F389415

General Info

Members Datasets Scaffolds Average Seq Length
289 210 264 261

Family's Representative Sequence

Representative Sequence 3300049460|Ga0495682_0090522|Ga0495682_0090522_27_905
Length 292
Sequence LTDRLVNSNSSADFRFSNRGRQRPQREVDVEKVLVLTDVRDGYRVLTLNRPDRLNAFTADMHGALFAALSEAEYDKTCRALILTGAGRGFCAGQDLSDFVFAPGEPPDLSVPLAKYYNPLVRKLRHMPIPIICAVNGVAAGAGANVAFACDIVIAARSAKFSQAFAKLGLVPDSGGTWFLPRLVGGARARALALLAETIPAEKAEAWGMIWKMVDDGELMAEAHRLGAYFASQPTDGLALIKQAFIASETNSLDQQLDLERDLQGQAGRSADCAEGFSAFLEKRSPNFAGRR

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
4 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
5 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
6 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
7 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
8 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
9 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
10 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
11 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
12 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
13 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
14 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
15 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
16 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
17 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
18 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
19 2904699407
20 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
25 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
26 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
172 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
173 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
174 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
175 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
176 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
191 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
192 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
193 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
194 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
199 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
200 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
201 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
202 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
203 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
206 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
207 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
208 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
209 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
210 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.67
Metatranscriptomes 0
Isolates 8.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.27
Nodule 2.08
Rhizoplane 3.81
Rhizosphere 73.36
Stem 0
Stem Tuber 0
Unclassified 13.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001692 3300001979 Bacteria 10127
2 JGI24739J22299_10009431 3300001989 Bacteria 3637
3 JGI24737J22298_10031400 3300001990 Bacteria 1659
4 JGI24738J21930_10000550 3300002075 Bacteria 10725
5 JGI25154J39366_1002002 3300002738 Bacteria 5935
6 JGI25404J52841_10003201 3300003659 Bacteria 3208
7 Ga0070658_10000144 3300005327 Bacteria 63113
8 Ga0070658_10229680 3300005327 Bacteria 1571
9 Ga0070660_100104679 3300005339 Bacteria 2245
10 Ga0070660_100121974 3300005339 Bacteria 2080
11 Ga0070689_100436277 3300005340 Bacteria 1112
12 Ga0070661_100059002 3300005344 Bacteria 2813
13 Ga0070671_100043475 3300005355 Bacteria 3733
14 Ga0070659_100000984 3300005366 Bacteria 20941
15 Ga0070708_100545891 3300005445 Bacteria 1093
16 Ga0070662_100065119 3300005457 Bacteria 2671
17 Ga0070698_100398018 3300005471 Bacteria 1310
18 Ga0070684_100090149 3300005535 Bacteria 2726
19 Ga0068853_100018745 3300005539 Bacteria 5731
20 Ga0068853_100274109 3300005539 Bacteria 1554
21 Ga0068853_100304302 3300005539 Bacteria 1474
22 Ga0068855_100012316 3300005563 Bacteria 10332
23 Ga0068855_100014954 3300005563 Bacteria 9349
24 Ga0068855_100030644 3300005563 Bacteria 6431
25 Ga0068855_100089215 3300005563 Bacteria 3560
26 Ga0068855_100179262 3300005563 Bacteria 2396
27 Ga0070664_100043309 3300005564 Bacteria 3798
28 Ga0068857_100021396 3300005577 Bacteria 5693
29 Ga0068857_100067673 3300005577 Bacteria 3179
30 Ga0068854_100000582 3300005578 Bacteria 21808
31 Ga0068854_100006504 3300005578 Bacteria 7436
32 Ga0068854_100014855 3300005578 Bacteria 5141
33 Ga0068854_100075409 3300005578 Bacteria 2476
34 Ga0068856_100008581 3300005614 Bacteria 9935
35 Ga0068856_100010919 3300005614 Bacteria 8815
36 Ga0068856_100587370 3300005614 Bacteria 1135
37 Ga0068856_100888147 3300005614 Bacteria 910
38 Ga0068852_100000273 3300005616 Bacteria 34348
39 Ga0068852_100015853 3300005616 Bacteria 5861
40 Ga0068851_10092910 3300005834 Bacteria 1590
41 Ga0068860_100318734 3300005843 Bacteria 1526
42 Ga0068862_100006632 3300005844 Bacteria 9602
43 Ga0081455_10014076 3300005937 Bacteria 7863
44 Ga0081540_1000413 3300005983 Bacteria 42230
45 Ga0075365_10006308 3300006038 Bacteria 6512
46 Ga0075365_10014812 3300006038 Bacteria 4699
47 Ga0075364_10049265 3300006051 Bacteria 2747
48 Ga0075362_10041039 3300006177 Bacteria 2039
49 Ga0097621_100212528 3300006237 Bacteria 1683
50 Ga0075428_100100973 3300006844 Bacteria 3145
51 Ga0075428_100216314 3300006844 Bacteria 2070
52 Ga0075428_100240130 3300006844 Bacteria 1955
53 Ga0075430_100250156 3300006846 Bacteria 1469
54 Ga0075430_100250843 3300006846 Bacteria 1466
55 Ga0075430_100349683 3300006846 Bacteria 1221
56 Ga0075436_100073959 3300006914 Bacteria 2359
57 Ga0075436_100204677 3300006914 Bacteria 1398
58 Ga0075435_100013659 3300007076 Bacteria 6050
59 Ga0099795_10001375 3300007788 Bacteria 5238
60 Ga0105240_10021093 3300009093 Bacteria 8672
61 Ga0105240_10022919 3300009093 Bacteria 8272
62 Ga0105240_10238463 3300009093 Bacteria 2110
63 Ga0111539_10020493 3300009094 Bacteria 8143
64 Ga0111539_10187861 3300009094 Bacteria 2412
65 Ga0111539_11145752 3300009094 Bacteria 904
66 Ga0114129_10022605 3300009147 Bacteria 8919
67 Ga0114129_10449038 3300009147 Bacteria 1691
68 Ga0105241_10003738 3300009174 Bacteria 11293
69 Ga0105241_10004214 3300009174 Bacteria 10621
70 Ga0105248_10041900 3300009177 Bacteria 5134
71 Ga0105237_10009175 3300009545 Bacteria 10621
72 Ga0105237_10029535 3300009545 Bacteria 5572
73 Ga0105238_10010683 3300009551 Bacteria 9220
74 Ga0105238_10070170 3300009551 Bacteria 3504
75 Ga0099796_10000132 3300010159 Bacteria 11303
76 Ga0105239_10017904 3300010375 Bacteria 7835
77 Ga0105239_10687345 3300010375 Bacteria 1170
78 Ga0157370_10006267 3300013104 Bacteria 13172
79 Ga0157369_10002565 3300013105 Bacteria 21747
80 Ga0157378_10248674 3300013297 Bacteria 1701
81 Ga0163162_10203356 3300013306 Bacteria 2110
82 Ga0163162_10636687 3300013306 Bacteria 1191
83 Ga0157372_10053036 3300013307 Bacteria 4518
84 Ga0157372_10147356 3300013307 Bacteria 2714
85 Ga0157375_10087161 3300013308 Bacteria 3173
86 Ga0157379_10118422 3300014968 Bacteria 2382
87 Ga0157376_10847013 3300014969 Bacteria 929
88 Ga0183361_10015 3300016635 Bacteria 166772
89 Ga0213872_10000135 3300021361 Bacteria 67262
90 Ga0213876_10001060 3300021384 Bacteria 17750
91 Ga0207656_10071615 3300025321 Bacteria 1541
92 Ga0207647_10005167 3300025904 Bacteria 9600
93 Ga0207705_10000155 3300025909 Bacteria 73779
94 Ga0207705_10001965 3300025909 Bacteria 16037
95 Ga0207654_10000442 3300025911 Bacteria 23622
96 Ga0207654_10002157 3300025911 Bacteria 10074
97 Ga0207695_10003338 3300025913 Bacteria 22726
98 Ga0207695_10008582 3300025913 Bacteria 12767
99 Ga0207695_10024927 3300025913 Bacteria 6712
100 Ga0207695_10093342 3300025913 Bacteria 3019
101 Ga0207671_10000702 3300025914 Bacteria 43116
102 Ga0207657_10002610 3300025919 Bacteria 19473
103 Ga0207652_10595273 3300025921 Bacteria 992
104 Ga0207694_10004238 3300025924 Bacteria 11230
105 Ga0207694_10006085 3300025924 Bacteria 9224
106 Ga0207694_10151108 3300025924 Bacteria 1871
107 Ga0207644_10013382 3300025931 Bacteria 5467
108 Ga0207690_10000052 3300025932 Bacteria 106112
109 Ga0207706_10007402 3300025933 Bacteria 10150
110 Ga0207686_10188260 3300025934 Bacteria 1469
111 Ga0207667_10007044 3300025949 Bacteria 13585
112 Ga0207667_10007260 3300025949 Bacteria 13364
113 Ga0207667_10022308 3300025949 Bacteria 6996
114 Ga0207640_10000314 3300025981 Bacteria 32442
115 Ga0207640_10133584 3300025981 Bacteria 1797
116 Ga0207640_10147350 3300025981 Bacteria 1724
117 Ga0207639_10014191 3300026041 Bacteria 5594
118 Ga0207678_10003212 3300026067 Bacteria 14773
119 Ga0207702_10002001 3300026078 Bacteria 19755
120 Ga0207702_10002550 3300026078 Bacteria 17144
121 Ga0207674_10061848 3300026116 Bacteria 3782
122 Ga0207674_10108599 3300026116 Bacteria 2751
123 Ga0207698_10000179 3300026142 Bacteria 38793
124 Ga0207698_10000649 3300026142 Bacteria 20125
125 Ga0207698_10002024 3300026142 Bacteria 11965
126 Ga0209179_1018577 3300027512 Bacteria 1329
127 Ga0207428_10227733 3300027907 Bacteria 1396
128 Ga0268265_10012028 3300028380 Bacteria 5858
129 Ga0268264_10330834 3300028381 Bacteria 1444
130 Ga0268264_10441196 3300028381 Bacteria 1259
131 Ga0307515_10014473 3300028794 Bacteria 14620
132 Ga0307515_10198538 3300028794 Bacteria 1890
133 Ga0265338_10000547 3300028800 Bacteria 65836
134 Ga0265332_10000546 3300031238 Bacteria 25445
135 Ga0265332_10075265 3300031238 Bacteria 1435
136 Ga0265340_10116182 3300031247 Bacteria 1233
137 Ga0307513_10040909 3300031456 Bacteria 5120
138 Ga0307513_10106063 3300031456 Bacteria 2817
139 Ga0307513_10123330 3300031456 Bacteria 2553
140 Ga0307513_10192916 3300031456 Bacteria 1887
141 Ga0265342_10000319 3300031712 Bacteria 54575
142 Ga0307516_10381783 3300031730 Bacteria 1070
143 Ga0307412_10084837 3300031911 Bacteria 2200
144 Ga0307416_100005766 3300032002 Bacteria 7669
145 Ga0307510_10057217 3300033180 Bacteria 4049
146 Ga0373924_0097349 3300035410 Bacteria 1264
147 Ga0373931_0037480 3300035691 Bacteria 2532
148 Ga0373935_0443048 3300035692 Bacteria 937
149 Ga0373927_0034254 3300035695 Bacteria 3304
150 Ga0373927_0075345 3300035695 Bacteria 2185
151 Ga0373927_0198991 3300035695 Bacteria 1315
152 Ga0373933_0054541 3300035724 Bacteria 2396
153 Ga0373947_0010892 3300035725 Bacteria 5220
154 Ga0373947_0249282 3300035725 Bacteria 1174
155 Ga0373937_0596833 3300036401 Bacteria 1048
156 Ga0373925_0071389 3300037068 Bacteria 2626
157 Ga0373925_0252224 3300037068 Bacteria 1415
158 Ga0373925_0612894 3300037068 Bacteria 897
159 Ga0395899_0000004 3300037312 Bacteria 874267
160 Ga0395905_0000166 3300037471 Bacteria 108507
161 Ga0395905_0145837 3300037471 Bacteria 2227
162 Ga0436364_0184302 3300037853 Bacteria 5500
163 Ga0436365_1224244 3300039437 Bacteria 2746
164 Ga0436365_1924769 3300039437 Bacteria 45178
165 Ga0436360_0824491 3300039438 Bacteria 3839
166 Ga0436361_0080101 3300039447 Bacteria 16464
167 Ga0436362_0127292 3300039453 Unclassified 2146
168 Ga0466969_0037386 3300044656 Bacteria 2448
169 Ga0466966_0031839 3300044684 Bacteria 3420
170 Ga0466961_0118583 3300044693 Bacteria 1662
171 Ga0466964_0001410 3300044706 Bacteria 8199
172 Ga0466971_0007343 3300044719 Bacteria 4794
173 Ga0466970_0006312 3300044765 Bacteria 5918
174 Ga0466957_0013597 3300044842 Bacteria 4724
175 Ga0466959_0015677 3300045049 Bacteria 5525
176 Ga0466959_0073522 3300045049 Bacteria 2473
177 Ga0495592_0109104 3300046454 Bacteria 1961
178 Ga0495638_0001151 3300046460 Bacteria 25469
179 Ga0495650_0003612 3300046471 Bacteria 11145
180 Ga0495650_0013628 3300046471 Bacteria 4287
181 Ga0495580_0276590 3300046472 Bacteria 1146
182 Ga0495610_0036532 3300046512 Bacteria 2509
183 Ga0495628_0059894 3300046516 Bacteria 2988
184 Ga0495648_0243955 3300046524 Bacteria 871
185 Ga0495668_0000001 3300046616 Bacteria 1013420
186 Ga0495668_0166373 3300046616 Bacteria 1208
187 Ga0495661_0071619 3300046665 Bacteria 2025
188 Ga0495674_0036177 3300047319 Bacteria 4447
189 Ga0495672_0010629 3300047320 Bacteria 6540
190 Ga0495672_0036593 3300047320 Bacteria 3013
191 Ga0495684_0220966 3300047471 Bacteria 1389
192 Ga0495686_0000260 3300047472 Bacteria 94551
193 Ga0495686_0001680 3300047472 Bacteria 22995
194 Ga0495626_0076002 3300048091 Bacteria 1500
195 Ga0496104_0000618 3300048907 Bacteria 30466
196 Ga0496104_0018794 3300048907 Bacteria 6311
197 Ga0496108_0088231 3300048911 Bacteria 2635
198 Ga0496109_0123513 3300048912 Bacteria 2413
199 Ga0496109_0167301 3300048912 Bacteria 2062
200 Ga0496110_0051866 3300048913 Bacteria 3605
201 Ga0496111_0003023 3300048914 Bacteria 10315
202 Ga0496112_0261052 3300048915 Bacteria 1681
203 Ga0496113_0009123 3300048916 Bacteria 6499
204 Ga0496113_0085636 3300048916 Bacteria 2421
205 Ga0496115_0024212 3300048918 Bacteria 4716
206 Ga0496117_0124527 3300048920 Bacteria 1576
207 Ga0496118_0020944 3300048921 Bacteria 5779
208 Ga0496121_0000643 3300048924 Bacteria 65217
209 Ga0496121_0008408 3300048924 Bacteria 12156
210 Ga0496121_0054158 3300048924 Bacteria 3355
211 Ga0496125_0001714 3300048928 Bacteria 30520
212 Ga0496126_0006376 3300048929 Bacteria 13162
213 Ga0495682_0090522 3300049460 Bacteria 1099
214 Ga0501034_0091332 3300049571 Bacteria 3043
215 Ga0501039_0068921 3300049575 Bacteria 2746
216 Ga0501041_0203820 3300049577 Bacteria 1240
217 Ga0501046_0258399 3300049580 Bacteria 1280
218 Ga0501047_0000070 3300049581 Bacteria 127146
219 Ga0501047_0000713 3300049581 Bacteria 34681
220 Ga0501070_0355305 3300049586 Bacteria 1189
221 Ga0501073_0100915 3300049589 Bacteria 2004
222 Ga0501077_0167258 3300049593 Bacteria 1397
223 Ga0501223_015412 3300049663 Bacteria 1513
224 Ga0501224_000011 3300049664 Bacteria 93275
225 Ga0501233_000253 3300049668 Bacteria 8131
226 Ga0501257_000009 3300049686 Bacteria 54439
227 Ga0501225_0032094 3300049705 Bacteria 1444
228 Ga0501225_0036755 3300049705 Bacteria 1349
229 Ga0501234_002172 3300049707 Bacteria 3098
230 Ga0501080_0498195 3300049742 Bacteria 1089
231 Ga0501045_0231019 3300049824 Bacteria 1377
232 Ga0501226_000024 3300049853 Bacteria 93123
233 nmdc:mga03683_35355_c1 3300050489 Bacteria 2026
234 nmdc:mga0yw44_37082_c1 3300050492 Bacteria 2877
235 nmdc:mga0yw44_4842_c1 3300050492 Bacteria 6255
236 nmdc:mga05p37_150293_c1 3300050507 Bacteria 2849
237 nmdc:mga05p37_211446_c1 3300050507 Bacteria 2344
238 nmdc:mga05p37_401229_c1 3300050507 Bacteria 1601
239 nmdc:mga09592_395260_c1 3300050508 Bacteria 1195
240 nmdc:mga09592_440513_c1 3300050508 Bacteria 1124
241 nmdc:mga0qj67_103172_c1 3300050509 Bacteria 2300
242 nmdc:mga0qj67_221668_c1 3300050509 Bacteria 1535
243 nmdc:mga06r32_641916_c1 3300050510 Bacteria 1030
244 nmdc:mga08y16_73579_c1 3300050511 Bacteria 3561
245 nmdc:mga0n895_122727_c1 3300050512 Bacteria 2619
246 nmdc:mga0rr50_3249_c1 3300050513 Bacteria 9313
247 nmdc:mga0rr50_90328_c1 3300050513 Bacteria 2383
248 nmdc:mga0a205_127131_c1 3300050515 Bacteria 2448
249 Ga0500643_002497 3300053087 Bacteria 9433
250 Ga0500566_0011104 3300053094 Bacteria 5306
251 Ga0500641_0012219 3300053096 Bacteria 3132
252 Ga0500650_0000309 3300053098 Bacteria 11742
253 Ga0500554_066476 3300053102 Bacteria 1166
254 Ga0500568_0045405 3300053139 Bacteria 1748
255 Ga0500590_055512 3300053148 Bacteria 2004
256 Ga0500616_0000033 3300053153 Bacteria 398830
257 Ga0500622_0000073 3300053156 Bacteria 111045
258 Ga0500627_0005428 3300053158 Bacteria 4238
259 Ga0500636_0000712 3300053177 Bacteria 17867
260 Ga0500637_0240910 3300053178 Bacteria 1014
261 Ga0500596_002527 3300053735 Bacteria 3599
262 Ga0500661_007313 3300055283 Bacteria 2046
263 Ga0501082_0127336 3300060353 Bacteria 2209
264 Ga0466962_0006912 3300061719 Bacteria 5439

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050508 nmdc:mga09592_440513_c1 nmdc:mga09592_440513_c1_50_721 189
2 3300006177 Ga0075362_10041039 Ga0075362_100410392 231
3 3300006844 Ga0075428_100240130 Ga0075428_1002401302 231
4 3300006846 Ga0075430_100349683 Ga0075430_1003496832 231
5 3300009147 Ga0114129_10449038 Ga0114129_104490382 231
6 3300046471 Ga0495650_0013628 Ga0495650_0013628_2691_3482 231
7 3300049586 Ga0501070_0355305 Ga0501070_0355305_22_723 231
8 3300050489 nmdc:mga03683_35355_c1 nmdc:mga03683_35355_c1_103_900 231
9 3300050507 nmdc:mga05p37_150293_c1 nmdc:mga05p37_150293_c1_50_847 231
10 3300046524 Ga0495648_0243955 Ga0495648_0243955_125_823 232
11 3300028800 Ga0265338_10000547 Ga0265338_100005474 233
12 3300031238 Ga0265332_10075265 Ga0265332_100752652 233
13 3300031247 Ga0265340_10116182 Ga0265340_101161821 233
14 3300037471 Ga0395905_0000166 Ga0395905_0000166_4125_4916 235
15 3300047319 Ga0495674_0036177 Ga0495674_0036177_2279_3070 236
16 3300006237 Ga0097621_100212528 Ga0097621_1002125281 239
17 3300046471 Ga0495650_0003612 Ga0495650_0003612_7688_8476 240
18 3300007788 Ga0099795_10001375 Ga0099795_100013752 241
19 3300010159 Ga0099796_10000132 Ga0099796_1000013212 241
20 3300027512 Ga0209179_1018577 Ga0209179_10185772 241
21 3300048907 Ga0496104_0000618 Ga0496104_0000618_26072_26875 242
22 3300049575 Ga0501039_0068921 Ga0501039_0068921_69_836 245
23 3300049577 Ga0501041_0203820 Ga0501041_0203820_85_852 245
24 3300049580 Ga0501046_0258399 Ga0501046_0258399_77_844 245
25 3300049824 Ga0501045_0231019 Ga0501045_0231019_97_864 245
26 3300005614 Ga0068856_100888147 Ga0068856_1008881471 246
27 3300009094 Ga0111539_11145752 Ga0111539_111457521 249
28 3300016635 Ga0183361_10015 Ga0183361_10015177 251
29 3300021384 Ga0213876_10001060 Ga0213876_1000106014 251
30 3300039437 Ga0436365_1924769 Ga0436365_1924769_3868_4659 251
31 3300035691 Ga0373931_0037480 Ga0373931_0037480_1049_1846 252
32 3300039438 Ga0436360_0824491 Ga0436360_0824491_901_1695 252
33 3300049589 Ga0501073_0100915 Ga0501073_0100915_609_1400 256
34 3300006914 Ga0075436_100073959 Ga0075436_1000739592 258
35 3300013306 Ga0163162_10203356 Ga0163162_102033563 258
36 3300025921 Ga0207652_10595273 Ga0207652_105952732 258
37 3300025981 Ga0207640_10133584 Ga0207640_101335843 258
38 iso_pu_bacteria 2501025501 2501075562 258
39 iso_pu_bacteria 2510917014 2511099896 258
40 iso_pu_bacteria 2510917015 2511102319 258
41 iso_pu_bacteria 2513237166 2514053153 258
42 iso_pu_bacteria 2515154189 2516024960 258
43 iso_pu_bacteria 2600255067 2600813964 258
44 iso_pu_bacteria 2744054901 2746093135 258
45 iso_pu_bacteria 2791355137 2792832800 258
46 iso_pu_bacteria 2842454564 2842461152 258
47 iso_pu_bacteria 2857524615 2857525213 258
48 iso_pu_bacteria 2883087390 2883094891 258
49 iso_pu_bacteria 2893066018 2893069601 258
50 iso_pu_bacteria 2900634093 2900637206 258
51 iso_pu_bacteria 2904690495 2904698246 258
52 iso_pu_bacteria 2904699407 2904706893 258
53 iso_pu_bacteria 2919527303 2919533420 258
54 iso_pu_bacteria 642555112 642594486 258
55 iso_pu_bacteria 642555113 642623067 258
56 iso_pu_bacteria 8006933436 8006934677 258
57 iso_pu_bacteria 8006973647 8006974646 258
58 iso_pu_bacteria 8055266321 8055269636 258
59 3300005344 Ga0070661_100059002 Ga0070661_1000590024 259
60 3300005355 Ga0070671_100043475 Ga0070671_1000434752 259
61 3300005834 Ga0068851_10092910 Ga0068851_100929102 259
62 3300009177 Ga0105248_10041900 Ga0105248_100419004 259
63 3300025321 Ga0207656_10071615 Ga0207656_100716152 259
64 3300025909 Ga0207705_10001965 Ga0207705_1000196521 259
65 3300025931 Ga0207644_10013382 Ga0207644_100133826 259
66 3300031456 Ga0307513_10106063 Ga0307513_101060633 259
67 3300031730 Ga0307516_10381783 Ga0307516_103817832 259
68 3300035695 Ga0373927_0198991 Ga0373927_0198991_313_1101 259
69 3300048913 Ga0496110_0051866 Ga0496110_0051866_2430_3209 259
70 3300048915 Ga0496112_0261052 Ga0496112_0261052_780_1559 259
71 3300048916 Ga0496113_0009123 Ga0496113_0009123_241_1020 259
72 iso_pu_bacteria 2522572158 2523105984 259
73 iso_pu_bacteria 2643221541 2643727277 259
74 iso_pu_bacteria 2643221606 2644041562 259
75 iso_pu_bacteria 2643221671 2644395102 259
76 3300005327 Ga0070658_10000144 Ga0070658_100001443 260
77 3300005539 Ga0068853_100274109 Ga0068853_1002741092 260
78 3300005563 Ga0068855_100030644 Ga0068855_1000306442 260
79 3300005563 Ga0068855_100179262 Ga0068855_1001792622 260
80 3300005577 Ga0068857_100067673 Ga0068857_1000676733 260
81 3300005578 Ga0068854_100000582 Ga0068854_10000058220 260
82 3300005614 Ga0068856_100587370 Ga0068856_1005873702 260
83 3300005616 Ga0068852_100000273 Ga0068852_1000002738 260
84 3300009093 Ga0105240_10022919 Ga0105240_100229193 260
85 3300009551 Ga0105238_10070170 Ga0105238_100701703 260
86 3300010375 Ga0105239_10687345 Ga0105239_106873451 260
87 3300025904 Ga0207647_10005167 Ga0207647_100051673 260
88 3300025909 Ga0207705_10000155 Ga0207705_1000015558 260
89 3300025913 Ga0207695_10024927 Ga0207695_100249276 260
90 3300025924 Ga0207694_10151108 Ga0207694_101511082 260
91 3300025949 Ga0207667_10022308 Ga0207667_100223089 260
92 3300025981 Ga0207640_10000314 Ga0207640_1000031412 260
93 3300026116 Ga0207674_10108599 Ga0207674_101085992 260
94 3300026142 Ga0207698_10000179 Ga0207698_100001798 260
95 3300003659 JGI25404J52841_10003201 JGI25404J52841_100032013 261
96 3300005843 Ga0068860_100318734 Ga0068860_1003187342 261
97 3300005983 Ga0081540_1000413 Ga0081540_100041334 261
98 3300013306 Ga0163162_10636687 Ga0163162_106366871 261
99 3300014969 Ga0157376_10847013 Ga0157376_108470131 261
100 3300028381 Ga0268264_10330834 Ga0268264_103308342 261
101 3300035695 Ga0373927_0034254 Ga0373927_0034254_1804_2634 261
102 3300035724 Ga0373933_0054541 Ga0373933_0054541_904_1734 261
103 3300035725 Ga0373947_0010892 Ga0373947_0010892_2312_3142 261
104 3300036401 Ga0373937_0596833 Ga0373937_0596833_30_860 261
105 3300037068 Ga0373925_0071389 Ga0373925_0071389_640_1449 261
106 3300037068 Ga0373925_0252224 Ga0373925_0252224_409_1239 261
107 3300046454 Ga0495592_0109104 Ga0495592_0109104_742_1551 261
108 3300046516 Ga0495628_0059894 Ga0495628_0059894_1966_2775 261
109 3300047471 Ga0495684_0220966 Ga0495684_0220966_35_865 261
110 3300048907 Ga0496104_0018794 Ga0496104_0018794_1251_2054 261
111 3300048912 Ga0496109_0167301 Ga0496109_0167301_245_1048 261
112 3300048916 Ga0496113_0085636 Ga0496113_0085636_106_909 261
113 3300048918 Ga0496115_0024212 Ga0496115_0024212_715_1518 261
114 3300048924 Ga0496121_0008408 Ga0496121_0008408_6701_7486 261
115 3300005471 Ga0070698_100398018 Ga0070698_1003980182 262
116 3300005563 Ga0068855_100089215 Ga0068855_1000892153 262
117 3300005578 Ga0068854_100075409 Ga0068854_1000754093 262
118 3300005844 Ga0068862_100006632 Ga0068862_1000066327 262
119 3300005937 Ga0081455_10014076 Ga0081455_100140769 262
120 3300006038 Ga0075365_10006308 Ga0075365_100063085 262
121 3300006038 Ga0075365_10014812 Ga0075365_100148124 262
122 3300006051 Ga0075364_10049265 Ga0075364_100492652 262
123 3300006844 Ga0075428_100100973 Ga0075428_1001009732 262
124 3300006846 Ga0075430_100250156 Ga0075430_1002501562 262
125 3300009093 Ga0105240_10238463 Ga0105240_102384633 262
126 3300009094 Ga0111539_10187861 Ga0111539_101878612 262
127 3300013307 Ga0157372_10053036 Ga0157372_100530362 262
128 3300025913 Ga0207695_10093342 Ga0207695_100933421 262
129 3300025934 Ga0207686_10188260 Ga0207686_101882602 262
130 3300028380 Ga0268265_10012028 Ga0268265_100120283 262
131 3300028381 Ga0268264_10441196 Ga0268264_104411961 262
132 3300028794 Ga0307515_10014473 Ga0307515_100144733 262
133 3300028794 Ga0307515_10198538 Ga0307515_101985383 262
134 3300031456 Ga0307513_10123330 Ga0307513_101233302 262
135 3300031712 Ga0265342_10000319 Ga0265342_1000031932 262
136 3300031911 Ga0307412_10084837 Ga0307412_100848372 262
137 3300033180 Ga0307510_10057217 Ga0307510_100572172 262
138 3300037471 Ga0395905_0145837 Ga0395905_0145837_1251_2039 262
139 3300037853 Ga0436364_0184302 Ga0436364_0184302_1982_2794 262
140 3300039453 Ga0436362_0127292 Ga0436362_0127292_571_1359 262
141 3300044656 Ga0466969_0037386 Ga0466969_0037386_986_1774 262
142 3300044684 Ga0466966_0031839 Ga0466966_0031839_1188_1976 262
143 3300044693 Ga0466961_0118583 Ga0466961_0118583_538_1326 262
144 3300044706 Ga0466964_0001410 Ga0466964_0001410_5599_6387 262
145 3300044719 Ga0466971_0007343 Ga0466971_0007343_1334_2122 262
146 3300044765 Ga0466970_0006312 Ga0466970_0006312_3843_4631 262
147 3300044842 Ga0466957_0013597 Ga0466957_0013597_695_1483 262
148 3300045049 Ga0466959_0015677 Ga0466959_0015677_2290_3078 262
149 3300046460 Ga0495638_0001151 Ga0495638_0001151_18946_19737 262
150 3300046512 Ga0495610_0036532 Ga0495610_0036532_1105_1896 262
151 3300046616 Ga0495668_0166373 Ga0495668_0166373_305_1096 262
152 3300046665 Ga0495661_0071619 Ga0495661_0071619_193_984 262
153 3300047320 Ga0495672_0010629 Ga0495672_0010629_2494_3285 262
154 3300047320 Ga0495672_0036593 Ga0495672_0036593_878_1675 262
155 3300048091 Ga0495626_0076002 Ga0495626_0076002_612_1469 262
156 3300048920 Ga0496117_0124527 Ga0496117_0124527_730_1521 262
157 3300048921 Ga0496118_0020944 Ga0496118_0020944_3512_4303 262
158 3300048924 Ga0496121_0000643 Ga0496121_0000643_7666_8457 262
159 3300048924 Ga0496121_0054158 Ga0496121_0054158_76_936 262
160 3300048928 Ga0496125_0001714 Ga0496125_0001714_3770_4561 262
161 3300048929 Ga0496126_0006376 Ga0496126_0006376_8356_9189 262
162 3300049460 Ga0495682_0090522 Ga0495682_0090522_27_905 262
163 3300049581 Ga0501047_0000713 Ga0501047_0000713_29675_30463 262
164 3300049593 Ga0501077_0167258 Ga0501077_0167258_203_1000 262
165 3300049742 Ga0501080_0498195 Ga0501080_0498195_225_1022 262
166 3300050492 nmdc:mga0yw44_37082_c1 nmdc:mga0yw44_37082_c1_1680_2480 262
167 3300050492 nmdc:mga0yw44_4842_c1 nmdc:mga0yw44_4842_c1_1028_1858 262
168 3300050507 nmdc:mga05p37_211446_c1 nmdc:mga05p37_211446_c1_198_1028 262
169 3300050507 nmdc:mga05p37_401229_c1 nmdc:mga05p37_401229_c1_747_1574 262
170 3300050508 nmdc:mga09592_395260_c1 nmdc:mga09592_395260_c1_110_907 262
171 3300050509 nmdc:mga0qj67_103172_c1 nmdc:mga0qj67_103172_c1_92_889 262
172 3300050510 nmdc:mga06r32_641916_c1 nmdc:mga06r32_641916_c1_170_970 262
173 3300053094 Ga0500566_0011104 Ga0500566_0011104_3106_3897 262
174 3300053096 Ga0500641_0012219 Ga0500641_0012219_1760_2551 262
175 3300053098 Ga0500650_0000309 Ga0500650_0000309_9406_10197 262
176 3300053102 Ga0500554_066476 Ga0500554_066476_59_850 262
177 3300053139 Ga0500568_0045405 Ga0500568_0045405_62_853 262
178 3300053148 Ga0500590_055512 Ga0500590_055512_548_1405 262
179 3300053153 Ga0500616_0000033 Ga0500616_0000033_241251_242042 262
180 3300053156 Ga0500622_0000073 Ga0500622_0000073_87812_88681 262
181 3300053158 Ga0500627_0005428 Ga0500627_0005428_2076_2867 262
182 3300053177 Ga0500636_0000712 Ga0500636_0000712_12378_13235 262
183 3300053178 Ga0500637_0240910 Ga0500637_0240910_15_872 262
184 3300060353 Ga0501082_0127336 Ga0501082_0127336_1366_2160 262
185 3300061719 Ga0466962_0006912 Ga0466962_0006912_1367_2155 262
186 3300001979 JGI24740J21852_10001692 JGI24740J21852_100016926 263
187 3300001989 JGI24739J22299_10009431 JGI24739J22299_100094313 263
188 3300001990 JGI24737J22298_10031400 JGI24737J22298_100314002 263
189 3300002075 JGI24738J21930_10000550 JGI24738J21930_100005508 263
190 3300002738 JGI25154J39366_1002002 JGI25154J39366_10020022 263
191 3300005327 Ga0070658_10229680 Ga0070658_102296802 263
192 3300005339 Ga0070660_100104679 Ga0070660_1001046792 263
193 3300005339 Ga0070660_100121974 Ga0070660_1001219742 263
194 3300005340 Ga0070689_100436277 Ga0070689_1004362771 263
195 3300005366 Ga0070659_100000984 Ga0070659_10000098410 263
196 3300005445 Ga0070708_100545891 Ga0070708_1005458911 263
197 3300005457 Ga0070662_100065119 Ga0070662_1000651192 263
198 3300005535 Ga0070684_100090149 Ga0070684_1000901492 263
199 3300005539 Ga0068853_100018745 Ga0068853_1000187453 263
200 3300005539 Ga0068853_100304302 Ga0068853_1003043021 263
201 3300005563 Ga0068855_100012316 Ga0068855_1000123164 263
202 3300005563 Ga0068855_100014954 Ga0068855_1000149549 263
203 3300005564 Ga0070664_100043309 Ga0070664_1000433092 263
204 3300005577 Ga0068857_100021396 Ga0068857_1000213962 263
205 3300005578 Ga0068854_100006504 Ga0068854_1000065044 263
206 3300005578 Ga0068854_100014855 Ga0068854_1000148554 263
207 3300005614 Ga0068856_100008581 Ga0068856_1000085815 263
208 3300005614 Ga0068856_100010919 Ga0068856_1000109194 263
209 3300005616 Ga0068852_100015853 Ga0068852_1000158535 263
210 3300006844 Ga0075428_100216314 Ga0075428_1002163143 263
211 3300006846 Ga0075430_100250843 Ga0075430_1002508432 263
212 3300006914 Ga0075436_100204677 Ga0075436_1002046772 263
213 3300007076 Ga0075435_100013659 Ga0075435_1000136595 263
214 3300009093 Ga0105240_10021093 Ga0105240_100210934 263
215 3300009094 Ga0111539_10020493 Ga0111539_100204936 263
216 3300009147 Ga0114129_10022605 Ga0114129_100226057 263
217 3300009174 Ga0105241_10003738 Ga0105241_100037388 263
218 3300009174 Ga0105241_10004214 Ga0105241_100042145 263
219 3300009545 Ga0105237_10009175 Ga0105237_100091755 263
220 3300009545 Ga0105237_10029535 Ga0105237_100295351 263
221 3300009551 Ga0105238_10010683 Ga0105238_100106835 263
222 3300010375 Ga0105239_10017904 Ga0105239_100179044 263
223 3300013104 Ga0157370_10006267 Ga0157370_1000626710 263
224 3300013105 Ga0157369_10002565 Ga0157369_1000256516 263
225 3300013297 Ga0157378_10248674 Ga0157378_102486742 263
226 3300013307 Ga0157372_10147356 Ga0157372_101473562 263
227 3300013308 Ga0157375_10087161 Ga0157375_100871612 263
228 3300014968 Ga0157379_10118422 Ga0157379_101184223 263
229 3300021361 Ga0213872_10000135 Ga0213872_1000013522 263
230 3300025911 Ga0207654_10000442 Ga0207654_1000044217 263
231 3300025911 Ga0207654_10002157 Ga0207654_100021577 263
232 3300025913 Ga0207695_10003338 Ga0207695_1000333819 263
233 3300025913 Ga0207695_10008582 Ga0207695_100085829 263
234 3300025914 Ga0207671_10000702 Ga0207671_1000070236 263
235 3300025919 Ga0207657_10002610 Ga0207657_1000261016 263
236 3300025924 Ga0207694_10004238 Ga0207694_100042388 263
237 3300025924 Ga0207694_10006085 Ga0207694_100060856 263
238 3300025932 Ga0207690_10000052 Ga0207690_1000005212 263
239 3300025933 Ga0207706_10007402 Ga0207706_100074026 263
240 3300025949 Ga0207667_10007044 Ga0207667_100070449 263
241 3300025949 Ga0207667_10007260 Ga0207667_100072605 263
242 3300025981 Ga0207640_10147350 Ga0207640_101473502 263
243 3300026041 Ga0207639_10014191 Ga0207639_100141912 263
244 3300026067 Ga0207678_10003212 Ga0207678_100032127 263
245 3300026078 Ga0207702_10002001 Ga0207702_1000200113 263
246 3300026078 Ga0207702_10002550 Ga0207702_1000255012 263
247 3300026116 Ga0207674_10061848 Ga0207674_100618481 263
248 3300026142 Ga0207698_10000649 Ga0207698_100006493 263
249 3300026142 Ga0207698_10002024 Ga0207698_100020243 263
250 3300027907 Ga0207428_10227733 Ga0207428_102277332 263
251 3300031238 Ga0265332_10000546 Ga0265332_1000054616 263
252 3300031456 Ga0307513_10040909 Ga0307513_100409093 263
253 3300031456 Ga0307513_10192916 Ga0307513_101929162 263
254 3300032002 Ga0307416_100005766 Ga0307416_1000057666 263
255 3300035410 Ga0373924_0097349 Ga0373924_0097349_341_1132 263
256 3300035692 Ga0373935_0443048 Ga0373935_0443048_60_851 263
257 3300035695 Ga0373927_0075345 Ga0373927_0075345_852_1661 263
258 3300035725 Ga0373947_0249282 Ga0373947_0249282_97_948 263
259 3300037068 Ga0373925_0612894 Ga0373925_0612894_14_805 263
260 3300037312 Ga0395899_0000004 Ga0395899_0000004_200564_201355 263
261 3300039437 Ga0436365_1224244 Ga0436365_1224244_57_848 263
262 3300039447 Ga0436361_0080101 Ga0436361_0080101_10353_11144 263
263 3300045049 Ga0466959_0073522 Ga0466959_0073522_74_865 263
264 3300046472 Ga0495580_0276590 Ga0495580_0276590_190_981 263
265 3300046616 Ga0495668_0000001 Ga0495668_0000001_996002_996793 263
266 3300047472 Ga0495686_0000260 Ga0495686_0000260_64721_65512 263
267 3300047472 Ga0495686_0001680 Ga0495686_0001680_67_858 263
268 3300048911 Ga0496108_0088231 Ga0496108_0088231_927_1730 263
269 3300048912 Ga0496109_0123513 Ga0496109_0123513_95_898 263
270 3300048914 Ga0496111_0003023 Ga0496111_0003023_6958_7761 263
271 3300049571 Ga0501034_0091332 Ga0501034_0091332_913_1704 263
272 3300049581 Ga0501047_0000070 Ga0501047_0000070_83388_84179 263
273 3300049663 Ga0501223_015412 Ga0501223_015412_340_1131 263
274 3300049664 Ga0501224_000011 Ga0501224_000011_70471_71262 263
275 3300049668 Ga0501233_000253 Ga0501233_000253_5475_6266 263
276 3300049686 Ga0501257_000009 Ga0501257_000009_21685_22476 263
277 3300049705 Ga0501225_0032094 Ga0501225_0032094_601_1392 263
278 3300049705 Ga0501225_0036755 Ga0501225_0036755_273_1064 263
279 3300049707 Ga0501234_002172 Ga0501234_002172_2189_2980 263
280 3300049853 Ga0501226_000024 Ga0501226_000024_21995_22786 263
281 3300050509 nmdc:mga0qj67_221668_c1 nmdc:mga0qj67_221668_c1_101_898 263
282 3300050511 nmdc:mga08y16_73579_c1 nmdc:mga08y16_73579_c1_832_1629 263
283 3300050512 nmdc:mga0n895_122727_c1 nmdc:mga0n895_122727_c1_1084_1887 263
284 3300050513 nmdc:mga0rr50_3249_c1 nmdc:mga0rr50_3249_c1_3442_4239 263
285 3300050513 nmdc:mga0rr50_90328_c1 nmdc:mga0rr50_90328_c1_1053_1856 263
286 3300050515 nmdc:mga0a205_127131_c1 nmdc:mga0a205_127131_c1_1535_2338 263
287 3300053087 Ga0500643_002497 Ga0500643_002497_7930_8721 263
288 3300053735 Ga0500596_002527 Ga0500596_002527_412_1203 263
289 3300055283 Ga0500661_007313 Ga0500661_007313_14_805 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

39

291

0.95

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

43

245

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fzw-assembly1.cif.gz_D crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9802 6 262
4fzw-assembly1.cif.gz_C crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9801 6 262
4fzw-assembly1.cif.gz_D crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9724 6 262
4fzw-assembly1.cif.gz_C crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9723 6 262
3hrx-assembly2.cif.gz_F crystal structure of phenylacetic acid degradation protein paag 0.9686 6 262
ID Description Score Start End Superfamily
af_P77467_205_262_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 1.002 208 262 1.10.12.10
4fzwC02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.997 208 262 1.10.12.10
4fzwD02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9968 208 262 1.10.12.10
3hrxA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9912 207 262 1.10.12.10
3hrxB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9904 207 262 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A4P0Y6Q3-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9934 94 262 GO:0004300
AF-A0A376RKK3-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9929 84 262 GO:0004300
GO:0016020
AF-A0A6A5L2U9-F1-model_v4 deleted 0.9892 13 262
AF-A0A2C9EMT4-F1-model_v4 Putative enoyl-CoA hydratase PaaG (EC 4.2.1.17) 0.984 1 262 GO:0004300
GO:0010124
AF-A0A7K0A4D3-F1-model_v4 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase 0.9809 4 262

Feature Viewer

pLDDT pTM Quality
94.67 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map