616_0015364 Ga0495616_0015364_141_959 238
93 3300046519 Ga0495632_0009760 Ga0495632_0009760_3534_4352 238
94 3300046522 Ga0495643_0000411 Ga0495643_0000411_7624_8445 238
95 3300046665 Ga0495661_0018893 Ga0495661_0018893_3410_4228 238
96 3300047320 Ga0495672_0127972 Ga0495672_0127972_508_1326 238
97 3300047445 Ga0495677_0014141 Ga0495677_0014141_1184_2002 238
98 iso_pu_bacteria 2547132374 2548498486 238
99 iso_pu_bacteria 2643221609 2644060401 238
100 iso_pu_bacteria 2643221611 2644076170 238
101 iso_pu_bacteria 2643221717 2644646290 238
102 3300031711 Ga0265314_10017945 Ga0265314_100179455 239
103 3300046471 Ga0495650_0000118 Ga0495650_0000118_10486_11316 239
104 3300046507 Ga0495606_0003111 Ga0495606_0003111_6752_7582 239
105 3300046524 Ga0495648_0070946 Ga0495648_0070946_624_1454 239
106 iso_pu_bacteria 2643221654 2644305830 239
107 3300049573 Ga0501037_0299375 Ga0501037_0299375_282_1082 240
108 3300053088 Ga0500644_0001001 Ga0500644_0001001_3202_4005 240
109 3300053117 Ga0500593_000850 Ga0500593_000850_6480_7283 240
110 iso_pu_bacteria 2842718218 2842721022 240
111 iso_pu_bacteria 2894023352 2894026487 240
112 iso_pu_bacteria 2974320154 2974323936 240
113 iso_pu_bacteria 2511231002 2511244228 241
114 iso_pu_bacteria 2932422444 2932423493 241
115 iso_pu_bacteria 2939631187 2939631582 241
116 3300005338 Ga0068868_100406179 Ga0068868_1004061792 242
117 3300027876 Ga0209974_10008311 Ga0209974_100083113 242
118 3300031548 Ga0307408_100000284 Ga0307408_10000028419 242
119 3300031730 Ga0307516_10092494 Ga0307516_100924942 242
120 3300031901 Ga0307406_10000151 Ga0307406_1000015127 242
121 3300046507 Ga0495606_0000011 Ga0495606_0000011_110941_111744 242
122 iso_pu_bacteria 2600255292 2601667638 242
123 iso_pu_bacteria 2643221570 2643866968 242
124 iso_pu_bacteria 2643221596 2643993683 242
125 iso_pu_bacteria 2643221652 2644294819 242
126 iso_pu_bacteria 2738543012 2739242801 242
127 iso_pu_bacteria 2816332133 2816475840 242
128 iso_pu_bacteria 2857547612 2857550336 242
129 iso_pu_bacteria 2885080285 2885081372 242
130 iso_pu_bacteria 2932410948 2932411243 242
131 iso_pu_bacteria 2932416698 2932419190 242
132 iso_pu_bacteria 2990710928 2990712954 242
133 3300027682 Ga0209971_1002072 Ga0209971_10020722 243
134 3300031235 Ga0265330_10000032 Ga0265330_1000003221 243
135 3300031238 Ga0265332_10000001 Ga0265332_10000001106 243
136 3300031241 Ga0265325_10005927 Ga0265325_100059274 243
137 3300031548 Ga0307408_100001145 Ga0307408_10000114520 243
138 3300031711 Ga0265314_10000022 Ga0265314_10000022106 243
139 3300049571 Ga0501034_0218640 Ga0501034_0218640_193_1017 243
140 3300005289 Ga0065704_10219490 Ga0065704_102194901 244
141 3300006051 Ga0075364_10072849 Ga0075364_100728492 244
142 3300031824 Ga0307413_10589957 Ga0307413_105899571 244
143 3300032002 Ga0307416_100146343 Ga0307416_1001463432 244
144 3300041404 Ga0439436_0016429 Ga0439436_0016429_763_1563 244
145 3300041408 Ga0439453_0005241 Ga0439453_0005241_991_1791 244
146 3300042128 Ga0450897_000589 Ga0450897_000589_344_1144 244
147 3300002704 JGI25155J39150_1000095 JGI25155J39150_100009526 245
148 3300002705 JGI25156J39149_1000025 JGI25156J39149_100002598 245
149 3300002738 JGI25154J39366_1000045 JGI25154J39366_100004598 245
150 3300002741 JGI25157J39369_1000034 JGI25157J39369_100003498 245
151 3300003354 JGI25160J50197_1000207 JGI25160J50197_100020715 245
152 3300003374 JGI25161J50226_1000148 JGI25161J50226_100014825 245
153 3300003771 Ga0055526_1000306 Ga0055526_100030622 245
154 3300003773 Ga0055537_1000008 Ga0055537_100000820 245
155 3300003775 Ga0055524_1000075 Ga0055524_100007540 245
156 3300003781 Ga0055536_1001446 Ga0055536_10014462 245
157 3300003784 Ga0055534_1002376 Ga0055534_10023762 245
158 3300003790 Ga0055528_1001296 Ga0055528_10012969 245
159 3300003791 Ga0055530_10000152 Ga0055530_1000015220 245
160 3300003791 Ga0055530_10049930 Ga0055530_100499301 245
161 3300003792 Ga0055540_1000160 Ga0055540_100016041 245
162 3300003794 Ga0055531_10000366 Ga0055531_1000036624 245
163 3300004625 Ga0055543_1000201 Ga0055543_100020115 245
164 3300005262 Ga0065165_1000870 Ga0065165_10008702 245
165 3300005262 Ga0065165_1006228 Ga0065165_10062288 245
166 3300005262 Ga0065165_1019795 Ga0065165_10197953 245
167 3300005288 Ga0065714_10099964 Ga0065714_100999642 245
168 3300005288 Ga0065714_10122010 Ga0065714_101220102 245
169 3300005295 Ga0065707_10137732 Ga0065707_101377322 245
170 3300005367 Ga0070667_100028369 Ga0070667_1000283695 245
171 3300005459 Ga0068867_100021676 Ga0068867_1000216762 245
172 3300005548 Ga0070665_100137970 Ga0070665_1001379702 245
173 3300005843 Ga0068860_100089474 Ga0068860_1000894744 245
174 3300006038 Ga0075365_10112022 Ga0075365_101120221 245
175 3300006038 Ga0075365_10260405 Ga0075365_102604052 245
176 3300006038 Ga0075365_10392205 Ga0075365_103922051 245
177 3300006051 Ga0075364_10144054 Ga0075364_101440542 245
178 3300006051 Ga0075364_10262198 Ga0075364_102621982 245
179 3300006177 Ga0075362_10051571 Ga0075362_100515712 245
180 3300006178 Ga0075367_10029078 Ga0075367_100290783 245
181 3300006186 Ga0075369_10046701 Ga0075369_100467013 245
182 3300006195 Ga0075366_10000851 Ga0075366_1000085116 245
183 3300006195 Ga0075366_10008680 Ga0075366_100086806 245
184 3300006195 Ga0075366_10077245 Ga0075366_100772451 245
185 3300006353 Ga0075370_10028287 Ga0075370_100282873 245
186 3300006881 Ga0068865_100077308 Ga0068865_1000773083 245
187 3300006946 Ga0079104_1010726 Ga0079104_10107263 245
188 3300009094 Ga0111539_10446380 Ga0111539_104463802 245
189 3300009098 Ga0105245_10277374 Ga0105245_102773742 245
190 3300009098 Ga0105245_10369921 Ga0105245_103699212 245
191 3300009098 Ga0105245_10425312 Ga0105245_104253122 245
192 3300009148 Ga0105243_10040357 Ga0105243_100403575 245
193 3300010375 Ga0105239_10097572 Ga0105239_100975723 245
194 3300012513 Ga0157326_1002912 Ga0157326_10029122 245
195 3300013308 Ga0157375_10081859 Ga0157375_100818593 245
196 3300014497 Ga0182008_10000413 Ga0182008_100004135 245
197 3300014969 Ga0157376_10276120 Ga0157376_102761202 245
198 3300015261 Ga0182006_1000002 Ga0182006_1000002542 245
199 3300015262 Ga0182007_10000606 Ga0182007_1000060616 245
200 3300015265 Ga0182005_1000002 Ga0182005_1000002551 245
201 3300025206 Ga0209435_100001 Ga0209435_100001884 245
202 3300025208 Ga0209436_112261 Ga0209436_1122612 245
203 3300025245 Ga0207425_1003160 Ga0207425_10031602 245
204 3300025246 Ga0209646_1000001 Ga0209646_10000011253 245
205 3300025250 Ga0209026_1000003 Ga0209026_1000003884 245
206 3300025256 Ga0209759_1000001 Ga0209759_1000001884 245
207 3300025263 Ga0209565_1000004 Ga0209565_1000004794 245
208 3300025263 Ga0209565_1000563 Ga0209565_100056319 245
209 3300025263 Ga0209565_1019414 Ga0209565_10194141 245
210 3300025273 Ga0209673_1000275 Ga0209673_100027514 245
211 3300025284 Ga0209130_1000129 Ga0209130_100012915 245
212 3300025284 Ga0209130_1000299 Ga0209130_10002994 245
213 3300025291 Ga0209675_1000044 Ga0209675_1000044217 245
214 3300025291 Ga0209675_1004528 Ga0209675_10045283 245
215 3300025292 Ga0209676_1000029 Ga0209676_1000029110 245
216 3300025292 Ga0209676_1001100 Ga0209676_100110017 245
217 3300025294 Ga0209025_1001299 Ga0209025_100129931 245
218 3300025294 Ga0209025_1009536 Ga0209025_10095368 245
219 3300025294 Ga0209025_1019901 Ga0209025_10199012 245
220 3300025295 Ga0209564_1000356 Ga0209564_100035638 245
221 3300025295 Ga0209564_1002112 Ga0209564_100211212 245
222 3300025298 Ga0209050_1000003 Ga0209050_1000003172 245
223 3300025298 Ga0209050_1001447 Ga0209050_100144716 245
224 3300025298 Ga0209050_1016742 Ga0209050_10167422 245
225 3300025299 Ga0209256_1000001 Ga0209256_1000001174 245
226 3300025299 Ga0209256_1061377 Ga0209256_10613771 245
227 3300025302 Ga0207426_1000071 Ga0207426_1000071269 245
228 3300025303 Ga0209051_1000003 Ga0209051_1000003172 245
229 3300025304 Ga0209257_1000018 Ga0209257_1000018172 245
230 3300025304 Ga0209257_1015706 Ga0209257_10157062 245
231 3300025913 Ga0207695_10046804 Ga0207695_100468045 245
232 3300025927 Ga0207687_10127420 Ga0207687_101274202 245
233 3300025933 Ga0207706_10021297 Ga0207706_100212975 245
234 3300025935 Ga0207709_10097430 Ga0207709_100974302 245
235 3300025938 Ga0207704_10071196 Ga0207704_100711963 245
236 3300025986 Ga0207658_10016689 Ga0207658_100166895 245
237 3300025986 Ga0207658_10135201 Ga0207658_101352012 245
238 3300026116 Ga0207674_10008091 Ga0207674_100080915 245
239 3300031456 Ga0307513_10000014 Ga0307513_1000001471 245
240 3300031548 Ga0307408_100006612 Ga0307408_1000066128 245
241 3300031730 Ga0307516_10051752 Ga0307516_100517525 245
242 3300032004 Ga0307414_10189800 Ga0307414_101898002 245
243 3300037068 Ga0373925_0282799 Ga0373925_0282799_160_987 245
244 3300042876 Ga0451577_0030529 Ga0451577_0030529_429_1244 245
245 3300044712 Ga0453684_0135914 Ga0453684_0135914_1958_2773 245
246 3300046452 Ga0495617_078456 Ga0495617_078456_265_1068 245
247 3300046474 Ga0495605_0076343 Ga0495605_0076343_97_900 245
248 3300046501 Ga0495607_0167691 Ga0495607_0167691_99_914 245
249 3300046519 Ga0495632_0007872 Ga0495632_0007872_4523_5326 245
250 3300046530 Ga0495654_0036558 Ga0495654_0036558_934_1752 245
251 3300046558 Ga0495633_0000250 Ga0495633_0000250_18073_18891 245
252 3300046692 Ga0495671_0102673 Ga0495671_0102673_550_1353 245
253 3300046694 Ga0495649_0005401 Ga0495649_0005401_78_881 245
254 3300046810 Ga0495660_0018541 Ga0495660_0018541_123_926 245
255 3300047320 Ga0495672_0000097 Ga0495672_0000097_115108_115929 245
256 3300047472 Ga0495686_0001813 Ga0495686_0001813_7587_8405 245
257 3300048914 Ga0496111_0210515 Ga0496111_0210515_11_829 245
258 3300048919 Ga0496116_0024690 Ga0496116_0024690_2832_3650 245
259 3300048920 Ga0496117_0000001 Ga0496117_0000001_1485365_1486183 245
260 3300048921 Ga0496118_0000002 Ga0496118_0000002_1485365_1486183 245
261 3300048924 Ga0496121_0004101 Ga0496121_0004101_10962_11780 245
262 3300048925 Ga0496122_0000822 Ga0496122_0000822_21891_22706 245
263 3300048926 Ga0496123_0001379 Ga0496123_0001379_17404_18219 245
264 3300048927 Ga0496124_0138464 Ga0496124_0138464_661_1479 245
265 3300048928 Ga0496125_0120731 Ga0496125_0120731_12_830 245
266 3300048929 Ga0496126_0405585 Ga0496126_0405585_233_1051 245
267 3300049460 Ga0495682_0002675 Ga0495682_0002675_1485_2303 245
268 3300049582 Ga0501048_0110834 Ga0501048_0110834_130_945 245
269 3300049591 Ga0501075_0249264 Ga0501075_0249264_490_1305 245
270 3300049742 Ga0501080_0111820 Ga0501080_0111820_313_1128 245
271 3300050489 nmdc:mga03683_2515_c1 nmdc:mga03683_2515_c1_2223_3026 245
272 3300050489 nmdc:mga03683_36276_c1 nmdc:mga03683_36276_c1_466_1269 245
273 3300050489 nmdc:mga03683_76245_c1 nmdc:mga03683_76245_c1_359_1162 245
274 3300050491 nmdc:mga00v17_38223_c1 nmdc:mga00v17_38223_c1_1670_2473 245
275 3300050492 nmdc:mga0yw44_108074_c1 nmdc:mga0yw44_108074_c1_79_882 245
276 3300050493 nmdc:mga0k408_143574_c1 nmdc:mga0k408_143574_c1_17_823 245
277 3300050493 nmdc:mga0k408_550_c1 nmdc:mga0k408_550_c1_13768_14571 245
278 3300050493 nmdc:mga0k408_6314_c1 nmdc:mga0k408_6314_c1_247_1050 245
279 3300050494 nmdc:mga06z11_277246_c1 nmdc:mga06z11_277246_c1_30_833 245
280 3300050494 nmdc:mga06z11_44320_c1 nmdc:mga06z11_44320_c1_619_1422 245
281 3300050496 nmdc:mga07m45_220359_c1 nmdc:mga07m45_220359_c1_78_881 245
282 3300050496 nmdc:mga07m45_30471_c1 nmdc:mga07m45_30471_c1_1622_2425 245
283 3300050496 nmdc:mga07m45_61062_c1 nmdc:mga07m45_61062_c1_925_1728 245
284 3300050496 nmdc:mga07m45_6281_c1 nmdc:mga07m45_6281_c1_1590_2393 245
285 3300050516 nmdc:mga0sz30_15941_c1 nmdc:mga0sz30_15941_c1_583_1386 245
286 3300053086 Ga0500578_0205552 Ga0500578_0205552_181_984 245
287 3300053129 Ga0500628_007790 Ga0500628_007790_648_1451 245
288 3300053134 Ga0500658_0047385 Ga0500658_0047385_714_1517 245
289 3300053730 Ga0500645_012024 Ga0500645_012024_1848_2651 245
290 3300055283 Ga0500661_000475 Ga0500661_000475_3077_3880 245
291 3300060353 Ga0501082_0468555 Ga0501082_0468555_160_975 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02405

MlaE

Permease MlaE

87

297

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zy2-assembly1.cif.gz_H cryo-em structure of apo mlafedb 0.7734 9 239
7ch9-assembly1.cif.gz_H cryo-em structure of p.aeruginosa mlafebd 0.761 7 241
7ch8-assembly1.cif.gz_H cryo-em structure of p.aeruginosa mlafebd with adp-v 0.7606 7 241
7d0a-assembly1.cif.gz_D acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation 0.7414 9 241
6z5u-assembly1.cif.gz_B cryo-em structure of the a. baumannii mlabdef complex bound to appnhp 0.7328 11 245
ID Description Score Start End Superfamily
af_A0A1D6EJ30_351_510_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4912 71 232 1.20.1250.20
af_A0A1D6EJ30_351_510_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4829 71 232 1.20.1250.20
af_Q651I6_271_428_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.467 68 233 1.20.1250.20
af_Q651I6_271_428_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4604 68 233 1.20.1250.20
af_Q96JW4_154_338_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4599 50 236 1.10.357.20
ID Description Score Start End GO Terms
AF-A0A4Q5W327-F1-model_v4 deleted 0.9291 36 245
AF-A0A5C7VLH4-F1-model_v4 ABC transporter permease 0.9261 1 245 GO:0043190
AF-A0A5C7VLH4-F1-model_v4 ABC transporter permease 0.9225 1 245 GO:0043190
AF-A0A1F4CBU2-F1-model_v4 ABC transporter permease 0.9158 7 245 GO:0005548
GO:0043190
AF-A1WFD1-F1-model_v4 ABC-type transport system ipermease component 0.9106 4 245 GO:0043190

Feature Viewer

pLDDT pTM Quality
79.19 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map