F390173

General Info

Members Datasets Scaffolds Average Seq Length
291 177 582 244

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100376630|Ga0068869_1003766301
Length 266
Sequence MAAVLHNLLVPVEPPPAADGAPSVALSVVAPVFEEKENLRTLHSEIVRVLGAGKDWELVLVDDGSRDGSDALIRELAREDPRVVGVFFAANRGQSAATAAGVQASRGRVVATLDADLQNDPADLPAMLGALDGNDAVVGYRVKRQDGFVRRVSSRIGNGVRNRLSKDSIRDTGCSLKVFRAEAARSIRWFNGAHRFLPTLLRHQGFTVVEHPVSHRPRRAGKSKYGIRNRALRGLLDVLAVRWMRARRIDFPVKEVIRGREVXRGR

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
96 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
97 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
115 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
158 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
159 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
160 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
161 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
162 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
163 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
164 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
165 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
166 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
167 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
168 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
169 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
170 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
171 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
172 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
173 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
174 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
175 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
176 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
177 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 0
Isolates 1.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.9
Nodule 0
Rhizoplane 6.19
Rhizosphere 81.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100376630 3300005334 Bacteria 1162
2 Ga0070658_10246704 3300005327 Bacteria 1514
3 Ga0070658_10378288 3300005327 Bacteria 1214
4 Ga0070690_100070481 3300005330 Bacteria 2270
5 Ga0070670_100009610 3300005331 Bacteria 8254
6 Ga0070670_100086588 3300005331 Bacteria 2692
7 Ga0070680_100023814 3300005336 Bacteria 4887
8 Ga0070680_100264471 3300005336 Bacteria 1456
9 Ga0068868_100272219 3300005338 Bacteria 1431
10 Ga0070660_100029882 3300005339 Bacteria 4086
11 Ga0070660_100338994 3300005339 Bacteria 1237
12 Ga0070689_100000917 3300005340 Bacteria 18401
13 Ga0070691_10013965 3300005341 Bacteria 3684
14 Ga0070668_100000707 3300005347 Bacteria 22821
15 Ga0070668_100001069 3300005347 Bacteria 19272
16 Ga0070668_100009879 3300005347 Bacteria 7068
17 Ga0070668_100016072 3300005347 Bacteria 5600
18 Ga0070669_100053167 3300005353 Bacteria 2964
19 Ga0070669_100059194 3300005353 Bacteria 2813
20 Ga0070671_100134825 3300005355 Bacteria 2081
21 Ga0070673_100289240 3300005364 Bacteria 1440
22 Ga0070659_100000315 3300005366 Bacteria 37706
23 Ga0070659_100181113 3300005366 Bacteria 1729
24 Ga0070667_100003824 3300005367 Bacteria 12796
25 Ga0070678_100071349 3300005456 Bacteria 2600
26 Ga0070681_10044731 3300005458 Bacteria 4432
27 Ga0070681_10173532 3300005458 Bacteria 2077
28 Ga0070679_100000858 3300005530 Bacteria 26439
29 Ga0070679_100013292 3300005530 Bacteria 7881
30 Ga0068853_100033140 3300005539 Bacteria 4381
31 Ga0068853_100071002 3300005539 Bacteria 3032
32 Ga0070686_100052718 3300005544 Bacteria 2595
33 Ga0070665_100000593 3300005548 Bacteria 50386
34 Ga0070665_100042994 3300005548 Bacteria 4542
35 Ga0070665_100068577 3300005548 Bacteria 3556
36 Ga0070665_100119780 3300005548 Bacteria 2634
37 Ga0068855_100009421 3300005563 Bacteria 11794
38 Ga0068855_100029587 3300005563 Bacteria 6547
39 Ga0068855_100144295 3300005563 Bacteria 2711
40 Ga0068855_100158042 3300005563 Bacteria 2574
41 Ga0070664_100257136 3300005564 Bacteria 1571
42 Ga0068857_100082664 3300005577 Bacteria 2869
43 Ga0068854_100070942 3300005578 Bacteria 2547
44 Ga0068856_100163863 3300005614 Bacteria 2234
45 Ga0068852_100416206 3300005616 Bacteria 1325
46 Ga0068859_100000747 3300005617 Bacteria 32789
47 Ga0068859_100015606 3300005617 Bacteria 7632
48 Ga0068859_100282443 3300005617 Bacteria 1753
49 Ga0068864_100000067 3300005618 Bacteria 115834
50 Ga0068864_100004585 3300005618 Bacteria 11336
51 Ga0068864_100148096 3300005618 Bacteria 2124
52 Ga0068864_100265348 3300005618 Bacteria 1598
53 Ga0068863_100000735 3300005841 Bacteria 32827
54 Ga0068863_100007632 3300005841 Bacteria 10579
55 Ga0068863_100076581 3300005841 Bacteria 3164
56 Ga0068863_100076891 3300005841 Bacteria 3158
57 Ga0068863_100537844 3300005841 Bacteria 1153
58 Ga0068858_100000020 3300005842 Bacteria 175896
59 Ga0068858_100001493 3300005842 Bacteria 24115
60 Ga0068858_100444591 3300005842 Bacteria 1249
61 Ga0068860_100000382 3300005843 Bacteria 58081
62 Ga0068860_100011682 3300005843 Bacteria 8657
63 Ga0068860_100410830 3300005843 Bacteria 1340
64 Ga0068862_100002990 3300005844 Bacteria 14752
65 Ga0068862_100017278 3300005844 Bacteria 6005
66 Ga0068862_100023889 3300005844 Bacteria 5124
67 Ga0068862_100026673 3300005844 Bacteria 4857
68 Ga0070717_10051586 3300006028 Bacteria 3386
69 Ga0070717_10557569 3300006028 Bacteria 1038
70 Ga0075362_10014721 3300006177 Bacteria 3165
71 Ga0075428_100001270 3300006844 Bacteria 26913
72 Ga0075429_100196498 3300006880 Bacteria 1767
73 Ga0068865_100001019 3300006881 Bacteria 16107
74 Ga0097620_100000747 3300006931 Bacteria 32789
75 Ga0097620_100015606 3300006931 Bacteria 7632
76 Ga0097620_100282432 3300006931 Bacteria 1753
77 Ga0099794_10029981 3300007265 Bacteria 2537
78 Ga0099794_10093708 3300007265 Bacteria 1493
79 Ga0105251_10083816 3300009011 Bacteria 1471
80 Ga0105250_10024347 3300009092 Bacteria 2439
81 Ga0105240_10021836 3300009093 Bacteria 8505
82 Ga0105240_10132547 3300009093 Bacteria 2987
83 Ga0105240_10252559 3300009093 Bacteria 2038
84 Ga0105240_10404535 3300009093 Bacteria 1537
85 Ga0111539_10002362 3300009094 Bacteria 25087
86 Ga0105247_10245179 3300009101 Bacteria 1222
87 Ga0105247_10295029 3300009101 Bacteria 1123
88 Ga0105248_10000305 3300009177 Bacteria 58472
89 Ga0105248_10003586 3300009177 Bacteria 17204
90 Ga0105248_10007895 3300009177 Bacteria 11694
91 Ga0105248_10030169 3300009177 Bacteria 6053
92 Ga0105248_10255658 3300009177 Bacteria 1972
93 Ga0105238_10021798 3300009551 Bacteria 6526
94 Ga0105249_10077080 3300009553 Bacteria 3091
95 Ga0105249_10305481 3300009553 Bacteria 1597
96 Ga0105239_10091888 3300010375 Bacteria 3350
97 Ga0105239_10188918 3300010375 Bacteria 2306
98 Ga0105239_10331055 3300010375 Bacteria 1718
99 Ga0105239_10492957 3300010375 Bacteria 1392
100 Ga0105239_10571275 3300010375 Bacteria 1289
101 Ga0105239_10784247 3300010375 Bacteria 1092
102 Ga0163162_10097413 3300013306 Bacteria 3030
103 Ga0163162_10379115 3300013306 Bacteria 1547
104 Ga0157375_10016957 3300013308 Bacteria 6563
105 Ga0163163_10003065 3300014325 Bacteria 14146
106 Ga0163163_10019624 3300014325 Bacteria 6349
107 Ga0163163_10034972 3300014325 Bacteria 4871
108 Ga0163163_10139445 3300014325 Bacteria 2467
109 Ga0163163_10928530 3300014325 Bacteria 933
110 Ga0157379_10002854 3300014968 Bacteria 14564
111 Ga0157379_10055262 3300014968 Bacteria 3547
112 Ga0157379_10509904 3300014968 Bacteria 1115
113 Ga0207696_1025689 3300025711 Bacteria 1832
114 Ga0207710_10171959 3300025900 Bacteria 1059
115 Ga0207710_10183602 3300025900 Bacteria 1027
116 Ga0207705_10000556 3300025909 Bacteria 31398
117 Ga0207707_10021552 3300025912 Bacteria 5633
118 Ga0207707_10182933 3300025912 Bacteria 1829
119 Ga0207695_10001235 3300025913 Bacteria 43771
120 Ga0207695_10002484 3300025913 Bacteria 27149
121 Ga0207695_10022933 3300025913 Bacteria 7070
122 Ga0207695_10054233 3300025913 Bacteria 4188
123 Ga0207660_10000773 3300025917 Bacteria 21298
124 Ga0207657_10000693 3300025919 Bacteria 35842
125 Ga0207657_10031284 3300025919 Bacteria 4824
126 Ga0207657_10203288 3300025919 Bacteria 1592
127 Ga0207652_10019459 3300025921 Bacteria 5584
128 Ga0207652_10065050 3300025921 Bacteria 3156
129 Ga0207681_10039606 3300025923 Bacteria 3130
130 Ga0207681_10049632 3300025923 Bacteria 2837
131 Ga0207694_10042147 3300025924 Bacteria 3520
132 Ga0207650_10011082 3300025925 Bacteria 6199
133 Ga0207650_10012810 3300025925 Bacteria 5794
134 Ga0207650_10068550 3300025925 Bacteria 2664
135 Ga0207690_10000843 3300025932 Bacteria 19644
136 Ga0207690_10296326 3300025932 Bacteria 1264
137 Ga0207706_10047076 3300025933 Bacteria 3817
138 Ga0207704_10002498 3300025938 Bacteria 8290
139 Ga0207711_10000160 3300025941 Bacteria 72317
140 Ga0207711_10019133 3300025941 Bacteria 5699
141 Ga0207711_10092152 3300025941 Bacteria 2666
142 Ga0207711_10162484 3300025941 Bacteria 2023
143 Ga0207679_10119334 3300025945 Bacteria 2097
144 Ga0207667_10006652 3300025949 Bacteria 13971
145 Ga0207667_10045108 3300025949 Bacteria 4669
146 Ga0207667_10073960 3300025949 Bacteria 3540
147 Ga0207667_10135248 3300025949 Bacteria 2538
148 Ga0207651_10243817 3300025960 Bacteria 1466
149 Ga0207712_10064297 3300025961 Bacteria 2615
150 Ga0207668_10000002 3300025972 Bacteria 209163
151 Ga0207668_10000788 3300025972 Bacteria 19416
152 Ga0207640_10112022 3300025981 Bacteria 1936
153 Ga0207658_10247577 3300025986 Bacteria 1513
154 Ga0207703_10000082 3300026035 Bacteria 110579
155 Ga0207703_10000853 3300026035 Bacteria 29885
156 Ga0207702_10126124 3300026078 Bacteria 2298
157 Ga0207641_10000007 3300026088 Bacteria 441443
158 Ga0207641_10009603 3300026088 Bacteria 7973
159 Ga0207641_10107082 3300026088 Bacteria 2472
160 Ga0207641_10167510 3300026088 Bacteria 2002
161 Ga0207641_10490790 3300026088 Bacteria 1191
162 Ga0207676_10000191 3300026095 Bacteria 53466
163 Ga0207676_10004212 3300026095 Bacteria 10160
164 Ga0207676_10041004 3300026095 Bacteria 3551
165 Ga0207676_10120279 3300026095 Bacteria 2213
166 Ga0207676_10425745 3300026095 Bacteria 1246
167 Ga0207674_10050977 3300026116 Bacteria 4225
168 Ga0207675_100179652 3300026118 Bacteria 2026
169 Ga0207683_10322786 3300026121 Bacteria 1414
170 Ga0207683_10328697 3300026121 Bacteria 1401
171 Ga0209981_1000327 3300027378 Bacteria 6139
172 Ga0207428_10018011 3300027907 Bacteria 6049
173 Ga0268266_10000003 3300028379 Bacteria 1701703
174 Ga0268266_10035677 3300028379 Bacteria 4230
175 Ga0268265_10006024 3300028380 Bacteria 8250
176 Ga0268265_10007874 3300028380 Bacteria 7190
177 Ga0268265_10016924 3300028380 Bacteria 5020
178 Ga0268264_10000008 3300028381 Bacteria 773387
179 Ga0268264_10004796 3300028381 Bacteria 11473
180 Ga0268264_10010210 3300028381 Bacteria 7772
181 Ga0307517_10019757 3300028786 Bacteria 8620
182 Ga0307517_10104925 3300028786 Bacteria 2197
183 Ga0307517_10279072 3300028786 Bacteria 954
184 Ga0265327_10016699 3300031251 Bacteria 4645
185 Ga0307513_10009525 3300031456 Bacteria 12284
186 Ga0307513_10023387 3300031456 Bacteria 7218
187 Ga0307408_100073487 3300031548 Bacteria 2535
188 Ga0307508_10216758 3300031616 Bacteria 1514
189 Ga0307413_10070534 3300031824 Bacteria 2198
190 Ga0307413_10112186 3300031824 Bacteria 1827
191 Ga0307414_10111624 3300032004 Bacteria 2082
192 Ga0307414_10410600 3300032004 Bacteria 1178
193 Ga0307414_10580898 3300032004 Bacteria 1002
194 Ga0307510_10126155 3300033180 Bacteria 2248
195 Ga0373944_0021884 3300035089 Bacteria 1854
196 Ga0373936_0004949 3300035113 Bacteria 5018
197 Ga0373955_0302692 3300035172 Bacteria 964
198 Ga0373935_0288078 3300035692 Bacteria 1158
199 Ga0373927_0003482 3300035695 Bacteria 11271
200 Ga0373937_0001520 3300036401 Bacteria 19497
201 Ga0373925_0000257 3300037068 Bacteria 55764
202 Ga0395899_0005899 3300037312 Bacteria 9504
203 Ga0395899_0185730 3300037312 Bacteria 1457
204 Ga0395899_0238994 3300037312 Bacteria 1251
205 Ga0395900_0000072 3300037418 Bacteria 187428
206 Ga0395900_0012117 3300037418 Bacteria 8810
207 Ga0395898_0052080 3300037466 Bacteria 3999
208 Ga0395905_0005670 3300037471 Bacteria 12700
209 Ga0395905_0042917 3300037471 Bacteria 4243
210 Ga0395905_0341130 3300037471 Bacteria 1389
211 Ga0395901_0001358 3300038443 Bacteria 25609
212 Ga0395901_0295818 3300038443 Bacteria 1679
213 Ga0451576_0015459 3300045051 Bacteria 8453
214 Ga0495629_0057699 3300046459 Bacteria 2714
215 Ga0495638_0203366 3300046460 Bacteria 1117
216 Ga0495594_0086427 3300046499 Bacteria 1755
217 Ga0495606_0199237 3300046507 Bacteria 1142
218 Ga0495610_0020422 3300046512 Bacteria 3678
219 Ga0495618_0211410 3300046514 Bacteria 1226
220 Ga0495620_0009236 3300046515 Bacteria 5252
221 Ga0495630_0069939 3300046517 Bacteria 2641
222 Ga0495648_0192204 3300046524 Bacteria 1029
223 Ga0495642_0001584 3300046528 Bacteria 9972
224 Ga0495640_0202855 3300046533 Bacteria 1256
225 Ga0495597_0002564 3300046542 Bacteria 11369
226 Ga0495645_0142782 3300046543 Bacteria 1669
227 Ga0495668_0011037 3300046616 Bacteria 5434
228 Ga0495611_0016748 3300046648 Bacteria 3132
229 Ga0495625_0083287 3300046660 Bacteria 2224
230 Ga0495599_0313216 3300046678 Bacteria 946
231 Ga0495669_0144447 3300046684 Bacteria 1124
232 Ga0495649_0000089 3300046694 Bacteria 79134
233 Ga0495636_0029058 3300047318 Bacteria 2256
234 Ga0495672_0025070 3300047320 Bacteria 3826
235 Ga0495687_027528 3300047443 Bacteria 2659
236 Ga0495593_0013357 3300047673 Bacteria 4687
237 Ga0496100_0346767 3300048903 Bacteria 1121
238 Ga0496101_0302451 3300048904 Bacteria 1253
239 Ga0496102_0076435 3300048905 Bacteria 3080
240 Ga0496103_0243627 3300048906 Bacteria 1157
241 Ga0496104_0376173 3300048907 Bacteria 1333
242 Ga0496106_0096387 3300048909 Bacteria 2289
243 Ga0496107_0114412 3300048910 Bacteria 1985
244 Ga0496108_0080504 3300048911 Bacteria 2759
245 Ga0496109_0018388 3300048912 Bacteria 6141
246 Ga0496110_0492591 3300048913 Bacteria 1116
247 Ga0496112_0018366 3300048915 Bacteria 6583
248 Ga0496112_0323558 3300048915 Bacteria 1486
249 Ga0496113_0063364 3300048916 Bacteria 2794
250 Ga0496114_0342711 3300048917 Bacteria 1322
251 Ga0496115_0002138 3300048918 Bacteria 14127
252 Ga0496115_0002497 3300048918 Bacteria 13220
253 Ga0496115_0179231 3300048918 Bacteria 1752
254 Ga0496117_0063629 3300048920 Bacteria 2521
255 Ga0496119_0023907 3300048922 Bacteria 4317
256 Ga0496121_0000035 3300048924 Bacteria 374316
257 Ga0496121_0198541 3300048924 Bacteria 1432
258 Ga0496122_0143624 3300048925 Bacteria 1488
259 Ga0501033_0014073 3300049570 Bacteria 6084
260 Ga0501037_0116920 3300049573 Bacteria 1919
261 Ga0501047_0076957 3300049581 Bacteria 3211
262 Ga0501047_0108107 3300049581 Bacteria 2663
263 Ga0501035_0167821 3300049822 Bacteria 1897
264 nmdc:mga03683_69230_c1 3300050489 Bacteria 1505
265 nmdc:mga09592_187041_c1 3300050508 Bacteria 1792
266 nmdc:mga08y16_9412_c1 3300050511 Bacteria 10247
267 Ga0500635_0000133 3300053080 Bacteria 42884
268 Ga0500651_0003759 3300053093 Bacteria 8368
269 Ga0500566_0012049 3300053094 Bacteria 5093
270 Ga0500641_0144653 3300053096 Bacteria 1027
271 Ga0500555_001064 3300053103 Bacteria 9234
272 Ga0500556_0063164 3300053104 Bacteria 1368
273 Ga0500569_000529 3300053109 Bacteria 6363
274 Ga0500595_004824 3300053119 Bacteria 5968
275 Ga0500595_008313 3300053119 Bacteria 4247
276 Ga0500595_011965 3300053119 Bacteria 3373
277 Ga0500607_117573 3300053121 Bacteria 1292
278 Ga0500614_005434 3300053123 Bacteria 2673
279 Ga0500590_027108 3300053148 Bacteria 2970
280 Ga0500620_065392 3300053155 Bacteria 1244
281 Ga0500638_085395 3300053162 Bacteria 1494
282 Ga0500639_126396 3300053163 Bacteria 1219
283 Ga0500636_0003639 3300053177 Bacteria 8694
284 Ga0500636_0184446 3300053177 Bacteria 1117
285 Ga0500637_0007759 3300053178 Bacteria 5382
286 Ga0500637_0060755 3300053178 Bacteria 2164
287 Ga0500596_001059 3300053735 Bacteria 5540
288 2644353478 2643221663 Bacteria 3425771
289 2757566280 2757320391 Bacteria 4746095
290 2941486144 2941485952 Bacteria 3591484
291 2980183738 2980182181 Bacteria 9454109
292 Ga0068869_100376630
293 Ga0070658_10246704
294 Ga0070658_10378288
295 Ga0070690_100070481
296 Ga0070670_100009610
297 Ga0070670_100086588
298 Ga0070680_100023814
299 Ga0070680_100264471
300 Ga0068868_100272219
301 Ga0070660_100029882
302 Ga0070660_100338994
303 Ga0070689_100000917
304 Ga0070691_10013965
305 Ga0070668_100000707
306 Ga0070668_100001069
307 Ga0070668_100009879
308 Ga0070668_100016072
309 Ga0070669_100053167
310 Ga0070669_100059194
311 Ga0070671_100134825
312 Ga0070673_100289240
313 Ga0070659_100000315
314 Ga0070659_100181113
315 Ga0070667_100003824
316 Ga0070678_100071349
317 Ga0070681_10044731
318 Ga0070681_10173532
319 Ga0070679_100000858
320 Ga0070679_100013292
321 Ga0068853_100033140
322 Ga0068853_100071002
323 Ga0070686_100052718
324 Ga0070665_100000593
325 Ga0070665_100042994
326 Ga0070665_100068577
327 Ga0070665_100119780
328 Ga0068855_100009421
329 Ga0068855_100029587
330 Ga0068855_100144295
331 Ga0068855_100158042
332 Ga0070664_100257136
333 Ga0068857_100082664
334 Ga0068854_100070942
335 Ga0068856_100163863
336 Ga0068852_100416206
337 Ga0068859_100000747
338 Ga0068859_100015606
339 Ga0068859_100282443
340 Ga0068864_100000067
341 Ga0068864_100004585
342 Ga0068864_100148096
343 Ga0068864_100265348
344 Ga0068863_100000735
345 Ga0068863_100007632
346 Ga0068863_100076581
347 Ga0068863_100076891
348 Ga0068863_100537844
349 Ga0068858_100000020
350 Ga0068858_100001493
351 Ga0068858_100444591
352 Ga0068860_100000382
353 Ga0068860_100011682
354 Ga0068860_100410830
355 Ga0068862_100002990
356 Ga0068862_100017278
357 Ga0068862_100023889
358 Ga0068862_100026673
359 Ga0070717_10051586
360 Ga0070717_10557569
361 Ga0075362_10014721
362 Ga0075428_100001270
363 Ga0075429_100196498
364 Ga0068865_100001019
365 Ga0097620_100000747
366 Ga0097620_100015606
367 Ga0097620_100282432
368 Ga0099794_10029981
369 Ga0099794_10093708
370 Ga0105251_10083816
371 Ga0105250_10024347
372 Ga0105240_10021836
373 Ga0105240_10132547
374 Ga0105240_10252559
375 Ga0105240_10404535
376 Ga0111539_10002362
377 Ga0105247_10245179
378 Ga0105247_10295029
379 Ga0105248_10000305
380 Ga0105248_10003586
381 Ga0105248_10007895
382 Ga0105248_10030169
383 Ga0105248_10255658
384 Ga0105238_10021798
385 Ga0105249_10077080
386 Ga0105249_10305481
387 Ga0105239_10091888
388 Ga0105239_10188918
389 Ga0105239_10331055
390 Ga0105239_10492957
391 Ga0105239_10571275
392 Ga0105239_10784247
393 Ga0163162_10097413
394 Ga0163162_10379115
395 Ga0157375_10016957
396 Ga0163163_10003065
397 Ga0163163_10019624
398 Ga0163163_10034972
399 Ga0163163_10139445
400 Ga0163163_10928530
401 Ga0157379_10002854
402 Ga0157379_10055262
403 Ga0157379_10509904
404 Ga0207696_1025689
405 Ga0207710_10171959
406 Ga0207710_10183602
407 Ga0207705_10000556
408 Ga0207707_10021552
409 Ga0207707_10182933
410 Ga0207695_10001235
411 Ga0207695_10002484
412 Ga0207695_10022933
413 Ga0207695_10054233
414 Ga0207660_10000773
415 Ga0207657_10000693
416 Ga0207657_10031284
417 Ga0207657_10203288
418 Ga0207652_10019459
419 Ga0207652_10065050
420 Ga0207681_10039606
421 Ga0207681_10049632
422 Ga0207694_10042147
423 Ga0207650_10011082
424 Ga0207650_10012810
425 Ga0207650_10068550
426 Ga0207690_10000843
427 Ga0207690_10296326
428 Ga0207706_10047076
429 Ga0207704_10002498
430 Ga0207711_10000160
431 Ga0207711_10019133
432 Ga0207711_10092152
433 Ga0207711_10162484
434 Ga0207679_10119334
435 Ga0207667_10006652
436 Ga0207667_10045108
437 Ga0207667_10073960
438 Ga0207667_10135248
439 Ga0207651_10243817
440 Ga0207712_10064297
441 Ga0207668_10000002
442 Ga0207668_10000788
443 Ga0207640_10112022
444 Ga0207658_10247577
445 Ga0207703_10000082
446 Ga0207703_10000853
447 Ga0207702_10126124
448 Ga0207641_10000007
449 Ga0207641_10009603
450 Ga0207641_10107082
451 Ga0207641_10167510
452 Ga0207641_10490790
453 Ga0207676_10000191
454 Ga0207676_10004212
455 Ga0207676_10041004
456 Ga0207676_10120279
457 Ga0207676_10425745
458 Ga0207674_10050977
459 Ga0207675_100179652
460 Ga0207683_10322786
461 Ga0207683_10328697
462 Ga0209981_1000327
463 Ga0207428_10018011
464 Ga0268266_10000003
465 Ga0268266_10035677
466 Ga0268265_10006024
467 Ga0268265_10007874
468 Ga0268265_10016924
469 Ga0268264_10000008
470 Ga0268264_10004796
471 Ga0268264_10010210
472 Ga0307517_10019757
473 Ga0307517_10104925
474 Ga0307517_10279072
475 Ga0265327_10016699
476 Ga0307513_10009525
477 Ga0307513_10023387
478 Ga0307408_100073487
479 Ga0307508_10216758
480 Ga0307413_10070534
481 Ga0307413_10112186
482 Ga0307414_10111624
483 Ga0307414_10410600
484 Ga0307414_10580898
485 Ga0307510_10126155
486 Ga0373944_0021884
487 Ga0373936_0004949
488 Ga0373955_0302692
489 Ga0373935_0288078
490 Ga0373927_0003482
491 Ga0373937_0001520
492 Ga0373925_0000257
493 Ga0395899_0005899
494 Ga0395899_0185730
495 Ga0395899_0238994
496 Ga0395900_0000072
497 Ga0395900_0012117
498 Ga0395898_0052080
499 Ga0395905_0005670
500 Ga0395905_0042917
501 Ga0395905_0341130
502 Ga0395901_0001358
503 Ga0395901_0295818
504 Ga0451576_0015459
505 Ga0495629_0057699
506 Ga0495638_0203366
507 Ga0495594_0086427
508 Ga0495606_0199237
509 Ga0495610_0020422
510 Ga0495618_0211410
511 Ga0495620_0009236
512 Ga0495630_0069939
513 Ga0495648_0192204
514 Ga0495642_0001584
515 Ga0495640_0202855
516 Ga0495597_0002564
517 Ga0495645_0142782
518 Ga0495668_0011037
519 Ga0495611_0016748
520 Ga0495625_0083287
521 Ga0495599_0313216
522 Ga0495669_0144447
523 Ga0495649_0000089
524 Ga0495636_0029058
525 Ga0495672_0025070
526 Ga0495687_027528
527 Ga0495593_0013357
528 Ga0496100_0346767
529 Ga0496101_0302451
530 Ga0496102_0076435
531 Ga0496103_0243627
532 Ga0496104_0376173
533 Ga0496106_0096387
534 Ga0496107_0114412
535 Ga0496108_0080504
536 Ga0496109_0018388
537 Ga0496110_0492591
538 Ga0496112_0018366
539 Ga0496112_0323558
540 Ga0496113_0063364
541 Ga0496114_0342711
542 Ga0496115_0002138
543 Ga0496115_0002497
544 Ga0496115_0179231
545 Ga0496117_0063629
546 Ga0496119_0023907
547 Ga0496121_0000035
548 Ga0496121_0198541
549 Ga0496122_0143624
550 Ga0501033_0014073
551 Ga0501037_0116920
552 Ga0501047_0076957
553 Ga0501047_0108107
554 Ga0501035_0167821
555 nmdc:mga03683_69230_c1
556 nmdc:mga09592_187041_c1
557 nmdc:mga08y16_9412_c1
558 Ga0500635_0000133
559 Ga0500651_0003759
560 Ga0500566_0012049
561 Ga0500641_0144653
562 Ga0500555_001064
563 Ga0500556_0063164
564 Ga0500569_000529
565 Ga0500595_004824
566 Ga0500595_008313
567 Ga0500595_011965
568 Ga0500607_117573
569 Ga0500614_005434
570 Ga0500590_027108
571 Ga0500620_065392
572 Ga0500638_085395
573 Ga0500639_126396
574 Ga0500636_0003639
575 Ga0500636_0184446
576 Ga0500637_0007759
577 Ga0500637_0060755
578 Ga0500596_001059
579 2644353478
580 2757566280
581 2941486144
582 2980183738

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

27

188

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8722 10 235
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8353 12 235
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8017 10 235
5eke-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.7884 7 228
5ekp-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.7866 7 228
ID Description Score Start End Superfamily
af_O60061_43_318_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8664 7 235 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.862 14 233 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8591 12 227 3.90.550.10
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.859 12 190 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.848 9 239 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A4V1ZS11-F1-model_v4 Glycosyltransferase family 2 protein 0.9812 8 108 GO:0005886
GO:0099621
AF-A0A7C5FNM4-F1-model_v4 Glycosyltransferase 0.9743 12 114 GO:0005886
GO:0016757
AF-A0A523V6E2-F1-model_v4 Glycosyltransferase 0.9733 7 118 GO:0005886
GO:0016757
AF-A0A844CHX4-F1-model_v4 Glycosyltransferase family 2 protein 0.9595 9 239 GO:0005886
GO:0099621
AF-A0A7C4KIH1-F1-model_v4 Glycosyltransferase 0.9573 9 121 GO:0005886
GO:0016757

Map