F389389

General Info

Members Datasets Scaffolds Average Seq Length
289 213 287 157

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0000072|Ga0495686_0000072_21116_21694
Length 192
Sequence MPAGPDPTRHDRVGALRSRELYIRPIGKRDSEREMTIEAERPPLPPFTLETAVQKVRLAEDGWNGRDPERVSLAYTVDCHWRNRAEFIEGRAAIQAFLARKWARELDYRLIKELWAFTDDRIAVRFAYEWRDDSGQWYRSYGNENWEFAANGLMRRRIASINDAPIAGADRKFHWPQGRRPDDHPGLSEFGF

Samples

Sample ID Description Type Environment
1 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
2 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
53 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
78 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
89 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
96 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
114 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
115 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
116 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
117 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
129 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
134 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
148 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
159 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
160 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
161 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
167 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
168 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
197 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
198 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
199 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
200 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
201 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
202 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
203 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
204 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
205 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
206 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
207 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
210 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
211 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
212 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.53
Nodule 1.73
Rhizoplane 1.38
Rhizosphere 73.01
Stem 0
Stem Tuber 0
Unclassified 9.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000969 3300002773 Bacteria 13988
2 JGI25151J46595_10002492 3300003187 Bacteria 11003
3 rootL2_10150555 3300003322 Bacteria 1537
4 Ga0055529_1000481 3300003763 Bacteria 37462
5 Ga0055526_1000080 3300003771 Bacteria 87500
6 Ga0055540_1035850 3300003792 Bacteria 1106
7 Ga0058692_1014673 3300003856 Bacteria 1788
8 Ga0065165_1000074 3300005262 Bacteria 164454
9 Ga0070714_100622835 3300005435 Bacteria 1037
10 Ga0070713_100683096 3300005436 Bacteria 979
11 Ga0070694_100013134 3300005444 Bacteria 5167
12 Ga0068867_100002213 3300005459 Bacteria 13647
13 Ga0068867_102045073 3300005459 Bacteria 542
14 Ga0070695_100013116 3300005545 Bacteria 4980
15 Ga0070665_100560939 3300005548 Bacteria 1154
16 Ga0068855_100439975 3300005563 Bacteria 1424
17 Ga0068855_100546034 3300005563 Bacteria 1255
18 Ga0068856_100648472 3300005614 Bacteria 1076
19 Ga0068859_100001416 3300005617 Bacteria 24328
20 Ga0068864_101483218 3300005618 Bacteria 681
21 Ga0068862_100080408 3300005844 Bacteria 2826
22 Ga0081540_1000213 3300005983 Bacteria 61164
23 Ga0075363_100822034 3300006048 Bacteria 566
24 Ga0070712_101278793 3300006175 Bacteria 639
25 Ga0075367_10067915 3300006178 Bacteria 2138
26 Ga0075366_10001457 3300006195 Bacteria 11781
27 Ga0075370_10000072 3300006353 Bacteria 31056
28 Ga0075370_10198850 3300006353 Bacteria 1182
29 Ga0075430_100000353 3300006846 Bacteria 33394
30 Ga0075430_100028768 3300006846 Bacteria 4720
31 Ga0075431_100002478 3300006847 Bacteria 17790
32 Ga0075431_100049025 3300006847 Bacteria 4356
33 Ga0075429_100024821 3300006880 Bacteria 5203
34 Ga0068865_100699573 3300006881 Bacteria 866
35 Ga0097620_100001416 3300006931 Bacteria 24328
36 Ga0099826_10000011 3300006948 Bacteria 287659
37 Ga0105244_10001680 3300009036 Bacteria 17493
38 Ga0105240_10067927 3300009093 Bacteria 4417
39 Ga0105240_10370003 3300009093 Bacteria 1621
40 Ga0111539_10530014 3300009094 Bacteria 1372
41 Ga0114129_10069857 3300009147 Bacteria 4897
42 Ga0105243_10594472 3300009148 Bacteria 1064
43 Ga0105241_11121129 3300009174 Bacteria 742
44 Ga0105248_10150135 3300009177 Bacteria 2629
45 Ga0105248_10179259 3300009177 Bacteria 2388
46 Ga0105237_10506230 3300009545 Bacteria 1214
47 Ga0105238_10058212 3300009551 Bacteria 3874
48 Ga0105249_11780852 3300009553 Bacteria 688
49 Ga0105239_10145074 3300010375 Bacteria 2647
50 Ga0105239_11424384 3300010375 Bacteria 800
51 Ga0157373_11319720 3300013100 Bacteria 547
52 Ga0157371_10257631 3300013102 Bacteria 1257
53 Ga0157374_10108403 3300013296 Bacteria 2669
54 Ga0157372_10201448 3300013307 Bacteria 2306
55 Ga0163163_10677520 3300014325 Bacteria 1095
56 Ga0163163_12288157 3300014325 Bacteria 599
57 Ga0182008_10232944 3300014497 Bacteria 945
58 Ga0163161_10174490 3300017792 Bacteria 1645
59 Ga0214542_1024039 3300021321 Bacteria 3495
60 Ga0214543_1016151 3300021327 Bacteria 7935
61 Ga0213876_10001291 3300021384 Bacteria 15786
62 Ga0213876_10048815 3300021384 Bacteria 2235
63 Ga0209437_114966 3300025233 Bacteria 1070
64 Ga0209129_1000070 3300025258 Bacteria 212476
65 Ga0209455_1000026 3300025272 Bacteria 653778
66 Ga0209025_1000175 3300025294 Bacteria 158379
67 Ga0209564_1000007 3300025295 Bacteria 1028582
68 Ga0209051_1019056 3300025303 Bacteria 3010
69 Ga0207655_1003435 3300025728 Bacteria 11789
70 Ga0207655_1027955 3300025728 Bacteria 2672
71 Ga0207713_1169585 3300025735 Bacteria 689
72 Ga0207713_1220038 3300025735 Bacteria 573
73 Ga0207695_10040604 3300025913 Bacteria 4986
74 Ga0207695_10078085 3300025913 Bacteria 3360
75 Ga0207693_10032077 3300025915 Bacteria 4147
76 Ga0207693_10644044 3300025915 Bacteria 823
77 Ga0207694_10025556 3300025924 Bacteria 4488
78 Ga0207700_10063832 3300025928 Bacteria 2803
79 Ga0207704_10538496 3300025938 Bacteria 947
80 Ga0207665_10045236 3300025939 Bacteria 2947
81 Ga0207711_10035303 3300025941 Bacteria 4238
82 Ga0207711_10118002 3300025941 Bacteria 2367
83 Ga0207667_10211204 3300025949 Bacteria 1989
84 Ga0207667_10947481 3300025949 Bacteria 850
85 Ga0207658_10935221 3300025986 Bacteria 790
86 Ga0207639_10792655 3300026041 Bacteria 883
87 Ga0207702_10306289 3300026078 Bacteria 1509
88 Ga0207648_10002863 3300026089 Bacteria 18260
89 Ga0207676_10996153 3300026095 Bacteria 825
90 Ga0207675_100005522 3300026118 Bacteria 12097
91 Ga0209281_1011961 3300027111 Bacteria 1924
92 Ga0209371_1000601 3300027312 Bacteria 32294
93 Ga0209371_1001587 3300027312 Bacteria 14815
94 Ga0209967_1008959 3300027364 Bacteria 1384
95 Ga0209984_1000733 3300027424 Bacteria 3521
96 Ga0210000_1001213 3300027462 Bacteria 3628
97 Ga0209995_1002359 3300027471 Bacteria 2982
98 Ga0209968_1015899 3300027526 Bacteria 1193
99 Ga0209999_1001087 3300027543 Bacteria 4635
100 Ga0209982_1001568 3300027552 Bacteria 3142
101 Ga0209970_1006252 3300027614 Bacteria 1950
102 Ga0209983_1000679 3300027665 Bacteria 7312
103 Ga0209282_1000056 3300027666 Bacteria 100584
104 Ga0209971_1000587 3300027682 Bacteria 9475
105 Ga0209966_1000098 3300027695 Bacteria 38805
106 Ga0209974_10004183 3300027876 Bacteria 5159
107 Ga0268266_10182308 3300028379 Bacteria 1912
108 Ga0268265_10004528 3300028380 Bacteria 9618
109 Ga0265338_10565004 3300028800 Bacteria 795
110 Ga0268256_1000517 3300030500 Bacteria 32417
111 Ga0268256_1001369 3300030500 Bacteria 14815
112 Ga0307511_10138963 3300030521 Bacteria 1435
113 Ga0265320_10342899 3300031240 Bacteria 660
114 Ga0307513_10123533 3300031456 Bacteria 2550
115 Ga0307509_10007259 3300031507 Bacteria 14559
116 Ga0307509_10020914 3300031507 Bacteria 7416
117 Ga0307509_10306460 3300031507 Bacteria 1333
118 Ga0265313_10144014 3300031595 Bacteria 1023
119 Ga0307508_10068078 3300031616 Bacteria 3130
120 Ga0307516_10002678 3300031730 Bacteria 23553
121 Ga0307516_10184666 3300031730 Bacteria 1816
122 Ga0307406_10064883 3300031901 Bacteria 2371
123 Ga0307412_10117090 3300031911 Bacteria 1912
124 Ga0373950_0032451 3300034818 Bacteria 972
125 Ga0373943_0003331 3300035170 Bacteria 7300
126 Ga0373946_0230012 3300035171 Bacteria 898
127 Ga0373935_0027416 3300035692 Bacteria 3520
128 Ga0373947_0007953 3300035725 Bacteria 6114
129 Ga0395905_0112424 3300037471 Bacteria 2558
130 Ga0436365_0515209 3300039437 Bacteria 4604
131 Ga0436365_0841126 3300039437 Bacteria 605
132 Ga0436365_1820187 3300039437 Bacteria 16013
133 Ga0436361_1118989 3300039447 Bacteria 914
134 Ga0451789_0287469 3300041443 Bacteria 953
135 Ga0451793_1619994 3300041452 Bacteria 745
136 Ga0451806_521278 3300041462 Bacteria 651
137 Ga0439446_0030505 3300042156 Bacteria 1558
138 Ga0439434_0217186 3300042435 Bacteria 648
139 Ga0451577_0516337 3300042876 Bacteria 1085
140 Ga0466969_0008985 3300044656 Bacteria 5295
141 Ga0466961_0084093 3300044693 Bacteria 2012
142 Ga0466964_0647991 3300044706 Bacteria 584
143 Ga0453684_0087681 3300044712 Bacteria 3856
144 Ga0453684_0799415 3300044712 Bacteria 1017
145 Ga0466968_0029903 3300044735 Bacteria 2255
146 Ga0451576_0043166 3300045051 Bacteria 4758
147 Ga0451576_0208976 3300045051 Bacteria 2038
148 Ga0451576_0464910 3300045051 Bacteria 1329
149 Ga0495617_051271 3300046452 Bacteria 1372
150 Ga0495629_0153531 3300046459 Bacteria 1600
151 Ga0495638_0123739 3300046460 Bacteria 1526
152 Ga0495638_0323782 3300046460 Bacteria 823
153 Ga0495650_0000086 3300046471 Bacteria 235224
154 Ga0495650_0017754 3300046471 Bacteria 3558
155 Ga0495650_0034562 3300046471 Bacteria 2235
156 Ga0495650_0034656 3300046471 Bacteria 2231
157 Ga0495650_0214437 3300046471 Bacteria 665
158 Ga0495605_0000022 3300046474 Bacteria 248321
159 Ga0495605_0002358 3300046474 Bacteria 11748
160 Ga0495639_0215255 3300046475 Bacteria 943
161 Ga0495584_0345843 3300046491 Bacteria 755
162 Ga0495585_0000350 3300046492 Bacteria 44650
163 Ga0495596_0000151 3300046500 Bacteria 48207
164 Ga0495607_0000725 3300046501 Bacteria 31676
165 Ga0495606_0003096 3300046507 Bacteria 18095
166 Ga0495606_0004900 3300046507 Bacteria 13103
167 Ga0495610_0000010 3300046512 Bacteria 538821
168 Ga0495610_0000328 3300046512 Bacteria 50375
169 Ga0495610_0001957 3300046512 Bacteria 17721
170 Ga0495610_0151866 3300046512 Bacteria 987
171 Ga0495616_0000501 3300046513 Bacteria 29682
172 Ga0495630_0188982 3300046517 Bacteria 1571
173 Ga0495631_0348215 3300046518 Bacteria 630
174 Ga0495632_0001040 3300046519 Bacteria 23905
175 Ga0495637_0126462 3300046520 Bacteria 979
176 Ga0495643_0000049 3300046522 Bacteria 212242
177 Ga0495643_0000137 3300046522 Bacteria 117968
178 Ga0495643_0196074 3300046522 Bacteria 972
179 Ga0495648_0006273 3300046524 Bacteria 9730
180 Ga0495648_0010663 3300046524 Bacteria 6984
181 Ga0495648_0035266 3300046524 Bacteria 3244
182 Ga0495648_0047268 3300046524 Bacteria 2661
183 Ga0495648_0065268 3300046524 Bacteria 2141
184 Ga0495648_0383303 3300046524 Bacteria 633
185 Ga0495652_0696765 3300046529 Bacteria 684
186 Ga0495654_0010709 3300046530 Bacteria 4980
187 Ga0495640_0114826 3300046533 Bacteria 1755
188 Ga0495609_0001067 3300046538 Bacteria 19193
189 Ga0495609_0023250 3300046538 Bacteria 2850
190 Ga0495597_0000276 3300046542 Bacteria 46947
191 Ga0495597_0138961 3300046542 Bacteria 1003
192 Ga0495645_0258825 3300046543 Bacteria 1153
193 Ga0495633_0000220 3300046558 Bacteria 70701
194 Ga0495633_0002754 3300046558 Bacteria 12159
195 Ga0495633_0029527 3300046558 Bacteria 2667
196 Ga0495656_0105425 3300046615 Bacteria 1310
197 Ga0495668_0000004 3300046616 Bacteria 574236
198 Ga0495668_0003088 3300046616 Bacteria 12882
199 Ga0495625_0000047 3300046660 Bacteria 200913
200 Ga0495625_0016170 3300046660 Bacteria 5877
201 Ga0495625_0017422 3300046660 Bacteria 5625
202 Ga0495625_0078895 3300046660 Bacteria 2298
203 Ga0495625_0133221 3300046660 Bacteria 1682
204 Ga0495661_0008567 3300046665 Bacteria 7070
205 Ga0495669_0274023 3300046684 Bacteria 811
206 Ga0495613_0258909 3300046689 Bacteria 1213
207 Ga0495670_0002073 3300046691 Bacteria 9883
208 Ga0495671_0000002 3300046692 Bacteria 1136189
209 Ga0495671_0001730 3300046692 Bacteria 14173
210 Ga0495671_0002756 3300046692 Bacteria 11002
211 Ga0495671_0006469 3300046692 Bacteria 6768
212 Ga0495671_0010382 3300046692 Bacteria 5161
213 Ga0495671_0056269 3300046692 Bacteria 1947
214 Ga0495671_0270316 3300046692 Bacteria 820
215 Ga0495671_0285149 3300046692 Bacteria 795
216 Ga0495649_0008868 3300046694 Bacteria 6021
217 Ga0495649_0009203 3300046694 Bacteria 5887
218 Ga0495649_0021974 3300046694 Bacteria 3573
219 Ga0495649_0025536 3300046694 Bacteria 3290
220 Ga0495649_0030618 3300046694 Bacteria 2971
221 Ga0495649_0176074 3300046694 Bacteria 1118
222 Ga0495589_0151757 3300046794 Bacteria 1106
223 Ga0495660_0033578 3300046810 Bacteria 2876
224 Ga0495674_0115388 3300047319 Bacteria 2273
225 Ga0495672_0000347 3300047320 Bacteria 59349
226 Ga0495672_0053541 3300047320 Bacteria 2364
227 Ga0495683_0008232 3300047323 Bacteria 5591
228 Ga0495687_000044 3300047443 Bacteria 215400
229 Ga0495679_033886 3300047446 Bacteria 1628
230 Ga0495673_0000026 3300047469 Bacteria 476378
231 Ga0495673_0000028 3300047469 Bacteria 473418
232 Ga0495681_0094399 3300047470 Bacteria 1316
233 Ga0495686_0000072 3300047472 Bacteria 216371
234 Ga0495686_0160080 3300047472 Bacteria 1316
235 Ga0496113_0087604 3300048916 Bacteria 2394
236 Ga0496116_0004283 3300048919 Bacteria 13682
237 Ga0496116_0060202 3300048919 Bacteria 2464
238 Ga0496116_0263797 3300048919 Bacteria 847
239 Ga0496119_0033175 3300048922 Bacteria 3428
240 Ga0496121_0003458 3300048924 Bacteria 22514
241 Ga0496121_0129275 3300048924 Bacteria 1894
242 Ga0496122_0001123 3300048925 Bacteria 46098
243 Ga0496123_0000957 3300048926 Bacteria 44790
244 Ga0496123_0112156 3300048926 Bacteria 1556
245 Ga0496124_0308592 3300048927 Bacteria 1139
246 Ga0496125_0218068 3300048928 Bacteria 1232
247 Ga0495678_000502 3300049459 Bacteria 38555
248 Ga0495678_081271 3300049459 Bacteria 1163
249 Ga0501031_0484316 3300049568 Bacteria 798
250 Ga0501033_0099896 3300049570 Bacteria 2118
251 Ga0501034_0141709 3300049571 Bacteria 2383
252 Ga0501047_0260013 3300049581 Bacteria 1584
253 Ga0501083_0085260 3300049744 Bacteria 2090
254 Ga0501045_0616128 3300049824 Bacteria 803
255 nmdc:mga03n38_285955_c1 3300050490 Bacteria 881
256 nmdc:mga0k408_17569_c1 3300050493 Bacteria 3987
257 nmdc:mga06z11_446636_c1 3300050494 Bacteria 781
258 nmdc:mga07m45_314_c1 3300050496 Bacteria 19551
259 nmdc:mga07m45_419764_c1 3300050496 Bacteria 776
260 nmdc:mga05p37_1439_c1 3300050507 Bacteria 27650
261 nmdc:mga09592_1904_c1 3300050508 Bacteria 16776
262 nmdc:mga0qj67_37012_c1 3300050509 Bacteria 3821
263 nmdc:mga0qj67_5224_c1 3300050509 Bacteria 9471
264 nmdc:mga06r32_1004_c1 3300050510 Bacteria 25303
265 nmdc:mga06r32_11652_c1 3300050510 Bacteria 7915
266 nmdc:mga08y16_399832_c1 3300050511 Bacteria 1406
267 Ga0500578_0246105 3300053086 Bacteria 1079
268 Ga0500651_0000205 3300053093 Bacteria 37424
269 Ga0500566_0000009 3300053094 Bacteria 131668
270 Ga0500640_002052 3300053095 Bacteria 6493
271 Ga0500572_000142 3300053111 Bacteria 24469
272 Ga0500591_028139 3300053115 Bacteria 2722
273 Ga0500594_0101568 3300053118 Bacteria 885
274 Ga0500608_085447 3300053122 Bacteria 1482
275 Ga0500614_030319 3300053123 Bacteria 1318
276 Ga0500618_035423 3300053125 Bacteria 1159
277 Ga0500618_055077 3300053125 Bacteria 897
278 Ga0500559_0000488 3300053136 Bacteria 27939
279 Ga0500586_000401 3300053145 Bacteria 8667
280 Ga0500590_004472 3300053148 Bacteria 6600
281 Ga0500603_000016 3300053150 Bacteria 56563
282 Ga0500616_0028921 3300053153 Bacteria 3052
283 Ga0500630_000034 3300053159 Bacteria 38552
284 Ga0500638_030506 3300053162 Bacteria 2596
285 Ga0500639_000017 3300053163 Bacteria 114464
286 Ga0500596_000747 3300053735 Bacteria 6392
287 Ga0501082_0070187 3300060353 Bacteria 3017

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10150555 rootL2_101505551 154
2 3300003771 Ga0055526_1000080 Ga0055526_100008055 154
3 3300003856 Ga0058692_1014673 Ga0058692_10146731 154
4 3300005435 Ga0070714_100622835 Ga0070714_1006228351 154
5 3300005436 Ga0070713_100683096 Ga0070713_1006830962 154
6 3300005459 Ga0068867_100002213 Ga0068867_1000022134 154
7 3300005459 Ga0068867_102045073 Ga0068867_1020450731 154
8 3300005548 Ga0070665_100560939 Ga0070665_1005609392 154
9 3300005563 Ga0068855_100439975 Ga0068855_1004399752 154
10 3300005563 Ga0068855_100546034 Ga0068855_1005460342 154
11 3300005614 Ga0068856_100648472 Ga0068856_1006484722 154
12 3300005617 Ga0068859_100001416 Ga0068859_10000141638 154
13 3300005618 Ga0068864_101483218 Ga0068864_1014832181 154
14 3300005844 Ga0068862_100080408 Ga0068862_1000804083 154
15 3300005983 Ga0081540_1000213 Ga0081540_100021339 154
16 3300006048 Ga0075363_100822034 Ga0075363_1008220341 154
17 3300006178 Ga0075367_10067915 Ga0075367_100679153 154
18 3300006353 Ga0075370_10198850 Ga0075370_101988502 154
19 3300006846 Ga0075430_100000353 Ga0075430_10000035317 154
20 3300006846 Ga0075430_100028768 Ga0075430_1000287686 154
21 3300006847 Ga0075431_100002478 Ga0075431_10000247810 154
22 3300006847 Ga0075431_100049025 Ga0075431_1000490257 154
23 3300006880 Ga0075429_100024821 Ga0075429_1000248212 154
24 3300006881 Ga0068865_100699573 Ga0068865_1006995732 154
25 3300006931 Ga0097620_100001416 Ga0097620_1000014165 154
26 3300009093 Ga0105240_10067927 Ga0105240_100679273 154
27 3300009093 Ga0105240_10370003 Ga0105240_103700032 154
28 3300009094 Ga0111539_10530014 Ga0111539_105300142 154
29 3300009147 Ga0114129_10069857 Ga0114129_100698572 154
30 3300009148 Ga0105243_10594472 Ga0105243_105944721 154
31 3300009174 Ga0105241_11121129 Ga0105241_111211291 154
32 3300009177 Ga0105248_10179259 Ga0105248_101792593 154
33 3300009545 Ga0105237_10506230 Ga0105237_105062302 154
34 3300009551 Ga0105238_10058212 Ga0105238_100582121 154
35 3300009553 Ga0105249_11780852 Ga0105249_117808521 154
36 3300010375 Ga0105239_10145074 Ga0105239_101450743 154
37 3300010375 Ga0105239_11424384 Ga0105239_114243842 154
38 3300013296 Ga0157374_10108403 Ga0157374_101084032 154
39 3300014325 Ga0163163_12288157 Ga0163163_122881572 154
40 3300014497 Ga0182008_10232944 Ga0182008_102329442 154
41 3300017792 Ga0163161_10174490 Ga0163161_101744902 154
42 3300021384 Ga0213876_10048815 Ga0213876_100488154 154
43 3300025295 Ga0209564_1000007 Ga0209564_1000007748 154
44 3300025913 Ga0207695_10040604 Ga0207695_100406044 154
45 3300025913 Ga0207695_10078085 Ga0207695_100780855 154
46 3300025915 Ga0207693_10644044 Ga0207693_106440441 154
47 3300025924 Ga0207694_10025556 Ga0207694_100255564 154
48 3300025938 Ga0207704_10538496 Ga0207704_105384962 154
49 3300025939 Ga0207665_10045236 Ga0207665_100452362 154
50 3300025941 Ga0207711_10035303 Ga0207711_100353035 154
51 3300025949 Ga0207667_10211204 Ga0207667_102112043 154
52 3300025949 Ga0207667_10947481 Ga0207667_109474812 154
53 3300025986 Ga0207658_10935221 Ga0207658_109352212 154
54 3300026078 Ga0207702_10306289 Ga0207702_103062892 154
55 3300026089 Ga0207648_10002863 Ga0207648_1000286317 154
56 3300026095 Ga0207676_10996153 Ga0207676_109961532 154
57 3300026118 Ga0207675_100005522 Ga0207675_1000055225 154
58 3300027312 Ga0209371_1000601 Ga0209371_100060116 154
59 3300027312 Ga0209371_1001587 Ga0209371_10015877 154
60 3300028379 Ga0268266_10182308 Ga0268266_101823083 154
61 3300028380 Ga0268265_10004528 Ga0268265_100045286 154
62 3300028800 Ga0265338_10565004 Ga0265338_105650042 154
63 3300030500 Ga0268256_1000517 Ga0268256_100051716 154
64 3300030500 Ga0268256_1001369 Ga0268256_10013699 154
65 3300031456 Ga0307513_10123533 Ga0307513_101235332 154
66 3300031730 Ga0307516_10002678 Ga0307516_1000267811 154
67 3300031901 Ga0307406_10064883 Ga0307406_100648832 154
68 3300031911 Ga0307412_10117090 Ga0307412_101170902 154
69 3300034818 Ga0373950_0032451 Ga0373950_0032451_210_680 154
70 3300035170 Ga0373943_0003331 Ga0373943_0003331_647_1117 154
71 3300035171 Ga0373946_0230012 Ga0373946_0230012_267_737 154
72 3300035692 Ga0373935_0027416 Ga0373935_0027416_306_776 154
73 3300035725 Ga0373947_0007953 Ga0373947_0007953_4541_5011 154
74 3300037471 Ga0395905_0112424 Ga0395905_0112424_251_721 154
75 3300039437 Ga0436365_0515209 Ga0436365_0515209_2095_2559 154
76 3300039437 Ga0436365_0841126 Ga0436365_0841126_15_479 154
77 3300041452 Ga0451793_1619994 Ga0451793_1619994_179_643 154
78 3300041462 Ga0451806_521278 Ga0451806_521278_175_639 154
79 3300042156 Ga0439446_0030505 Ga0439446_0030505_44_508 154
80 3300044712 Ga0453684_0799415 Ga0453684_0799415_294_761 154
81 3300045051 Ga0451576_0464910 Ga0451576_0464910_278_745 154
82 3300046459 Ga0495629_0153531 Ga0495629_0153531_536_1006 154
83 3300046460 Ga0495638_0123739 Ga0495638_0123739_927_1394 154
84 3300046460 Ga0495638_0323782 Ga0495638_0323782_12_524 154
85 3300046471 Ga0495650_0000086 Ga0495650_0000086_178253_178765 154
86 3300046471 Ga0495650_0034562 Ga0495650_0034562_901_1413 154
87 3300046471 Ga0495650_0214437 Ga0495650_0214437_125_589 154
88 3300046474 Ga0495605_0000022 Ga0495605_0000022_134010_134477 154
89 3300046475 Ga0495639_0215255 Ga0495639_0215255_423_893 154
90 3300046492 Ga0495585_0000350 Ga0495585_0000350_7814_8326 154
91 3300046507 Ga0495606_0003096 Ga0495606_0003096_5256_5723 154
92 3300046507 Ga0495606_0004900 Ga0495606_0004900_10969_11436 154
93 3300046512 Ga0495610_0000010 Ga0495610_0000010_277994_278506 154
94 3300046512 Ga0495610_0001957 Ga0495610_0001957_15616_16083 154
95 3300046512 Ga0495610_0151866 Ga0495610_0151866_56_532 154
96 3300046517 Ga0495630_0188982 Ga0495630_0188982_358_828 154
97 3300046519 Ga0495632_0001040 Ga0495632_0001040_2554_3018 154
98 3300046522 Ga0495643_0000049 Ga0495643_0000049_65396_65872 154
99 3300046522 Ga0495643_0000137 Ga0495643_0000137_32812_33279 154
100 3300046524 Ga0495648_0006273 Ga0495648_0006273_8678_9145 154
101 3300046524 Ga0495648_0010663 Ga0495648_0010663_3692_4156 154
102 3300046524 Ga0495648_0035266 Ga0495648_0035266_245_757 154
103 3300046524 Ga0495648_0065268 Ga0495648_0065268_303_770 154
104 3300046530 Ga0495654_0010709 Ga0495654_0010709_946_1458 154
105 3300046533 Ga0495640_0114826 Ga0495640_0114826_157_627 154
106 3300046538 Ga0495609_0023250 Ga0495609_0023250_1122_1589 154
107 3300046542 Ga0495597_0000276 Ga0495597_0000276_17981_18448 154
108 3300046558 Ga0495633_0000220 Ga0495633_0000220_44004_44471 154
109 3300046558 Ga0495633_0002754 Ga0495633_0002754_6755_7222 154
110 3300046558 Ga0495633_0029527 Ga0495633_0029527_1447_1959 154
111 3300046616 Ga0495668_0000004 Ga0495668_0000004_235063_235539 154
112 3300046616 Ga0495668_0003088 Ga0495668_0003088_8023_8535 154
113 3300046660 Ga0495625_0000047 Ga0495625_0000047_63124_63594 154
114 3300046660 Ga0495625_0016170 Ga0495625_0016170_2625_3092 154
115 3300046660 Ga0495625_0017422 Ga0495625_0017422_2186_2662 154
116 3300046660 Ga0495625_0078895 Ga0495625_0078895_361_873 154
117 3300046660 Ga0495625_0133221 Ga0495625_0133221_837_1304 154
118 3300046689 Ga0495613_0258909 Ga0495613_0258909_202_672 154
119 3300046691 Ga0495670_0002073 Ga0495670_0002073_1793_2263 154
120 3300046692 Ga0495671_0000002 Ga0495671_0000002_326196_326663 154
121 3300046692 Ga0495671_0001730 Ga0495671_0001730_9875_10351 154
122 3300046692 Ga0495671_0056269 Ga0495671_0056269_442_909 154
123 3300046692 Ga0495671_0285149 Ga0495671_0285149_274_741 154
124 3300046694 Ga0495649_0009203 Ga0495649_0009203_2488_2955 154
125 3300046694 Ga0495649_0021974 Ga0495649_0021974_414_881 154
126 3300046694 Ga0495649_0025536 Ga0495649_0025536_129_605 154
127 3300046694 Ga0495649_0030618 Ga0495649_0030618_129_605 154
128 3300046694 Ga0495649_0176074 Ga0495649_0176074_482_952 154
129 3300046810 Ga0495660_0033578 Ga0495660_0033578_2069_2560 154
130 3300047319 Ga0495674_0115388 Ga0495674_0115388_1030_1500 154
131 3300047320 Ga0495672_0000347 Ga0495672_0000347_25146_25613 154
132 3300047323 Ga0495683_0008232 Ga0495683_0008232_4316_4828 154
133 3300047443 Ga0495687_000044 Ga0495687_000044_82200_82670 154
134 3300047446 Ga0495679_033886 Ga0495679_033886_788_1300 154
135 3300047469 Ga0495673_0000026 Ga0495673_0000026_220773_221285 154
136 3300047469 Ga0495673_0000028 Ga0495673_0000028_169530_169997 154
137 3300047470 Ga0495681_0094399 Ga0495681_0094399_775_1251 154
138 3300047472 Ga0495686_0000072 Ga0495686_0000072_21116_21694 154
139 3300047472 Ga0495686_0160080 Ga0495686_0160080_11_523 154
140 3300048919 Ga0496116_0060202 Ga0496116_0060202_931_1395 154
141 3300048919 Ga0496116_0263797 Ga0496116_0263797_18_482 154
142 3300048926 Ga0496123_0112156 Ga0496123_0112156_183_647 154
143 3300048928 Ga0496125_0218068 Ga0496125_0218068_238_702 154
144 3300049459 Ga0495678_000502 Ga0495678_000502_1729_2196 154
145 3300049568 Ga0501031_0484316 Ga0501031_0484316_304_768 154
146 3300049570 Ga0501033_0099896 Ga0501033_0099896_715_1179 154
147 3300049581 Ga0501047_0260013 Ga0501047_0260013_15_479 154
148 3300050490 nmdc:mga03n38_285955_c1 nmdc:mga03n38_285955_c1_179_643 154
149 3300050494 nmdc:mga06z11_446636_c1 nmdc:mga06z11_446636_c1_275_739 154
150 3300050496 nmdc:mga07m45_419764_c1 nmdc:mga07m45_419764_c1_240_704 154
151 3300050507 nmdc:mga05p37_1439_c1 nmdc:mga05p37_1439_c1_27043_27507 154
152 3300050508 nmdc:mga09592_1904_c1 nmdc:mga09592_1904_c1_7729_8193 154
153 3300050509 nmdc:mga0qj67_37012_c1 nmdc:mga0qj67_37012_c1_1309_1773 154
154 3300050509 nmdc:mga0qj67_5224_c1 nmdc:mga0qj67_5224_c1_6673_7137 154
155 3300050510 nmdc:mga06r32_1004_c1 nmdc:mga06r32_1004_c1_9263_9727 154
156 3300050510 nmdc:mga06r32_11652_c1 nmdc:mga06r32_11652_c1_1016_1480 154
157 3300050511 nmdc:mga08y16_399832_c1 nmdc:mga08y16_399832_c1_741_1205 154
158 3300053086 Ga0500578_0246105 Ga0500578_0246105_543_1007 154
159 3300053118 Ga0500594_0101568 Ga0500594_0101568_72_539 154
160 3300053125 Ga0500618_035423 Ga0500618_035423_654_1118 154
161 3300053145 Ga0500586_000401 Ga0500586_000401_1467_1934 154
162 iso_pu_bacteria 2738543020 2739287625 154
163 iso_pu_bacteria 2738543021 2739292938 154
164 3300005262 Ga0065165_1000074 Ga0065165_100007493 155
165 3300006195 Ga0075366_10001457 Ga0075366_100014575 155
166 3300006353 Ga0075370_10000072 Ga0075370_1000007228 155
167 3300026041 Ga0207639_10792655 Ga0207639_107926551 155
168 3300031507 Ga0307509_10020914 Ga0307509_100209149 155
169 3300031507 Ga0307509_10306460 Ga0307509_103064602 155
170 3300031616 Ga0307508_10068078 Ga0307508_100680781 155
171 3300031730 Ga0307516_10184666 Ga0307516_101846662 155
172 3300042435 Ga0439434_0217186 Ga0439434_0217186_70_537 155
173 3300042876 Ga0451577_0516337 Ga0451577_0516337_396_863 155
174 3300044656 Ga0466969_0008985 Ga0466969_0008985_2441_2908 155
175 3300044693 Ga0466961_0084093 Ga0466961_0084093_68_535 155
176 3300044706 Ga0466964_0647991 Ga0466964_0647991_40_507 155
177 3300044712 Ga0453684_0087681 Ga0453684_0087681_1866_2333 155
178 3300044735 Ga0466968_0029903 Ga0466968_0029903_1675_2142 155
179 3300045051 Ga0451576_0043166 Ga0451576_0043166_3572_4039 155
180 3300046524 Ga0495648_0383303 Ga0495648_0383303_139_606 155
181 3300050493 nmdc:mga0k408_17569_c1 nmdc:mga0k408_17569_c1_2768_3235 155
182 3300050496 nmdc:mga07m45_314_c1 nmdc:mga07m45_314_c1_11594_12061 155
183 3300053125 Ga0500618_055077 Ga0500618_055077_337_804 155
184 3300053148 Ga0500590_004472 Ga0500590_004472_4160_4627 155
185 3300025915 Ga0207693_10032077 Ga0207693_100320774 156
186 3300025928 Ga0207700_10063832 Ga0207700_100638323 156
187 3300030521 Ga0307511_10138963 Ga0307511_101389632 156
188 3300031240 Ga0265320_10342899 Ga0265320_103428991 156
189 3300031507 Ga0307509_10007259 Ga0307509_100072597 156
190 3300031595 Ga0265313_10144014 Ga0265313_101440141 156
191 3300046520 Ga0495637_0126462 Ga0495637_0126462_26_496 156
192 3300048922 Ga0496119_0033175 Ga0496119_0033175_2822_3295 156
193 3300049571 Ga0501034_0141709 Ga0501034_0141709_1025_1495 156
194 3300053093 Ga0500651_0000205 Ga0500651_0000205_30318_30788 156
195 3300053094 Ga0500566_0000009 Ga0500566_0000009_90714_91187 156
196 3300053095 Ga0500640_002052 Ga0500640_002052_2808_3281 156
197 3300053111 Ga0500572_000142 Ga0500572_000142_19268_19741 156
198 3300053115 Ga0500591_028139 Ga0500591_028139_1409_1882 156
199 3300053122 Ga0500608_085447 Ga0500608_085447_651_1124 156
200 3300053123 Ga0500614_030319 Ga0500614_030319_590_1063 156
201 3300053136 Ga0500559_0000488 Ga0500559_0000488_21804_22277 156
202 3300053150 Ga0500603_000016 Ga0500603_000016_40945_41418 156
203 3300053153 Ga0500616_0028921 Ga0500616_0028921_1135_1605 156
204 3300053159 Ga0500630_000034 Ga0500630_000034_29456_29929 156
205 3300053162 Ga0500638_030506 Ga0500638_030506_63_536 156
206 3300053163 Ga0500639_000017 Ga0500639_000017_43235_43708 156
207 3300053735 Ga0500596_000747 Ga0500596_000747_3737_4210 156
208 3300060353 Ga0501082_0070187 Ga0501082_0070187_1708_2178 156
209 3300002773 JGI25152J39213_1000969 JGI25152J39213_10009694 157
210 3300003187 JGI25151J46595_10002492 JGI25151J46595_100024927 157
211 3300003763 Ga0055529_1000481 Ga0055529_10004818 157
212 3300003792 Ga0055540_1035850 Ga0055540_10358501 157
213 3300005444 Ga0070694_100013134 Ga0070694_1000131347 157
214 3300005545 Ga0070695_100013116 Ga0070695_1000131167 157
215 3300006175 Ga0070712_101278793 Ga0070712_1012787931 157
216 3300006948 Ga0099826_10000011 Ga0099826_1000001157 157
217 3300009036 Ga0105244_10001680 Ga0105244_1000168012 157
218 3300009177 Ga0105248_10150135 Ga0105248_101501354 157
219 3300013100 Ga0157373_11319720 Ga0157373_113197201 157
220 3300013102 Ga0157371_10257631 Ga0157371_102576312 157
221 3300013307 Ga0157372_10201448 Ga0157372_102014482 157
222 3300014325 Ga0163163_10677520 Ga0163163_106775202 157
223 3300021321 Ga0214542_1024039 Ga0214542_10240395 157
224 3300021327 Ga0214543_1016151 Ga0214543_10161515 157
225 3300021384 Ga0213876_10001291 Ga0213876_1000129112 157
226 3300025233 Ga0209437_114966 Ga0209437_1149662 157
227 3300025258 Ga0209129_1000070 Ga0209129_100007086 157
228 3300025272 Ga0209455_1000026 Ga0209455_1000026546 157
229 3300025294 Ga0209025_1000175 Ga0209025_100017584 157
230 3300025303 Ga0209051_1019056 Ga0209051_10190563 157
231 3300025728 Ga0207655_1003435 Ga0207655_100343510 157
232 3300025728 Ga0207655_1027955 Ga0207655_10279553 157
233 3300025735 Ga0207713_1169585 Ga0207713_11695851 157
234 3300025735 Ga0207713_1220038 Ga0207713_12200381 157
235 3300025941 Ga0207711_10118002 Ga0207711_101180024 157
236 3300027111 Ga0209281_1011961 Ga0209281_10119611 157
237 3300027364 Ga0209967_1008959 Ga0209967_10089592 157
238 3300027424 Ga0209984_1000733 Ga0209984_10007331 157
239 3300027462 Ga0210000_1001213 Ga0210000_10012134 157
240 3300027471 Ga0209995_1002359 Ga0209995_10023592 157
241 3300027526 Ga0209968_1015899 Ga0209968_10158992 157
242 3300027543 Ga0209999_1001087 Ga0209999_10010876 157
243 3300027552 Ga0209982_1001568 Ga0209982_10015686 157
244 3300027614 Ga0209970_1006252 Ga0209970_10062522 157
245 3300027665 Ga0209983_1000679 Ga0209983_10006795 157
246 3300027666 Ga0209282_1000056 Ga0209282_100005657 157
247 3300027682 Ga0209971_1000587 Ga0209971_10005872 157
248 3300027695 Ga0209966_1000098 Ga0209966_100009827 157
249 3300027876 Ga0209974_10004183 Ga0209974_100041836 157
250 3300039437 Ga0436365_1820187 Ga0436365_1820187_11065_11544 157
251 3300039447 Ga0436361_1118989 Ga0436361_1118989_18_500 157
252 3300041443 Ga0451789_0287469 Ga0451789_0287469_346_819 157
253 3300045051 Ga0451576_0208976 Ga0451576_0208976_337_837 157
254 3300046452 Ga0495617_051271 Ga0495617_051271_658_1131 157
255 3300046471 Ga0495650_0017754 Ga0495650_0017754_1326_1799 157
256 3300046471 Ga0495650_0034656 Ga0495650_0034656_1343_1816 157
257 3300046474 Ga0495605_0002358 Ga0495605_0002358_11217_11696 157
258 3300046491 Ga0495584_0345843 Ga0495584_0345843_259_738 157
259 3300046500 Ga0495596_0000151 Ga0495596_0000151_31301_31780 157
260 3300046501 Ga0495607_0000725 Ga0495607_0000725_18922_19401 157
261 3300046512 Ga0495610_0000328 Ga0495610_0000328_17647_18126 157
262 3300046513 Ga0495616_0000501 Ga0495616_0000501_16072_16551 157
263 3300046518 Ga0495631_0348215 Ga0495631_0348215_101_580 157
264 3300046522 Ga0495643_0196074 Ga0495643_0196074_394_873 157
265 3300046524 Ga0495648_0047268 Ga0495648_0047268_875_1354 157
266 3300046529 Ga0495652_0696765 Ga0495652_0696765_49_522 157
267 3300046538 Ga0495609_0001067 Ga0495609_0001067_8661_9140 157
268 3300046542 Ga0495597_0138961 Ga0495597_0138961_282_761 157
269 3300046543 Ga0495645_0258825 Ga0495645_0258825_99_572 157
270 3300046615 Ga0495656_0105425 Ga0495656_0105425_76_555 157
271 3300046665 Ga0495661_0008567 Ga0495661_0008567_5027_5506 157
272 3300046684 Ga0495669_0274023 Ga0495669_0274023_30_509 157
273 3300046692 Ga0495671_0002756 Ga0495671_0002756_9982_10461 157
274 3300046692 Ga0495671_0006469 Ga0495671_0006469_3903_4376 157
275 3300046692 Ga0495671_0010382 Ga0495671_0010382_4422_4895 157
276 3300046692 Ga0495671_0270316 Ga0495671_0270316_305_778 157
277 3300046694 Ga0495649_0008868 Ga0495649_0008868_5027_5506 157
278 3300046794 Ga0495589_0151757 Ga0495589_0151757_598_1077 157
279 3300047320 Ga0495672_0053541 Ga0495672_0053541_949_1428 157
280 3300048916 Ga0496113_0087604 Ga0496113_0087604_148_621 157
281 3300048919 Ga0496116_0004283 Ga0496116_0004283_11864_12343 157
282 3300048924 Ga0496121_0003458 Ga0496121_0003458_32_511 157
283 3300048924 Ga0496121_0129275 Ga0496121_0129275_62_538 157
284 3300048925 Ga0496122_0001123 Ga0496122_0001123_29960_30439 157
285 3300048926 Ga0496123_0000957 Ga0496123_0000957_14775_15254 157
286 3300048927 Ga0496124_0308592 Ga0496124_0308592_455_928 157
287 3300049459 Ga0495678_081271 Ga0495678_081271_43_516 157
288 3300049744 Ga0501083_0085260 Ga0501083_0085260_264_743 157
289 3300049824 Ga0501045_0616128 Ga0501045_0616128_62_544 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07080

DUF1348

Protein of unknown function (DUF1348)

45

174

1

PF12680

SnoaL_2

SnoaL-like domain

56

157

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.999 5 153
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.9665 5 153
3ebt-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (bpss0132) from burkholderia pseudomallei k96243 at 1.30 a resolution 0.8821 17 127
1cqs-assembly1.cif.gz_B crystal structure of d103e mutant with equilenineof ksi in pseudomonas putida 0.8752 13 124
1dmm-assembly1.cif.gz_A-2 crystal structures of mutant enzymes y57f of ketosteroid isomerase from pseudomonas putida biotype b 0.8751 12 124
ID Description Score Start End Superfamily
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9989 13 153 3.10.450.50
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9847 13 153 3.10.450.50
af_A0A1D8PLG7_39_140_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.89 40 127 3.10.450.50
3ebtA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8712 17 127 3.10.450.50
4u13B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8606 21 125 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A176FRT9-F1-model_v4 DUF4440 domain-containing protein 1.005 5 122
AF-A0A529HV08-F1-model_v4 deleted 1.005 6 93
AF-A0A1M5PD77-F1-model_v4 DUF4440 domain-containing protein 1.004 9 136
AF-A0A436F433-F1-model_v4 DUF1348 family protein 1.004 6 106
AF-A0A533J3Y5-F1-model_v4 deleted 1.004 6 104

Feature Viewer

pLDDT pTM Quality
96.95 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map