F390033

General Info

Members Datasets Scaffolds Average Seq Length
290 185 580 202

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0355042|Ga0501036_0355042_61_669
Length 202
Sequence MADKNIYHAGSRELQERFDTRRIADRLEEVTVHDRFNDGDRETIESAAMFFLATADADGWPDVSYKGGMPGFVRVVSEDTLAFPNYDGNGMYKSWGNVLVNPRVGLLFIVWGEHPHRMRVQGTASIHYDDPLLAEHPDAQFIVRVKAERIFPNCPRYIHKMELREYSVYAPRPNHKPPVPEWKKMEVFRDALPERDQVEGQS

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
121 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
126 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
133 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
134 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
178 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
183 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
184 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
185 2643221695 Lysobacter sp. Root494 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 0
Isolates 1.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 1.38
Rhizosphere 95.52
Stem 0
Stem Tuber 0
Unclassified 4.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0355042 3300049572 Unclassified 1224
2 rootH1_10001458 3300003316 Bacteria 1659
3 Ga0065715_10037137 3300005293 Bacteria 1241
4 Ga0070658_10235369 3300005327 Bacteria 1551
5 Ga0070690_100080997 3300005330 Bacteria 2124
6 Ga0070690_100490887 3300005330 Bacteria 917
7 Ga0070690_100549023 3300005330 Bacteria 871
8 Ga0070670_100039086 3300005331 Bacteria 4080
9 Ga0070670_100132951 3300005331 Bacteria 2149
10 Ga0070670_100209959 3300005331 Bacteria 1693
11 Ga0070677_10029059 3300005333 Bacteria 2094
12 Ga0070666_10190512 3300005335 Bacteria 1441
13 Ga0070682_100401153 3300005337 Bacteria 1037
14 Ga0070689_100048978 3300005340 Bacteria 3260
15 Ga0070687_100078294 3300005343 Bacteria 1797
16 Ga0070687_100308554 3300005343 Bacteria 1006
17 Ga0070661_100010979 3300005344 Bacteria 6312
18 Ga0070692_10057671 3300005345 Bacteria 2037
19 Ga0070669_100266209 3300005353 Bacteria 1369
20 Ga0070675_100010740 3300005354 Bacteria 7163
21 Ga0070675_100087741 3300005354 Bacteria 2601
22 Ga0070671_100131954 3300005355 Bacteria 2104
23 Ga0070671_100312940 3300005355 Bacteria 1338
24 Ga0070674_101051724 3300005356 Bacteria 717
25 Ga0070673_100442981 3300005364 Bacteria 1167
26 Ga0070673_100625871 3300005364 Bacteria 983
27 Ga0070673_100880596 3300005364 Bacteria 830
28 Ga0070673_100936383 3300005364 Bacteria 804
29 Ga0070667_100105150 3300005367 Bacteria 2443
30 Ga0070667_100320896 3300005367 Bacteria 1398
31 Ga0070667_100345770 3300005367 Bacteria 1346
32 Ga0070701_10003051 3300005438 Bacteria 6562
33 Ga0070701_10342351 3300005438 Bacteria 932
34 Ga0070705_100005102 3300005440 Bacteria 6384
35 Ga0070700_100269415 3300005441 Bacteria 1230
36 Ga0070694_100013708 3300005444 Bacteria 5066
37 Ga0070694_100015787 3300005444 Bacteria 4749
38 Ga0070663_100031029 3300005455 Bacteria 3669
39 Ga0070681_10014060 3300005458 Bacteria 7965
40 Ga0068867_100626691 3300005459 Bacteria 941
41 Ga0068867_100649980 3300005459 Bacteria 925
42 Ga0070698_100243901 3300005471 Bacteria 1730
43 Ga0070698_100643694 3300005471 Bacteria 1001
44 Ga0070679_100030000 3300005530 Bacteria 5366
45 Ga0068853_100002937 3300005539 Bacteria 12966
46 Ga0068853_100096474 3300005539 Bacteria 2609
47 Ga0070672_100073620 3300005543 Bacteria 2723
48 Ga0070672_100411920 3300005543 Bacteria 1160
49 Ga0070695_100001110 3300005545 Bacteria 14737
50 Ga0070695_100077982 3300005545 Bacteria 2184
51 Ga0070696_100298939 3300005546 Bacteria 1232
52 Ga0070693_100063991 3300005547 Bacteria 2145
53 Ga0070664_100173681 3300005564 Bacteria 1912
54 Ga0068857_100022459 3300005577 Bacteria 5551
55 Ga0068852_100041933 3300005616 Bacteria 3872
56 Ga0068852_100761513 3300005616 Bacteria 981
57 Ga0068859_100047680 3300005617 Bacteria 4305
58 Ga0068859_100221074 3300005617 Bacteria 1982
59 Ga0068864_100034800 3300005618 Bacteria 4286
60 Ga0068861_100005722 3300005719 Bacteria 8426
61 Ga0068861_100067827 3300005719 Bacteria 2755
62 Ga0068851_10072719 3300005834 Bacteria 1782
63 Ga0068870_10020303 3300005840 Bacteria 3233
64 Ga0068870_10708923 3300005840 Bacteria 695
65 Ga0068863_100055762 3300005841 Bacteria 3742
66 Ga0068863_100094165 3300005841 Bacteria 2843
67 Ga0068863_100673735 3300005841 Bacteria 1027
68 Ga0068863_100678038 3300005841 Bacteria 1023
69 Ga0068858_100016262 3300005842 Bacteria 6988
70 Ga0068860_100037054 3300005843 Bacteria 4669
71 Ga0068860_100132413 3300005843 Bacteria 2394
72 Ga0068862_100025421 3300005844 Bacteria 4972
73 Ga0068862_100064869 3300005844 Bacteria 3144
74 Ga0075432_10008780 3300006058 Bacteria 3448
75 Ga0097621_100201421 3300006237 Bacteria 1728
76 Ga0097621_100301736 3300006237 Bacteria 1415
77 Ga0097621_100528972 3300006237 Bacteria 1071
78 Ga0068871_100107249 3300006358 Bacteria 2346
79 Ga0075428_100001790 3300006844 Bacteria 22959
80 Ga0075428_100003085 3300006844 Bacteria 18177
81 Ga0075430_100012409 3300006846 Bacteria 7250
82 Ga0075431_100050704 3300006847 Bacteria 4279
83 Ga0075431_100063836 3300006847 Bacteria 3801
84 Ga0075429_100004011 3300006880 Bacteria 12605
85 Ga0075429_100021212 3300006880 Bacteria 5632
86 Ga0068865_100107349 3300006881 Bacteria 2053
87 Ga0068865_100159947 3300006881 Bacteria 1717
88 Ga0068865_100525152 3300006881 Bacteria 990
89 Ga0068865_100963734 3300006881 Bacteria 745
90 Ga0097620_100047680 3300006931 Bacteria 4305
91 Ga0097620_100221068 3300006931 Bacteria 1982
92 Ga0105240_10197310 3300009093 Bacteria 2361
93 Ga0111539_10071191 3300009094 Bacteria 4103
94 Ga0111539_10216305 3300009094 Bacteria 2232
95 Ga0111539_10871671 3300009094 Bacteria 1047
96 Ga0114129_10016579 3300009147 Bacteria 10494
97 Ga0105243_10534157 3300009148 Bacteria 1117
98 Ga0105242_10058913 3300009176 Bacteria 3150
99 Ga0105242_10353568 3300009176 Bacteria 1358
100 Ga0105248_10071171 3300009177 Bacteria 3906
101 Ga0105249_11435332 3300009553 Bacteria 762
102 Ga0157370_10028570 3300013104 Bacteria 5484
103 Ga0163162_10030417 3300013306 Bacteria 5350
104 Ga0163162_10046039 3300013306 Bacteria 4372
105 Ga0157372_10041887 3300013307 Bacteria 5063
106 Ga0157375_10006939 3300013308 Bacteria 9889
107 Ga0157375_10258842 3300013308 Bacteria 1902
108 Ga0163163_10471412 3300014325 Bacteria 1316
109 Ga0157380_10001434 3300014326 Bacteria 15615
110 Ga0157380_10008649 3300014326 Bacteria 7279
111 Ga0157380_10108642 3300014326 Bacteria 2326
112 Ga0157380_10130338 3300014326 Bacteria 2144
113 Ga0157380_10170835 3300014326 Bacteria 1899
114 Ga0157379_10013912 3300014968 Bacteria 7054
115 Ga0157379_10738502 3300014968 Unclassified 926
116 Ga0157376_10428653 3300014969 Bacteria 1285
117 Ga0157376_10889464 3300014969 Unclassified 908
118 Ga0213876_10137994 3300021384 Bacteria 1297
119 Ga0207682_10018637 3300025893 Bacteria 2715
120 Ga0207682_10062457 3300025893 Bacteria 1562
121 Ga0207645_10270407 3300025907 Bacteria 1127
122 Ga0207643_10454319 3300025908 Bacteria 815
123 Ga0207705_10398589 3300025909 Bacteria 1064
124 Ga0207707_10015546 3300025912 Bacteria 6630
125 Ga0207660_10021722 3300025917 Bacteria 4318
126 Ga0207662_10113819 3300025918 Bacteria 1689
127 Ga0207662_10166920 3300025918 Bacteria 1410
128 Ga0207652_10010119 3300025921 Bacteria 7597
129 Ga0207646_10449671 3300025922 Bacteria 1162
130 Ga0207681_10553413 3300025923 Bacteria 947
131 Ga0207650_10107953 3300025925 Bacteria 2151
132 Ga0207650_10179058 3300025925 Bacteria 1689
133 Ga0207659_10025120 3300025926 Bacteria 3999
134 Ga0207659_10028034 3300025926 Bacteria 3821
135 Ga0207659_10933069 3300025926 Bacteria 746
136 Ga0207644_10056936 3300025931 Bacteria 2822
137 Ga0207644_10091386 3300025931 Bacteria 2270
138 Ga0207690_10724977 3300025932 Bacteria 818
139 Ga0207706_10740505 3300025933 Bacteria 838
140 Ga0207670_10083876 3300025936 Bacteria 2236
141 Ga0207669_10558104 3300025937 Bacteria 925
142 Ga0207704_10081504 3300025938 Bacteria 2093
143 Ga0207704_10263432 3300025938 Bacteria 1301
144 Ga0207704_10372550 3300025938 Bacteria 1118
145 Ga0207691_10026307 3300025940 Bacteria 5461
146 Ga0207711_10121469 3300025941 Bacteria 2332
147 Ga0207711_10435005 3300025941 Bacteria 1221
148 Ga0207689_10063139 3300025942 Bacteria 3047
149 Ga0207679_10030975 3300025945 Bacteria 3741
150 Ga0207651_10163553 3300025960 Bacteria 1747
151 Ga0207651_10694327 3300025960 Bacteria 896
152 Ga0207712_11094438 3300025961 Bacteria 709
153 Ga0207658_10054503 3300025986 Bacteria 2959
154 Ga0207658_10125869 3300025986 Bacteria 2051
155 Ga0207658_10143949 3300025986 Bacteria 1933
156 Ga0207703_10011996 3300026035 Bacteria 6749
157 Ga0207639_10023656 3300026041 Bacteria 4437
158 Ga0207639_10520496 3300026041 Bacteria 1089
159 Ga0207678_10084462 3300026067 Bacteria 2715
160 Ga0207708_10025448 3300026075 Bacteria 4477
161 Ga0207708_10060176 3300026075 Bacteria 2899
162 Ga0207641_10119417 3300026088 Bacteria 2350
163 Ga0207641_10261551 3300026088 Unclassified 1620
164 Ga0207641_10344392 3300026088 Unclassified 1419
165 Ga0207648_10034429 3300026089 Bacteria 4465
166 Ga0207648_10075336 3300026089 Bacteria 2942
167 Ga0207648_10179348 3300026089 Bacteria 1874
168 Ga0207676_10038162 3300026095 Bacteria 3664
169 Ga0207676_10137894 3300026095 Bacteria 2084
170 Ga0207676_10297713 3300026095 Bacteria 1472
171 Ga0207674_10080094 3300026116 Bacteria 3270
172 Ga0207675_100013415 3300026118 Bacteria 7646
173 Ga0207675_100077190 3300026118 Bacteria 3120
174 Ga0207683_10020916 3300026121 Bacteria 5599
175 Ga0207698_10900107 3300026142 Bacteria 892
176 Ga0209969_1013206 3300027360 Unclassified 1195
177 Ga0209971_1001480 3300027682 Bacteria 5838
178 Ga0209974_10001674 3300027876 Bacteria 8024
179 Ga0207428_10001689 3300027907 Bacteria 22717
180 Ga0268265_10040485 3300028380 Bacteria 3442
181 Ga0268264_10012304 3300028381 Bacteria 7043
182 Ga0265334_10000022 3300028573 Bacteria 127132
183 Ga0307515_10513490 3300028794 Bacteria 808
184 Ga0265330_10018367 3300031235 Bacteria 3212
185 Ga0265332_10021433 3300031238 Bacteria 2854
186 Ga0265329_10002395 3300031242 Bacteria 8507
187 Ga0265331_10006140 3300031250 Bacteria 7143
188 Ga0265316_10093076 3300031344 Bacteria 2297
189 Ga0316579_10023437 3300031691 Bacteria 2770
190 Ga0316579_10092862 3300031691 Bacteria 1442
191 Ga0316579_10119574 3300031691 Bacteria 1265
192 Ga0316578_10012819 3300031728 Bacteria 4427
193 Ga0307410_10719849 3300031852 Unclassified 843
194 Ga0307412_10124308 3300031911 Bacteria 1863
195 Ga0307412_10272833 3300031911 Bacteria 1324
196 Ga0307414_10456216 3300032004 Bacteria 1122
197 Ga0316583_10037663 3300032133 Bacteria 1714
198 Ga0373960_0160370 3300035121 Bacteria 774
199 Ga0373937_0276483 3300036401 Bacteria 1585
200 Ga0316582_0228159 3300036647 Bacteria 1274
201 Ga0395898_0776407 3300037466 Bacteria 899
202 Ga0436365_1509179 3300039437 Bacteria 1923
203 Ga0436363_1467252 3300039450 Bacteria 2218
204 Ga0451789_1286745 3300041443 Bacteria 651
205 Ga0439441_044094 3300042001 Bacteria 902
206 Ga0439464_0003748 3300042439 Bacteria 3859
207 Ga0451577_0296387 3300042876 Bacteria 1465
208 Ga0451577_0353390 3300042876 Bacteria 1333
209 Ga0451577_0944180 3300042876 Unclassified 776
210 Ga0453683_0254576 3300044673 Bacteria 1119
211 Ga0453684_0023442 3300044712 Bacteria 9088
212 Ga0451576_0370627 3300045051 Bacteria 1500
213 Ga0451576_0513272 3300045051 Bacteria 1259
214 Ga0495603_0192075 3300046455 Unclassified 1181
215 Ga0495638_0020747 3300046460 Bacteria 4338
216 Ga0495625_0016446 3300046660 Bacteria 5822
217 Ga0495647_0045995 3300046681 Bacteria 1679
218 Ga0495658_0081615 3300046683 Bacteria 1899
219 Ga0495613_0201771 3300046689 Bacteria 1402
220 Ga0495686_0165148 3300047472 Bacteria 1291
221 Ga0496104_0129548 3300048907 Bacteria 2423
222 Ga0496106_0410569 3300048909 Bacteria 1088
223 Ga0496114_0030020 3300048917 Bacteria 4471
224 Ga0501036_0216924 3300049572 Bacteria 1607
225 Ga0501038_0014662 3300049574 Bacteria 7142
226 Ga0501039_0096567 3300049575 Bacteria 2304
227 Ga0501040_0137152 3300049576 Bacteria 1723
228 Ga0501042_0051754 3300049578 Bacteria 2929
229 Ga0501042_0100479 3300049578 Bacteria 2080
230 Ga0501042_0288100 3300049578 Bacteria 1186
231 Ga0501047_0193407 3300049581 Bacteria 1897
232 Ga0501067_0063775 3300049583 Bacteria 2040
233 Ga0501067_0278964 3300049583 Bacteria 930
234 Ga0501068_0000244 3300049584 Bacteria 26692
235 Ga0501068_0093145 3300049584 Bacteria 1861
236 Ga0501068_0229723 3300049584 Bacteria 1180
237 Ga0501069_0077134 3300049585 Bacteria 1874
238 Ga0501069_0401121 3300049585 Bacteria 812
239 Ga0501070_0121565 3300049586 Bacteria 2158
240 Ga0501071_0075812 3300049587 Bacteria 2455
241 Ga0501072_0041472 3300049588 Bacteria 3615
242 Ga0501072_0043904 3300049588 Bacteria 3515
243 Ga0501072_0100063 3300049588 Bacteria 2304
244 Ga0501072_0149886 3300049588 Unclassified 1860
245 Ga0501073_0001640 3300049589 Bacteria 16596
246 Ga0501073_0018363 3300049589 Bacteria 5055
247 Ga0501073_0078264 3300049589 Bacteria 2301
248 Ga0501074_0000542 3300049590 Bacteria 23258
249 Ga0501074_0027592 3300049590 Bacteria 4117
250 Ga0501074_0489654 3300049590 Bacteria 871
251 Ga0501075_0008453 3300049591 Bacteria 7182
252 Ga0501075_0406264 3300049591 Unclassified 1038
253 Ga0501075_0666526 3300049591 Bacteria 793
254 Ga0501076_0026433 3300049592 Bacteria 4497
255 Ga0501076_0028203 3300049592 Bacteria 4357
256 Ga0501076_0053223 3300049592 Unclassified 3207
257 Ga0501077_0004295 3300049593 Bacteria 8625
258 Ga0501249_031953 3300049679 Bacteria 1176
259 Ga0501079_0003059 3300049741 Bacteria 12240
260 Ga0501079_0007712 3300049741 Bacteria 8147
261 Ga0501080_0020662 3300049742 Bacteria 6099
262 Ga0501080_0096716 3300049742 Bacteria 2741
263 Ga0501081_0012559 3300049743 Bacteria 5569
264 Ga0501081_0938097 3300049743 Bacteria 653
265 Ga0501083_0025187 3300049744 Bacteria 4119
266 Ga0501083_0049463 3300049744 Bacteria 2833
267 Ga0501035_0110609 3300049822 Bacteria 2408
268 Ga0501045_0068380 3300049824 Bacteria 2609
269 nmdc:mga05p37_27457_c1 3300050507 Bacteria 6929
270 nmdc:mga09592_139859_c1 3300050508 Bacteria 2086
271 nmdc:mga09592_6420_c1 3300050508 Bacteria 9581
272 nmdc:mga0qj67_5267_c1 3300050509 Bacteria 9432
273 nmdc:mga06r32_722041_c1 3300050510 Bacteria 961
274 nmdc:mga08y16_62674_c1 3300050511 Bacteria 3883
275 Ga0500610_0008469 3300053079 Bacteria 4485
276 Ga0500644_0110430 3300053088 Bacteria 1058
277 Ga0500616_0007034 3300053153 Bacteria 7224
278 Ga0501084_0002850 3300054114 Bacteria 13972
279 Ga0501084_0231526 3300054114 Bacteria 1560
280 Ga0501084_0492926 3300054114 Bacteria 1035
281 Ga0501084_1305093 3300054114 Bacteria 608
282 Ga0501082_0020831 3300060353 Bacteria 5655
283 Ga0501082_0071152 3300060353 Bacteria 2995
284 Ga0501082_0227634 3300060353 Unclassified 1623
285 Ga0501082_0732487 3300060353 Bacteria 865
286 Ga0530510_0002233 3300061734 Bacteria 13282
287 Ga0530510_0010246 3300061734 Bacteria 6568
288 2525558029 2524614729 Bacteria 3091755
289 2630649832 2627854209 Bacteria 3093011
290 2644529028 2643221695 Bacteria 3441323
291 Ga0501036_0355042
292 rootH1_10001458
293 Ga0065715_10037137
294 Ga0070658_10235369
295 Ga0070690_100080997
296 Ga0070690_100490887
297 Ga0070690_100549023
298 Ga0070670_100039086
299 Ga0070670_100132951
300 Ga0070670_100209959
301 Ga0070677_10029059
302 Ga0070666_10190512
303 Ga0070682_100401153
304 Ga0070689_100048978
305 Ga0070687_100078294
306 Ga0070687_100308554
307 Ga0070661_100010979
308 Ga0070692_10057671
309 Ga0070669_100266209
310 Ga0070675_100010740
311 Ga0070675_100087741
312 Ga0070671_100131954
313 Ga0070671_100312940
314 Ga0070674_101051724
315 Ga0070673_100442981
316 Ga0070673_100625871
317 Ga0070673_100880596
318 Ga0070673_100936383
319 Ga0070667_100105150
320 Ga0070667_100320896
321 Ga0070667_100345770
322 Ga0070701_10003051
323 Ga0070701_10342351
324 Ga0070705_100005102
325 Ga0070700_100269415
326 Ga0070694_100013708
327 Ga0070694_100015787
328 Ga0070663_100031029
329 Ga0070681_10014060
330 Ga0068867_100626691
331 Ga0068867_100649980
332 Ga0070698_100243901
333 Ga0070698_100643694
334 Ga0070679_100030000
335 Ga0068853_100002937
336 Ga0068853_100096474
337 Ga0070672_100073620
338 Ga0070672_100411920
339 Ga0070695_100001110
340 Ga0070695_100077982
341 Ga0070696_100298939
342 Ga0070693_100063991
343 Ga0070664_100173681
344 Ga0068857_100022459
345 Ga0068852_100041933
346 Ga0068852_100761513
347 Ga0068859_100047680
348 Ga0068859_100221074
349 Ga0068864_100034800
350 Ga0068861_100005722
351 Ga0068861_100067827
352 Ga0068851_10072719
353 Ga0068870_10020303
354 Ga0068870_10708923
355 Ga0068863_100055762
356 Ga0068863_100094165
357 Ga0068863_100673735
358 Ga0068863_100678038
359 Ga0068858_100016262
360 Ga0068860_100037054
361 Ga0068860_100132413
362 Ga0068862_100025421
363 Ga0068862_100064869
364 Ga0075432_10008780
365 Ga0097621_100201421
366 Ga0097621_100301736
367 Ga0097621_100528972
368 Ga0068871_100107249
369 Ga0075428_100001790
370 Ga0075428_100003085
371 Ga0075430_100012409
372 Ga0075431_100050704
373 Ga0075431_100063836
374 Ga0075429_100004011
375 Ga0075429_100021212
376 Ga0068865_100107349
377 Ga0068865_100159947
378 Ga0068865_100525152
379 Ga0068865_100963734
380 Ga0097620_100047680
381 Ga0097620_100221068
382 Ga0105240_10197310
383 Ga0111539_10071191
384 Ga0111539_10216305
385 Ga0111539_10871671
386 Ga0114129_10016579
387 Ga0105243_10534157
388 Ga0105242_10058913
389 Ga0105242_10353568
390 Ga0105248_10071171
391 Ga0105249_11435332
392 Ga0157370_10028570
393 Ga0163162_10030417
394 Ga0163162_10046039
395 Ga0157372_10041887
396 Ga0157375_10006939
397 Ga0157375_10258842
398 Ga0163163_10471412
399 Ga0157380_10001434
400 Ga0157380_10008649
401 Ga0157380_10108642
402 Ga0157380_10130338
403 Ga0157380_10170835
404 Ga0157379_10013912
405 Ga0157379_10738502
406 Ga0157376_10428653
407 Ga0157376_10889464
408 Ga0213876_10137994
409 Ga0207682_10018637
410 Ga0207682_10062457
411 Ga0207645_10270407
412 Ga0207643_10454319
413 Ga0207705_10398589
414 Ga0207707_10015546
415 Ga0207660_10021722
416 Ga0207662_10113819
417 Ga0207662_10166920
418 Ga0207652_10010119
419 Ga0207646_10449671
420 Ga0207681_10553413
421 Ga0207650_10107953
422 Ga0207650_10179058
423 Ga0207659_10025120
424 Ga0207659_10028034
425 Ga0207659_10933069
426 Ga0207644_10056936
427 Ga0207644_10091386
428 Ga0207690_10724977
429 Ga0207706_10740505
430 Ga0207670_10083876
431 Ga0207669_10558104
432 Ga0207704_10081504
433 Ga0207704_10263432
434 Ga0207704_10372550
435 Ga0207691_10026307
436 Ga0207711_10121469
437 Ga0207711_10435005
438 Ga0207689_10063139
439 Ga0207679_10030975
440 Ga0207651_10163553
441 Ga0207651_10694327
442 Ga0207712_11094438
443 Ga0207658_10054503
444 Ga0207658_10125869
445 Ga0207658_10143949
446 Ga0207703_10011996
447 Ga0207639_10023656
448 Ga0207639_10520496
449 Ga0207678_10084462
450 Ga0207708_10025448
451 Ga0207708_10060176
452 Ga0207641_10119417
453 Ga0207641_10261551
454 Ga0207641_10344392
455 Ga0207648_10034429
456 Ga0207648_10075336
457 Ga0207648_10179348
458 Ga0207676_10038162
459 Ga0207676_10137894
460 Ga0207676_10297713
461 Ga0207674_10080094
462 Ga0207675_100013415
463 Ga0207675_100077190
464 Ga0207683_10020916
465 Ga0207698_10900107
466 Ga0209969_1013206
467 Ga0209971_1001480
468 Ga0209974_10001674
469 Ga0207428_10001689
470 Ga0268265_10040485
471 Ga0268264_10012304
472 Ga0265334_10000022
473 Ga0307515_10513490
474 Ga0265330_10018367
475 Ga0265332_10021433
476 Ga0265329_10002395
477 Ga0265331_10006140
478 Ga0265316_10093076
479 Ga0316579_10023437
480 Ga0316579_10092862
481 Ga0316579_10119574
482 Ga0316578_10012819
483 Ga0307410_10719849
484 Ga0307412_10124308
485 Ga0307412_10272833
486 Ga0307414_10456216
487 Ga0316583_10037663
488 Ga0373960_0160370
489 Ga0373937_0276483
490 Ga0316582_0228159
491 Ga0395898_0776407
492 Ga0436365_1509179
493 Ga0436363_1467252
494 Ga0451789_1286745
495 Ga0439441_044094
496 Ga0439464_0003748
497 Ga0451577_0296387
498 Ga0451577_0353390
499 Ga0451577_0944180
500 Ga0453683_0254576
501 Ga0453684_0023442
502 Ga0451576_0370627
503 Ga0451576_0513272
504 Ga0495603_0192075
505 Ga0495638_0020747
506 Ga0495625_0016446
507 Ga0495647_0045995
508 Ga0495658_0081615
509 Ga0495613_0201771
510 Ga0495686_0165148
511 Ga0496104_0129548
512 Ga0496106_0410569
513 Ga0496114_0030020
514 Ga0501036_0216924
515 Ga0501038_0014662
516 Ga0501039_0096567
517 Ga0501040_0137152
518 Ga0501042_0051754
519 Ga0501042_0100479
520 Ga0501042_0288100
521 Ga0501047_0193407
522 Ga0501067_0063775
523 Ga0501067_0278964
524 Ga0501068_0000244
525 Ga0501068_0093145
526 Ga0501068_0229723
527 Ga0501069_0077134
528 Ga0501069_0401121
529 Ga0501070_0121565
530 Ga0501071_0075812
531 Ga0501072_0041472
532 Ga0501072_0043904
533 Ga0501072_0100063
534 Ga0501072_0149886
535 Ga0501073_0001640
536 Ga0501073_0018363
537 Ga0501073_0078264
538 Ga0501074_0000542
539 Ga0501074_0027592
540 Ga0501074_0489654
541 Ga0501075_0008453
542 Ga0501075_0406264
543 Ga0501075_0666526
544 Ga0501076_0026433
545 Ga0501076_0028203
546 Ga0501076_0053223
547 Ga0501077_0004295
548 Ga0501249_031953
549 Ga0501079_0003059
550 Ga0501079_0007712
551 Ga0501080_0020662
552 Ga0501080_0096716
553 Ga0501081_0012559
554 Ga0501081_0938097
555 Ga0501083_0025187
556 Ga0501083_0049463
557 Ga0501035_0110609
558 Ga0501045_0068380
559 nmdc:mga05p37_27457_c1
560 nmdc:mga09592_139859_c1
561 nmdc:mga09592_6420_c1
562 nmdc:mga0qj67_5267_c1
563 nmdc:mga06r32_722041_c1
564 nmdc:mga08y16_62674_c1
565 Ga0500610_0008469
566 Ga0500644_0110430
567 Ga0500616_0007034
568 Ga0501084_0002850
569 Ga0501084_0231526
570 Ga0501084_0492926
571 Ga0501084_1305093
572 Ga0501082_0020831
573 Ga0501082_0071152
574 Ga0501082_0227634
575 Ga0501082_0732487
576 Ga0530510_0002233
577 Ga0530510_0010246
578 2525558029
579 2630649832
580 2644529028

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

36

131

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2htd-assembly1.cif.gz_A crystal structure of a putative pyridoxamine 5'-phosphate oxidase (ldb0262) from lactobacillus delbrueckii subsp. at 1.60 a resolution 0.8247 32 149
7eg5-assembly1.cif.gz_B fmn-bound form of yvic from lactococcus lactis subsp. lactis il1403 0.8064 36 152
3amf-assembly1.cif.gz_B e13r mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.8013 35 152
3awh-assembly1.cif.gz_B e13k mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.8005 35 152
7kq2-assembly1.cif.gz_A 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 0.7824 36 151
ID Description Score Start End Superfamily
2htdA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8276 32 149 2.30.110.10
af_Q9LTX3_323_519_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7947 47 127 2.30.110.10
2htdA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.784 32 149 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.776 35 149 2.30.110.10
af_Q9UTQ1_28_231_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7711 47 126 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7W1DYC8-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9818 6 192
AF-A0A433B166-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9788 6 193
AF-A0A1F4EL75-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9747 2 172
AF-A0A535ME30-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9744 4 192
AF-A0A4R1BTR8-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.974 4 192

Map