F389389
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 289 | 213 | 287 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0000072|Ga0495686_0000072_21116_21694 |
| Length | 192 |
| Sequence | MPAGPDPTRHDRVGALRSRELYIRPIGKRDSEREMTIEAERPPLPPFTLETAVQKVRLAEDGWNGRDPERVSLAYTVDCHWRNRAEFIEGRAAIQAFLARKWARELDYRLIKELWAFTDDRIAVRFAYEWRDDSGQWYRSYGNENWEFAANGLMRRRIASINDAPIAGADRKFHWPQGRRPDDHPGLSEFGF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 2 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 15 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 18 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 19 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 20 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 21 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 22 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 23 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 24 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 26 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 27 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 28 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 29 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 30 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 31 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 32 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 34 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 51 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 53 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 54 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 55 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 57 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 60 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 78 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 89 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 96 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 97 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 98 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 99 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 100 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 101 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 102 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 103 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 104 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 105 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 106 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 107 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 108 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 109 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 110 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 111 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 112 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 113 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 114 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 115 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 116 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 117 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 118 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 119 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 120 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 121 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 122 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 123 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 124 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 125 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 171 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 172 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 173 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 174 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 175 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 176 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 177 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 178 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 186 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 187 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 188 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 189 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 195 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 196 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 197 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 198 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 199 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 200 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 201 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 202 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 203 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 204 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 205 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 206 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 207 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 208 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 209 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 210 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 211 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 212 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 213 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.31 |
| Metatranscriptomes | 0 |
| Isolates | 0.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.53 |
| Nodule | 1.73 |
| Rhizoplane | 1.38 |
| Rhizosphere | 73.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1000969 | 3300002773 | Bacteria | 13988 |
| 2 | JGI25151J46595_10002492 | 3300003187 | Bacteria | 11003 |
| 3 | rootL2_10150555 | 3300003322 | Bacteria | 1537 |
| 4 | Ga0055529_1000481 | 3300003763 | Bacteria | 37462 |
| 5 | Ga0055526_1000080 | 3300003771 | Bacteria | 87500 |
| 6 | Ga0055540_1035850 | 3300003792 | Bacteria | 1106 |
| 7 | Ga0058692_1014673 | 3300003856 | Bacteria | 1788 |
| 8 | Ga0065165_1000074 | 3300005262 | Bacteria | 164454 |
| 9 | Ga0070714_100622835 | 3300005435 | Bacteria | 1037 |
| 10 | Ga0070713_100683096 | 3300005436 | Bacteria | 979 |
| 11 | Ga0070694_100013134 | 3300005444 | Bacteria | 5167 |
| 12 | Ga0068867_100002213 | 3300005459 | Bacteria | 13647 |
| 13 | Ga0068867_102045073 | 3300005459 | Bacteria | 542 |
| 14 | Ga0070695_100013116 | 3300005545 | Bacteria | 4980 |
| 15 | Ga0070665_100560939 | 3300005548 | Bacteria | 1154 |
| 16 | Ga0068855_100439975 | 3300005563 | Bacteria | 1424 |
| 17 | Ga0068855_100546034 | 3300005563 | Bacteria | 1255 |
| 18 | Ga0068856_100648472 | 3300005614 | Bacteria | 1076 |
| 19 | Ga0068859_100001416 | 3300005617 | Bacteria | 24328 |
| 20 | Ga0068864_101483218 | 3300005618 | Bacteria | 681 |
| 21 | Ga0068862_100080408 | 3300005844 | Bacteria | 2826 |
| 22 | Ga0081540_1000213 | 3300005983 | Bacteria | 61164 |
| 23 | Ga0075363_100822034 | 3300006048 | Bacteria | 566 |
| 24 | Ga0070712_101278793 | 3300006175 | Bacteria | 639 |
| 25 | Ga0075367_10067915 | 3300006178 | Bacteria | 2138 |
| 26 | Ga0075366_10001457 | 3300006195 | Bacteria | 11781 |
| 27 | Ga0075370_10000072 | 3300006353 | Bacteria | 31056 |
| 28 | Ga0075370_10198850 | 3300006353 | Bacteria | 1182 |
| 29 | Ga0075430_100000353 | 3300006846 | Bacteria | 33394 |
| 30 | Ga0075430_100028768 | 3300006846 | Bacteria | 4720 |
| 31 | Ga0075431_100002478 | 3300006847 | Bacteria | 17790 |
| 32 | Ga0075431_100049025 | 3300006847 | Bacteria | 4356 |
| 33 | Ga0075429_100024821 | 3300006880 | Bacteria | 5203 |
| 34 | Ga0068865_100699573 | 3300006881 | Bacteria | 866 |
| 35 | Ga0097620_100001416 | 3300006931 | Bacteria | 24328 |
| 36 | Ga0099826_10000011 | 3300006948 | Bacteria | 287659 |
| 37 | Ga0105244_10001680 | 3300009036 | Bacteria | 17493 |
| 38 | Ga0105240_10067927 | 3300009093 | Bacteria | 4417 |
| 39 | Ga0105240_10370003 | 3300009093 | Bacteria | 1621 |
| 40 | Ga0111539_10530014 | 3300009094 | Bacteria | 1372 |
| 41 | Ga0114129_10069857 | 3300009147 | Bacteria | 4897 |
| 42 | Ga0105243_10594472 | 3300009148 | Bacteria | 1064 |
| 43 | Ga0105241_11121129 | 3300009174 | Bacteria | 742 |
| 44 | Ga0105248_10150135 | 3300009177 | Bacteria | 2629 |
| 45 | Ga0105248_10179259 | 3300009177 | Bacteria | 2388 |
| 46 | Ga0105237_10506230 | 3300009545 | Bacteria | 1214 |
| 47 | Ga0105238_10058212 | 3300009551 | Bacteria | 3874 |
| 48 | Ga0105249_11780852 | 3300009553 | Bacteria | 688 |
| 49 | Ga0105239_10145074 | 3300010375 | Bacteria | 2647 |
| 50 | Ga0105239_11424384 | 3300010375 | Bacteria | 800 |
| 51 | Ga0157373_11319720 | 3300013100 | Bacteria | 547 |
| 52 | Ga0157371_10257631 | 3300013102 | Bacteria | 1257 |
| 53 | Ga0157374_10108403 | 3300013296 | Bacteria | 2669 |
| 54 | Ga0157372_10201448 | 3300013307 | Bacteria | 2306 |
| 55 | Ga0163163_10677520 | 3300014325 | Bacteria | 1095 |
| 56 | Ga0163163_12288157 | 3300014325 | Bacteria | 599 |
| 57 | Ga0182008_10232944 | 3300014497 | Bacteria | 945 |
| 58 | Ga0163161_10174490 | 3300017792 | Bacteria | 1645 |
| 59 | Ga0214542_1024039 | 3300021321 | Bacteria | 3495 |
| 60 | Ga0214543_1016151 | 3300021327 | Bacteria | 7935 |
| 61 | Ga0213876_10001291 | 3300021384 | Bacteria | 15786 |
| 62 | Ga0213876_10048815 | 3300021384 | Bacteria | 2235 |
| 63 | Ga0209437_114966 | 3300025233 | Bacteria | 1070 |
| 64 | Ga0209129_1000070 | 3300025258 | Bacteria | 212476 |
| 65 | Ga0209455_1000026 | 3300025272 | Bacteria | 653778 |
| 66 | Ga0209025_1000175 | 3300025294 | Bacteria | 158379 |
| 67 | Ga0209564_1000007 | 3300025295 | Bacteria | 1028582 |
| 68 | Ga0209051_1019056 | 3300025303 | Bacteria | 3010 |
| 69 | Ga0207655_1003435 | 3300025728 | Bacteria | 11789 |
| 70 | Ga0207655_1027955 | 3300025728 | Bacteria | 2672 |
| 71 | Ga0207713_1169585 | 3300025735 | Bacteria | 689 |
| 72 | Ga0207713_1220038 | 3300025735 | Bacteria | 573 |
| 73 | Ga0207695_10040604 | 3300025913 | Bacteria | 4986 |
| 74 | Ga0207695_10078085 | 3300025913 | Bacteria | 3360 |
| 75 | Ga0207693_10032077 | 3300025915 | Bacteria | 4147 |
| 76 | Ga0207693_10644044 | 3300025915 | Bacteria | 823 |
| 77 | Ga0207694_10025556 | 3300025924 | Bacteria | 4488 |
| 78 | Ga0207700_10063832 | 3300025928 | Bacteria | 2803 |
| 79 | Ga0207704_10538496 | 3300025938 | Bacteria | 947 |
| 80 | Ga0207665_10045236 | 3300025939 | Bacteria | 2947 |
| 81 | Ga0207711_10035303 | 3300025941 | Bacteria | 4238 |
| 82 | Ga0207711_10118002 | 3300025941 | Bacteria | 2367 |
| 83 | Ga0207667_10211204 | 3300025949 | Bacteria | 1989 |
| 84 | Ga0207667_10947481 | 3300025949 | Bacteria | 850 |
| 85 | Ga0207658_10935221 | 3300025986 | Bacteria | 790 |
| 86 | Ga0207639_10792655 | 3300026041 | Bacteria | 883 |
| 87 | Ga0207702_10306289 | 3300026078 | Bacteria | 1509 |
| 88 | Ga0207648_10002863 | 3300026089 | Bacteria | 18260 |
| 89 | Ga0207676_10996153 | 3300026095 | Bacteria | 825 |
| 90 | Ga0207675_100005522 | 3300026118 | Bacteria | 12097 |
| 91 | Ga0209281_1011961 | 3300027111 | Bacteria | 1924 |
| 92 | Ga0209371_1000601 | 3300027312 | Bacteria | 32294 |
| 93 | Ga0209371_1001587 | 3300027312 | Bacteria | 14815 |
| 94 | Ga0209967_1008959 | 3300027364 | Bacteria | 1384 |
| 95 | Ga0209984_1000733 | 3300027424 | Bacteria | 3521 |
| 96 | Ga0210000_1001213 | 3300027462 | Bacteria | 3628 |
| 97 | Ga0209995_1002359 | 3300027471 | Bacteria | 2982 |
| 98 | Ga0209968_1015899 | 3300027526 | Bacteria | 1193 |
| 99 | Ga0209999_1001087 | 3300027543 | Bacteria | 4635 |
| 100 | Ga0209982_1001568 | 3300027552 | Bacteria | 3142 |
| 101 | Ga0209970_1006252 | 3300027614 | Bacteria | 1950 |
| 102 | Ga0209983_1000679 | 3300027665 | Bacteria | 7312 |
| 103 | Ga0209282_1000056 | 3300027666 | Bacteria | 100584 |
| 104 | Ga0209971_1000587 | 3300027682 | Bacteria | 9475 |
| 105 | Ga0209966_1000098 | 3300027695 | Bacteria | 38805 |
| 106 | Ga0209974_10004183 | 3300027876 | Bacteria | 5159 |
| 107 | Ga0268266_10182308 | 3300028379 | Bacteria | 1912 |
| 108 | Ga0268265_10004528 | 3300028380 | Bacteria | 9618 |
| 109 | Ga0265338_10565004 | 3300028800 | Bacteria | 795 |
| 110 | Ga0268256_1000517 | 3300030500 | Bacteria | 32417 |
| 111 | Ga0268256_1001369 | 3300030500 | Bacteria | 14815 |
| 112 | Ga0307511_10138963 | 3300030521 | Bacteria | 1435 |
| 113 | Ga0265320_10342899 | 3300031240 | Bacteria | 660 |
| 114 | Ga0307513_10123533 | 3300031456 | Bacteria | 2550 |
| 115 | Ga0307509_10007259 | 3300031507 | Bacteria | 14559 |
| 116 | Ga0307509_10020914 | 3300031507 | Bacteria | 7416 |
| 117 | Ga0307509_10306460 | 3300031507 | Bacteria | 1333 |
| 118 | Ga0265313_10144014 | 3300031595 | Bacteria | 1023 |
| 119 | Ga0307508_10068078 | 3300031616 | Bacteria | 3130 |
| 120 | Ga0307516_10002678 | 3300031730 | Bacteria | 23553 |
| 121 | Ga0307516_10184666 | 3300031730 | Bacteria | 1816 |
| 122 | Ga0307406_10064883 | 3300031901 | Bacteria | 2371 |
| 123 | Ga0307412_10117090 | 3300031911 | Bacteria | 1912 |
| 124 | Ga0373950_0032451 | 3300034818 | Bacteria | 972 |
| 125 | Ga0373943_0003331 | 3300035170 | Bacteria | 7300 |
| 126 | Ga0373946_0230012 | 3300035171 | Bacteria | 898 |
| 127 | Ga0373935_0027416 | 3300035692 | Bacteria | 3520 |
| 128 | Ga0373947_0007953 | 3300035725 | Bacteria | 6114 |
| 129 | Ga0395905_0112424 | 3300037471 | Bacteria | 2558 |
| 130 | Ga0436365_0515209 | 3300039437 | Bacteria | 4604 |
| 131 | Ga0436365_0841126 | 3300039437 | Bacteria | 605 |
| 132 | Ga0436365_1820187 | 3300039437 | Bacteria | 16013 |
| 133 | Ga0436361_1118989 | 3300039447 | Bacteria | 914 |
| 134 | Ga0451789_0287469 | 3300041443 | Bacteria | 953 |
| 135 | Ga0451793_1619994 | 3300041452 | Bacteria | 745 |
| 136 | Ga0451806_521278 | 3300041462 | Bacteria | 651 |
| 137 | Ga0439446_0030505 | 3300042156 | Bacteria | 1558 |
| 138 | Ga0439434_0217186 | 3300042435 | Bacteria | 648 |
| 139 | Ga0451577_0516337 | 3300042876 | Bacteria | 1085 |
| 140 | Ga0466969_0008985 | 3300044656 | Bacteria | 5295 |
| 141 | Ga0466961_0084093 | 3300044693 | Bacteria | 2012 |
| 142 | Ga0466964_0647991 | 3300044706 | Bacteria | 584 |
| 143 | Ga0453684_0087681 | 3300044712 | Bacteria | 3856 |
| 144 | Ga0453684_0799415 | 3300044712 | Bacteria | 1017 |
| 145 | Ga0466968_0029903 | 3300044735 | Bacteria | 2255 |
| 146 | Ga0451576_0043166 | 3300045051 | Bacteria | 4758 |
| 147 | Ga0451576_0208976 | 3300045051 | Bacteria | 2038 |
| 148 | Ga0451576_0464910 | 3300045051 | Bacteria | 1329 |
| 149 | Ga0495617_051271 | 3300046452 | Bacteria | 1372 |
| 150 | Ga0495629_0153531 | 3300046459 | Bacteria | 1600 |
| 151 | Ga0495638_0123739 | 3300046460 | Bacteria | 1526 |
| 152 | Ga0495638_0323782 | 3300046460 | Bacteria | 823 |
| 153 | Ga0495650_0000086 | 3300046471 | Bacteria | 235224 |
| 154 | Ga0495650_0017754 | 3300046471 | Bacteria | 3558 |
| 155 | Ga0495650_0034562 | 3300046471 | Bacteria | 2235 |
| 156 | Ga0495650_0034656 | 3300046471 | Bacteria | 2231 |
| 157 | Ga0495650_0214437 | 3300046471 | Bacteria | 665 |
| 158 | Ga0495605_0000022 | 3300046474 | Bacteria | 248321 |
| 159 | Ga0495605_0002358 | 3300046474 | Bacteria | 11748 |
| 160 | Ga0495639_0215255 | 3300046475 | Bacteria | 943 |
| 161 | Ga0495584_0345843 | 3300046491 | Bacteria | 755 |
| 162 | Ga0495585_0000350 | 3300046492 | Bacteria | 44650 |
| 163 | Ga0495596_0000151 | 3300046500 | Bacteria | 48207 |
| 164 | Ga0495607_0000725 | 3300046501 | Bacteria | 31676 |
| 165 | Ga0495606_0003096 | 3300046507 | Bacteria | 18095 |
| 166 | Ga0495606_0004900 | 3300046507 | Bacteria | 13103 |
| 167 | Ga0495610_0000010 | 3300046512 | Bacteria | 538821 |
| 168 | Ga0495610_0000328 | 3300046512 | Bacteria | 50375 |
| 169 | Ga0495610_0001957 | 3300046512 | Bacteria | 17721 |
| 170 | Ga0495610_0151866 | 3300046512 | Bacteria | 987 |
| 171 | Ga0495616_0000501 | 3300046513 | Bacteria | 29682 |
| 172 | Ga0495630_0188982 | 3300046517 | Bacteria | 1571 |
| 173 | Ga0495631_0348215 | 3300046518 | Bacteria | 630 |
| 174 | Ga0495632_0001040 | 3300046519 | Bacteria | 23905 |
| 175 | Ga0495637_0126462 | 3300046520 | Bacteria | 979 |
| 176 | Ga0495643_0000049 | 3300046522 | Bacteria | 212242 |
| 177 | Ga0495643_0000137 | 3300046522 | Bacteria | 117968 |
| 178 | Ga0495643_0196074 | 3300046522 | Bacteria | 972 |
| 179 | Ga0495648_0006273 | 3300046524 | Bacteria | 9730 |
| 180 | Ga0495648_0010663 | 3300046524 | Bacteria | 6984 |
| 181 | Ga0495648_0035266 | 3300046524 | Bacteria | 3244 |
| 182 | Ga0495648_0047268 | 3300046524 | Bacteria | 2661 |
| 183 | Ga0495648_0065268 | 3300046524 | Bacteria | 2141 |
| 184 | Ga0495648_0383303 | 3300046524 | Bacteria | 633 |
| 185 | Ga0495652_0696765 | 3300046529 | Bacteria | 684 |
| 186 | Ga0495654_0010709 | 3300046530 | Bacteria | 4980 |
| 187 | Ga0495640_0114826 | 3300046533 | Bacteria | 1755 |
| 188 | Ga0495609_0001067 | 3300046538 | Bacteria | 19193 |
| 189 | Ga0495609_0023250 | 3300046538 | Bacteria | 2850 |
| 190 | Ga0495597_0000276 | 3300046542 | Bacteria | 46947 |
| 191 | Ga0495597_0138961 | 3300046542 | Bacteria | 1003 |
| 192 | Ga0495645_0258825 | 3300046543 | Bacteria | 1153 |
| 193 | Ga0495633_0000220 | 3300046558 | Bacteria | 70701 |
| 194 | Ga0495633_0002754 | 3300046558 | Bacteria | 12159 |
| 195 | Ga0495633_0029527 | 3300046558 | Bacteria | 2667 |
| 196 | Ga0495656_0105425 | 3300046615 | Bacteria | 1310 |
| 197 | Ga0495668_0000004 | 3300046616 | Bacteria | 574236 |
| 198 | Ga0495668_0003088 | 3300046616 | Bacteria | 12882 |
| 199 | Ga0495625_0000047 | 3300046660 | Bacteria | 200913 |
| 200 | Ga0495625_0016170 | 3300046660 | Bacteria | 5877 |
| 201 | Ga0495625_0017422 | 3300046660 | Bacteria | 5625 |
| 202 | Ga0495625_0078895 | 3300046660 | Bacteria | 2298 |
| 203 | Ga0495625_0133221 | 3300046660 | Bacteria | 1682 |
| 204 | Ga0495661_0008567 | 3300046665 | Bacteria | 7070 |
| 205 | Ga0495669_0274023 | 3300046684 | Bacteria | 811 |
| 206 | Ga0495613_0258909 | 3300046689 | Bacteria | 1213 |
| 207 | Ga0495670_0002073 | 3300046691 | Bacteria | 9883 |
| 208 | Ga0495671_0000002 | 3300046692 | Bacteria | 1136189 |
| 209 | Ga0495671_0001730 | 3300046692 | Bacteria | 14173 |
| 210 | Ga0495671_0002756 | 3300046692 | Bacteria | 11002 |
| 211 | Ga0495671_0006469 | 3300046692 | Bacteria | 6768 |
| 212 | Ga0495671_0010382 | 3300046692 | Bacteria | 5161 |
| 213 | Ga0495671_0056269 | 3300046692 | Bacteria | 1947 |
| 214 | Ga0495671_0270316 | 3300046692 | Bacteria | 820 |
| 215 | Ga0495671_0285149 | 3300046692 | Bacteria | 795 |
| 216 | Ga0495649_0008868 | 3300046694 | Bacteria | 6021 |
| 217 | Ga0495649_0009203 | 3300046694 | Bacteria | 5887 |
| 218 | Ga0495649_0021974 | 3300046694 | Bacteria | 3573 |
| 219 | Ga0495649_0025536 | 3300046694 | Bacteria | 3290 |
| 220 | Ga0495649_0030618 | 3300046694 | Bacteria | 2971 |
| 221 | Ga0495649_0176074 | 3300046694 | Bacteria | 1118 |
| 222 | Ga0495589_0151757 | 3300046794 | Bacteria | 1106 |
| 223 | Ga0495660_0033578 | 3300046810 | Bacteria | 2876 |
| 224 | Ga0495674_0115388 | 3300047319 | Bacteria | 2273 |
| 225 | Ga0495672_0000347 | 3300047320 | Bacteria | 59349 |
| 226 | Ga0495672_0053541 | 3300047320 | Bacteria | 2364 |
| 227 | Ga0495683_0008232 | 3300047323 | Bacteria | 5591 |
| 228 | Ga0495687_000044 | 3300047443 | Bacteria | 215400 |
| 229 | Ga0495679_033886 | 3300047446 | Bacteria | 1628 |
| 230 | Ga0495673_0000026 | 3300047469 | Bacteria | 476378 |
| 231 | Ga0495673_0000028 | 3300047469 | Bacteria | 473418 |
| 232 | Ga0495681_0094399 | 3300047470 | Bacteria | 1316 |
| 233 | Ga0495686_0000072 | 3300047472 | Bacteria | 216371 |
| 234 | Ga0495686_0160080 | 3300047472 | Bacteria | 1316 |
| 235 | Ga0496113_0087604 | 3300048916 | Bacteria | 2394 |
| 236 | Ga0496116_0004283 | 3300048919 | Bacteria | 13682 |
| 237 | Ga0496116_0060202 | 3300048919 | Bacteria | 2464 |
| 238 | Ga0496116_0263797 | 3300048919 | Bacteria | 847 |
| 239 | Ga0496119_0033175 | 3300048922 | Bacteria | 3428 |
| 240 | Ga0496121_0003458 | 3300048924 | Bacteria | 22514 |
| 241 | Ga0496121_0129275 | 3300048924 | Bacteria | 1894 |
| 242 | Ga0496122_0001123 | 3300048925 | Bacteria | 46098 |
| 243 | Ga0496123_0000957 | 3300048926 | Bacteria | 44790 |
| 244 | Ga0496123_0112156 | 3300048926 | Bacteria | 1556 |
| 245 | Ga0496124_0308592 | 3300048927 | Bacteria | 1139 |
| 246 | Ga0496125_0218068 | 3300048928 | Bacteria | 1232 |
| 247 | Ga0495678_000502 | 3300049459 | Bacteria | 38555 |
| 248 | Ga0495678_081271 | 3300049459 | Bacteria | 1163 |
| 249 | Ga0501031_0484316 | 3300049568 | Bacteria | 798 |
| 250 | Ga0501033_0099896 | 3300049570 | Bacteria | 2118 |
| 251 | Ga0501034_0141709 | 3300049571 | Bacteria | 2383 |
| 252 | Ga0501047_0260013 | 3300049581 | Bacteria | 1584 |
| 253 | Ga0501083_0085260 | 3300049744 | Bacteria | 2090 |
| 254 | Ga0501045_0616128 | 3300049824 | Bacteria | 803 |
| 255 | nmdc:mga03n38_285955_c1 | 3300050490 | Bacteria | 881 |
| 256 | nmdc:mga0k408_17569_c1 | 3300050493 | Bacteria | 3987 |
| 257 | nmdc:mga06z11_446636_c1 | 3300050494 | Bacteria | 781 |
| 258 | nmdc:mga07m45_314_c1 | 3300050496 | Bacteria | 19551 |
| 259 | nmdc:mga07m45_419764_c1 | 3300050496 | Bacteria | 776 |
| 260 | nmdc:mga05p37_1439_c1 | 3300050507 | Bacteria | 27650 |
| 261 | nmdc:mga09592_1904_c1 | 3300050508 | Bacteria | 16776 |
| 262 | nmdc:mga0qj67_37012_c1 | 3300050509 | Bacteria | 3821 |
| 263 | nmdc:mga0qj67_5224_c1 | 3300050509 | Bacteria | 9471 |
| 264 | nmdc:mga06r32_1004_c1 | 3300050510 | Bacteria | 25303 |
| 265 | nmdc:mga06r32_11652_c1 | 3300050510 | Bacteria | 7915 |
| 266 | nmdc:mga08y16_399832_c1 | 3300050511 | Bacteria | 1406 |
| 267 | Ga0500578_0246105 | 3300053086 | Bacteria | 1079 |
| 268 | Ga0500651_0000205 | 3300053093 | Bacteria | 37424 |
| 269 | Ga0500566_0000009 | 3300053094 | Bacteria | 131668 |
| 270 | Ga0500640_002052 | 3300053095 | Bacteria | 6493 |
| 271 | Ga0500572_000142 | 3300053111 | Bacteria | 24469 |
| 272 | Ga0500591_028139 | 3300053115 | Bacteria | 2722 |
| 273 | Ga0500594_0101568 | 3300053118 | Bacteria | 885 |
| 274 | Ga0500608_085447 | 3300053122 | Bacteria | 1482 |
| 275 | Ga0500614_030319 | 3300053123 | Bacteria | 1318 |
| 276 | Ga0500618_035423 | 3300053125 | Bacteria | 1159 |
| 277 | Ga0500618_055077 | 3300053125 | Bacteria | 897 |
| 278 | Ga0500559_0000488 | 3300053136 | Bacteria | 27939 |
| 279 | Ga0500586_000401 | 3300053145 | Bacteria | 8667 |
| 280 | Ga0500590_004472 | 3300053148 | Bacteria | 6600 |
| 281 | Ga0500603_000016 | 3300053150 | Bacteria | 56563 |
| 282 | Ga0500616_0028921 | 3300053153 | Bacteria | 3052 |
| 283 | Ga0500630_000034 | 3300053159 | Bacteria | 38552 |
| 284 | Ga0500638_030506 | 3300053162 | Bacteria | 2596 |
| 285 | Ga0500639_000017 | 3300053163 | Bacteria | 114464 |
| 286 | Ga0500596_000747 | 3300053735 | Bacteria | 6392 |
| 287 | Ga0501082_0070187 | 3300060353 | Bacteria | 3017 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003322 | rootL2_10150555 | rootL2_101505551 | 154 |
| 2 | 3300003771 | Ga0055526_1000080 | Ga0055526_100008055 | 154 |
| 3 | 3300003856 | Ga0058692_1014673 | Ga0058692_10146731 | 154 |
| 4 | 3300005435 | Ga0070714_100622835 | Ga0070714_1006228351 | 154 |
| 5 | 3300005436 | Ga0070713_100683096 | Ga0070713_1006830962 | 154 |
| 6 | 3300005459 | Ga0068867_100002213 | Ga0068867_1000022134 | 154 |
| 7 | 3300005459 | Ga0068867_102045073 | Ga0068867_1020450731 | 154 |
| 8 | 3300005548 | Ga0070665_100560939 | Ga0070665_1005609392 | 154 |
| 9 | 3300005563 | Ga0068855_100439975 | Ga0068855_1004399752 | 154 |
| 10 | 3300005563 | Ga0068855_100546034 | Ga0068855_1005460342 | 154 |
| 11 | 3300005614 | Ga0068856_100648472 | Ga0068856_1006484722 | 154 |
| 12 | 3300005617 | Ga0068859_100001416 | Ga0068859_10000141638 | 154 |
| 13 | 3300005618 | Ga0068864_101483218 | Ga0068864_1014832181 | 154 |
| 14 | 3300005844 | Ga0068862_100080408 | Ga0068862_1000804083 | 154 |
| 15 | 3300005983 | Ga0081540_1000213 | Ga0081540_100021339 | 154 |
| 16 | 3300006048 | Ga0075363_100822034 | Ga0075363_1008220341 | 154 |
| 17 | 3300006178 | Ga0075367_10067915 | Ga0075367_100679153 | 154 |
| 18 | 3300006353 | Ga0075370_10198850 | Ga0075370_101988502 | 154 |
| 19 | 3300006846 | Ga0075430_100000353 | Ga0075430_10000035317 | 154 |
| 20 | 3300006846 | Ga0075430_100028768 | Ga0075430_1000287686 | 154 |
| 21 | 3300006847 | Ga0075431_100002478 | Ga0075431_10000247810 | 154 |
| 22 | 3300006847 | Ga0075431_100049025 | Ga0075431_1000490257 | 154 |
| 23 | 3300006880 | Ga0075429_100024821 | Ga0075429_1000248212 | 154 |
| 24 | 3300006881 | Ga0068865_100699573 | Ga0068865_1006995732 | 154 |
| 25 | 3300006931 | Ga0097620_100001416 | Ga0097620_1000014165 | 154 |
| 26 | 3300009093 | Ga0105240_10067927 | Ga0105240_100679273 | 154 |
| 27 | 3300009093 | Ga0105240_10370003 | Ga0105240_103700032 | 154 |
| 28 | 3300009094 | Ga0111539_10530014 | Ga0111539_105300142 | 154 |
| 29 | 3300009147 | Ga0114129_10069857 | Ga0114129_100698572 | 154 |
| 30 | 3300009148 | Ga0105243_10594472 | Ga0105243_105944721 | 154 |
| 31 | 3300009174 | Ga0105241_11121129 | Ga0105241_111211291 | 154 |
| 32 | 3300009177 | Ga0105248_10179259 | Ga0105248_101792593 | 154 |
| 33 | 3300009545 | Ga0105237_10506230 | Ga0105237_105062302 | 154 |
| 34 | 3300009551 | Ga0105238_10058212 | Ga0105238_100582121 | 154 |
| 35 | 3300009553 | Ga0105249_11780852 | Ga0105249_117808521 | 154 |
| 36 | 3300010375 | Ga0105239_10145074 | Ga0105239_101450743 | 154 |
| 37 | 3300010375 | Ga0105239_11424384 | Ga0105239_114243842 | 154 |
| 38 | 3300013296 | Ga0157374_10108403 | Ga0157374_101084032 | 154 |
| 39 | 3300014325 | Ga0163163_12288157 | Ga0163163_122881572 | 154 |
| 40 | 3300014497 | Ga0182008_10232944 | Ga0182008_102329442 | 154 |
| 41 | 3300017792 | Ga0163161_10174490 | Ga0163161_101744902 | 154 |
| 42 | 3300021384 | Ga0213876_10048815 | Ga0213876_100488154 | 154 |
| 43 | 3300025295 | Ga0209564_1000007 | Ga0209564_1000007748 | 154 |
| 44 | 3300025913 | Ga0207695_10040604 | Ga0207695_100406044 | 154 |
| 45 | 3300025913 | Ga0207695_10078085 | Ga0207695_100780855 | 154 |
| 46 | 3300025915 | Ga0207693_10644044 | Ga0207693_106440441 | 154 |
| 47 | 3300025924 | Ga0207694_10025556 | Ga0207694_100255564 | 154 |
| 48 | 3300025938 | Ga0207704_10538496 | Ga0207704_105384962 | 154 |
| 49 | 3300025939 | Ga0207665_10045236 | Ga0207665_100452362 | 154 |
| 50 | 3300025941 | Ga0207711_10035303 | Ga0207711_100353035 | 154 |
| 51 | 3300025949 | Ga0207667_10211204 | Ga0207667_102112043 | 154 |
| 52 | 3300025949 | Ga0207667_10947481 | Ga0207667_109474812 | 154 |
| 53 | 3300025986 | Ga0207658_10935221 | Ga0207658_109352212 | 154 |
| 54 | 3300026078 | Ga0207702_10306289 | Ga0207702_103062892 | 154 |
| 55 | 3300026089 | Ga0207648_10002863 | Ga0207648_1000286317 | 154 |
| 56 | 3300026095 | Ga0207676_10996153 | Ga0207676_109961532 | 154 |
| 57 | 3300026118 | Ga0207675_100005522 | Ga0207675_1000055225 | 154 |
| 58 | 3300027312 | Ga0209371_1000601 | Ga0209371_100060116 | 154 |
| 59 | 3300027312 | Ga0209371_1001587 | Ga0209371_10015877 | 154 |
| 60 | 3300028379 | Ga0268266_10182308 | Ga0268266_101823083 | 154 |
| 61 | 3300028380 | Ga0268265_10004528 | Ga0268265_100045286 | 154 |
| 62 | 3300028800 | Ga0265338_10565004 | Ga0265338_105650042 | 154 |
| 63 | 3300030500 | Ga0268256_1000517 | Ga0268256_100051716 | 154 |
| 64 | 3300030500 | Ga0268256_1001369 | Ga0268256_10013699 | 154 |
| 65 | 3300031456 | Ga0307513_10123533 | Ga0307513_101235332 | 154 |
| 66 | 3300031730 | Ga0307516_10002678 | Ga0307516_1000267811 | 154 |
| 67 | 3300031901 | Ga0307406_10064883 | Ga0307406_100648832 | 154 |
| 68 | 3300031911 | Ga0307412_10117090 | Ga0307412_101170902 | 154 |
| 69 | 3300034818 | Ga0373950_0032451 | Ga0373950_0032451_210_680 | 154 |
| 70 | 3300035170 | Ga0373943_0003331 | Ga0373943_0003331_647_1117 | 154 |
| 71 | 3300035171 | Ga0373946_0230012 | Ga0373946_0230012_267_737 | 154 |
| 72 | 3300035692 | Ga0373935_0027416 | Ga0373935_0027416_306_776 | 154 |
| 73 | 3300035725 | Ga0373947_0007953 | Ga0373947_0007953_4541_5011 | 154 |
| 74 | 3300037471 | Ga0395905_0112424 | Ga0395905_0112424_251_721 | 154 |
| 75 | 3300039437 | Ga0436365_0515209 | Ga0436365_0515209_2095_2559 | 154 |
| 76 | 3300039437 | Ga0436365_0841126 | Ga0436365_0841126_15_479 | 154 |
| 77 | 3300041452 | Ga0451793_1619994 | Ga0451793_1619994_179_643 | 154 |
| 78 | 3300041462 | Ga0451806_521278 | Ga0451806_521278_175_639 | 154 |
| 79 | 3300042156 | Ga0439446_0030505 | Ga0439446_0030505_44_508 | 154 |
| 80 | 3300044712 | Ga0453684_0799415 | Ga0453684_0799415_294_761 | 154 |
| 81 | 3300045051 | Ga0451576_0464910 | Ga0451576_0464910_278_745 | 154 |
| 82 | 3300046459 | Ga0495629_0153531 | Ga0495629_0153531_536_1006 | 154 |
| 83 | 3300046460 | Ga0495638_0123739 | Ga0495638_0123739_927_1394 | 154 |
| 84 | 3300046460 | Ga0495638_0323782 | Ga0495638_0323782_12_524 | 154 |
| 85 | 3300046471 | Ga0495650_0000086 | Ga0495650_0000086_178253_178765 | 154 |
| 86 | 3300046471 | Ga0495650_0034562 | Ga0495650_0034562_901_1413 | 154 |
| 87 | 3300046471 | Ga0495650_0214437 | Ga0495650_0214437_125_589 | 154 |
| 88 | 3300046474 | Ga0495605_0000022 | Ga0495605_0000022_134010_134477 | 154 |
| 89 | 3300046475 | Ga0495639_0215255 | Ga0495639_0215255_423_893 | 154 |
| 90 | 3300046492 | Ga0495585_0000350 | Ga0495585_0000350_7814_8326 | 154 |
| 91 | 3300046507 | Ga0495606_0003096 | Ga0495606_0003096_5256_5723 | 154 |
| 92 | 3300046507 | Ga0495606_0004900 | Ga0495606_0004900_10969_11436 | 154 |
| 93 | 3300046512 | Ga0495610_0000010 | Ga0495610_0000010_277994_278506 | 154 |
| 94 | 3300046512 | Ga0495610_0001957 | Ga0495610_0001957_15616_16083 | 154 |
| 95 | 3300046512 | Ga0495610_0151866 | Ga0495610_0151866_56_532 | 154 |
| 96 | 3300046517 | Ga0495630_0188982 | Ga0495630_0188982_358_828 | 154 |
| 97 | 3300046519 | Ga0495632_0001040 | Ga0495632_0001040_2554_3018 | 154 |
| 98 | 3300046522 | Ga0495643_0000049 | Ga0495643_0000049_65396_65872 | 154 |
| 99 | 3300046522 | Ga0495643_0000137 | Ga0495643_0000137_32812_33279 | 154 |
| 100 | 3300046524 | Ga0495648_0006273 | Ga0495648_0006273_8678_9145 | 154 |
| 101 | 3300046524 | Ga0495648_0010663 | Ga0495648_0010663_3692_4156 | 154 |
| 102 | 3300046524 | Ga0495648_0035266 | Ga0495648_0035266_245_757 | 154 |
| 103 | 3300046524 | Ga0495648_0065268 | Ga0495648_0065268_303_770 | 154 |
| 104 | 3300046530 | Ga0495654_0010709 | Ga0495654_0010709_946_1458 | 154 |
| 105 | 3300046533 | Ga0495640_0114826 | Ga0495640_0114826_157_627 | 154 |
| 106 | 3300046538 | Ga0495609_0023250 | Ga0495609_0023250_1122_1589 | 154 |
| 107 | 3300046542 | Ga0495597_0000276 | Ga0495597_0000276_17981_18448 | 154 |
| 108 | 3300046558 | Ga0495633_0000220 | Ga0495633_0000220_44004_44471 | 154 |
| 109 | 3300046558 | Ga0495633_0002754 | Ga0495633_0002754_6755_7222 | 154 |
| 110 | 3300046558 | Ga0495633_0029527 | Ga0495633_0029527_1447_1959 | 154 |
| 111 | 3300046616 | Ga0495668_0000004 | Ga0495668_0000004_235063_235539 | 154 |
| 112 | 3300046616 | Ga0495668_0003088 | Ga0495668_0003088_8023_8535 | 154 |
| 113 | 3300046660 | Ga0495625_0000047 | Ga0495625_0000047_63124_63594 | 154 |
| 114 | 3300046660 | Ga0495625_0016170 | Ga0495625_0016170_2625_3092 | 154 |
| 115 | 3300046660 | Ga0495625_0017422 | Ga0495625_0017422_2186_2662 | 154 |
| 116 | 3300046660 | Ga0495625_0078895 | Ga0495625_0078895_361_873 | 154 |
| 117 | 3300046660 | Ga0495625_0133221 | Ga0495625_0133221_837_1304 | 154 |
| 118 | 3300046689 | Ga0495613_0258909 | Ga0495613_0258909_202_672 | 154 |
| 119 | 3300046691 | Ga0495670_0002073 | Ga0495670_0002073_1793_2263 | 154 |
| 120 | 3300046692 | Ga0495671_0000002 | Ga0495671_0000002_326196_326663 | 154 |
| 121 | 3300046692 | Ga0495671_0001730 | Ga0495671_0001730_9875_10351 | 154 |
| 122 | 3300046692 | Ga0495671_0056269 | Ga0495671_0056269_442_909 | 154 |
| 123 | 3300046692 | Ga0495671_0285149 | Ga0495671_0285149_274_741 | 154 |
| 124 | 3300046694 | Ga0495649_0009203 | Ga0495649_0009203_2488_2955 | 154 |
| 125 | 3300046694 | Ga0495649_0021974 | Ga0495649_0021974_414_881 | 154 |
| 126 | 3300046694 | Ga0495649_0025536 | Ga0495649_0025536_129_605 | 154 |
| 127 | 3300046694 | Ga0495649_0030618 | Ga0495649_0030618_129_605 | 154 |
| 128 | 3300046694 | Ga0495649_0176074 | Ga0495649_0176074_482_952 | 154 |
| 129 | 3300046810 | Ga0495660_0033578 | Ga0495660_0033578_2069_2560 | 154 |
| 130 | 3300047319 | Ga0495674_0115388 | Ga0495674_0115388_1030_1500 | 154 |
| 131 | 3300047320 | Ga0495672_0000347 | Ga0495672_0000347_25146_25613 | 154 |
| 132 | 3300047323 | Ga0495683_0008232 | Ga0495683_0008232_4316_4828 | 154 |
| 133 | 3300047443 | Ga0495687_000044 | Ga0495687_000044_82200_82670 | 154 |
| 134 | 3300047446 | Ga0495679_033886 | Ga0495679_033886_788_1300 | 154 |
| 135 | 3300047469 | Ga0495673_0000026 | Ga0495673_0000026_220773_221285 | 154 |
| 136 | 3300047469 | Ga0495673_0000028 | Ga0495673_0000028_169530_169997 | 154 |
| 137 | 3300047470 | Ga0495681_0094399 | Ga0495681_0094399_775_1251 | 154 |
| 138 | 3300047472 | Ga0495686_0000072 | Ga0495686_0000072_21116_21694 | 154 |
| 139 | 3300047472 | Ga0495686_0160080 | Ga0495686_0160080_11_523 | 154 |
| 140 | 3300048919 | Ga0496116_0060202 | Ga0496116_0060202_931_1395 | 154 |
| 141 | 3300048919 | Ga0496116_0263797 | Ga0496116_0263797_18_482 | 154 |
| 142 | 3300048926 | Ga0496123_0112156 | Ga0496123_0112156_183_647 | 154 |
| 143 | 3300048928 | Ga0496125_0218068 | Ga0496125_0218068_238_702 | 154 |
| 144 | 3300049459 | Ga0495678_000502 | Ga0495678_000502_1729_2196 | 154 |
| 145 | 3300049568 | Ga0501031_0484316 | Ga0501031_0484316_304_768 | 154 |
| 146 | 3300049570 | Ga0501033_0099896 | Ga0501033_0099896_715_1179 | 154 |
| 147 | 3300049581 | Ga0501047_0260013 | Ga0501047_0260013_15_479 | 154 |
| 148 | 3300050490 | nmdc:mga03n38_285955_c1 | nmdc:mga03n38_285955_c1_179_643 | 154 |
| 149 | 3300050494 | nmdc:mga06z11_446636_c1 | nmdc:mga06z11_446636_c1_275_739 | 154 |
| 150 | 3300050496 | nmdc:mga07m45_419764_c1 | nmdc:mga07m45_419764_c1_240_704 | 154 |
| 151 | 3300050507 | nmdc:mga05p37_1439_c1 | nmdc:mga05p37_1439_c1_27043_27507 | 154 |
| 152 | 3300050508 | nmdc:mga09592_1904_c1 | nmdc:mga09592_1904_c1_7729_8193 | 154 |
| 153 | 3300050509 | nmdc:mga0qj67_37012_c1 | nmdc:mga0qj67_37012_c1_1309_1773 | 154 |
| 154 | 3300050509 | nmdc:mga0qj67_5224_c1 | nmdc:mga0qj67_5224_c1_6673_7137 | 154 |
| 155 | 3300050510 | nmdc:mga06r32_1004_c1 | nmdc:mga06r32_1004_c1_9263_9727 | 154 |
| 156 | 3300050510 | nmdc:mga06r32_11652_c1 | nmdc:mga06r32_11652_c1_1016_1480 | 154 |
| 157 | 3300050511 | nmdc:mga08y16_399832_c1 | nmdc:mga08y16_399832_c1_741_1205 | 154 |
| 158 | 3300053086 | Ga0500578_0246105 | Ga0500578_0246105_543_1007 | 154 |
| 159 | 3300053118 | Ga0500594_0101568 | Ga0500594_0101568_72_539 | 154 |
| 160 | 3300053125 | Ga0500618_035423 | Ga0500618_035423_654_1118 | 154 |
| 161 | 3300053145 | Ga0500586_000401 | Ga0500586_000401_1467_1934 | 154 |
| 162 | iso_pu_bacteria | 2738543020 | 2739287625 | 154 |
| 163 | iso_pu_bacteria | 2738543021 | 2739292938 | 154 |
| 164 | 3300005262 | Ga0065165_1000074 | Ga0065165_100007493 | 155 |
| 165 | 3300006195 | Ga0075366_10001457 | Ga0075366_100014575 | 155 |
| 166 | 3300006353 | Ga0075370_10000072 | Ga0075370_1000007228 | 155 |
| 167 | 3300026041 | Ga0207639_10792655 | Ga0207639_107926551 | 155 |
| 168 | 3300031507 | Ga0307509_10020914 | Ga0307509_100209149 | 155 |
| 169 | 3300031507 | Ga0307509_10306460 | Ga0307509_103064602 | 155 |
| 170 | 3300031616 | Ga0307508_10068078 | Ga0307508_100680781 | 155 |
| 171 | 3300031730 | Ga0307516_10184666 | Ga0307516_101846662 | 155 |
| 172 | 3300042435 | Ga0439434_0217186 | Ga0439434_0217186_70_537 | 155 |
| 173 | 3300042876 | Ga0451577_0516337 | Ga0451577_0516337_396_863 | 155 |
| 174 | 3300044656 | Ga0466969_0008985 | Ga0466969_0008985_2441_2908 | 155 |
| 175 | 3300044693 | Ga0466961_0084093 | Ga0466961_0084093_68_535 | 155 |
| 176 | 3300044706 | Ga0466964_0647991 | Ga0466964_0647991_40_507 | 155 |
| 177 | 3300044712 | Ga0453684_0087681 | Ga0453684_0087681_1866_2333 | 155 |
| 178 | 3300044735 | Ga0466968_0029903 | Ga0466968_0029903_1675_2142 | 155 |
| 179 | 3300045051 | Ga0451576_0043166 | Ga0451576_0043166_3572_4039 | 155 |
| 180 | 3300046524 | Ga0495648_0383303 | Ga0495648_0383303_139_606 | 155 |
| 181 | 3300050493 | nmdc:mga0k408_17569_c1 | nmdc:mga0k408_17569_c1_2768_3235 | 155 |
| 182 | 3300050496 | nmdc:mga07m45_314_c1 | nmdc:mga07m45_314_c1_11594_12061 | 155 |
| 183 | 3300053125 | Ga0500618_055077 | Ga0500618_055077_337_804 | 155 |
| 184 | 3300053148 | Ga0500590_004472 | Ga0500590_004472_4160_4627 | 155 |
| 185 | 3300025915 | Ga0207693_10032077 | Ga0207693_100320774 | 156 |
| 186 | 3300025928 | Ga0207700_10063832 | Ga0207700_100638323 | 156 |
| 187 | 3300030521 | Ga0307511_10138963 | Ga0307511_101389632 | 156 |
| 188 | 3300031240 | Ga0265320_10342899 | Ga0265320_103428991 | 156 |
| 189 | 3300031507 | Ga0307509_10007259 | Ga0307509_100072597 | 156 |
| 190 | 3300031595 | Ga0265313_10144014 | Ga0265313_101440141 | 156 |
| 191 | 3300046520 | Ga0495637_0126462 | Ga0495637_0126462_26_496 | 156 |
| 192 | 3300048922 | Ga0496119_0033175 | Ga0496119_0033175_2822_3295 | 156 |
| 193 | 3300049571 | Ga0501034_0141709 | Ga0501034_0141709_1025_1495 | 156 |
| 194 | 3300053093 | Ga0500651_0000205 | Ga0500651_0000205_30318_30788 | 156 |
| 195 | 3300053094 | Ga0500566_0000009 | Ga0500566_0000009_90714_91187 | 156 |
| 196 | 3300053095 | Ga0500640_002052 | Ga0500640_002052_2808_3281 | 156 |
| 197 | 3300053111 | Ga0500572_000142 | Ga0500572_000142_19268_19741 | 156 |
| 198 | 3300053115 | Ga0500591_028139 | Ga0500591_028139_1409_1882 | 156 |
| 199 | 3300053122 | Ga0500608_085447 | Ga0500608_085447_651_1124 | 156 |
| 200 | 3300053123 | Ga0500614_030319 | Ga0500614_030319_590_1063 | 156 |
| 201 | 3300053136 | Ga0500559_0000488 | Ga0500559_0000488_21804_22277 | 156 |
| 202 | 3300053150 | Ga0500603_000016 | Ga0500603_000016_40945_41418 | 156 |
| 203 | 3300053153 | Ga0500616_0028921 | Ga0500616_0028921_1135_1605 | 156 |
| 204 | 3300053159 | Ga0500630_000034 | Ga0500630_000034_29456_29929 | 156 |
| 205 | 3300053162 | Ga0500638_030506 | Ga0500638_030506_63_536 | 156 |
| 206 | 3300053163 | Ga0500639_000017 | Ga0500639_000017_43235_43708 | 156 |
| 207 | 3300053735 | Ga0500596_000747 | Ga0500596_000747_3737_4210 | 156 |
| 208 | 3300060353 | Ga0501082_0070187 | Ga0501082_0070187_1708_2178 | 156 |
| 209 | 3300002773 | JGI25152J39213_1000969 | JGI25152J39213_10009694 | 157 |
| 210 | 3300003187 | JGI25151J46595_10002492 | JGI25151J46595_100024927 | 157 |
| 211 | 3300003763 | Ga0055529_1000481 | Ga0055529_10004818 | 157 |
| 212 | 3300003792 | Ga0055540_1035850 | Ga0055540_10358501 | 157 |
| 213 | 3300005444 | Ga0070694_100013134 | Ga0070694_1000131347 | 157 |
| 214 | 3300005545 | Ga0070695_100013116 | Ga0070695_1000131167 | 157 |
| 215 | 3300006175 | Ga0070712_101278793 | Ga0070712_1012787931 | 157 |
| 216 | 3300006948 | Ga0099826_10000011 | Ga0099826_1000001157 | 157 |
| 217 | 3300009036 | Ga0105244_10001680 | Ga0105244_1000168012 | 157 |
| 218 | 3300009177 | Ga0105248_10150135 | Ga0105248_101501354 | 157 |
| 219 | 3300013100 | Ga0157373_11319720 | Ga0157373_113197201 | 157 |
| 220 | 3300013102 | Ga0157371_10257631 | Ga0157371_102576312 | 157 |
| 221 | 3300013307 | Ga0157372_10201448 | Ga0157372_102014482 | 157 |
| 222 | 3300014325 | Ga0163163_10677520 | Ga0163163_106775202 | 157 |
| 223 | 3300021321 | Ga0214542_1024039 | Ga0214542_10240395 | 157 |
| 224 | 3300021327 | Ga0214543_1016151 | Ga0214543_10161515 | 157 |
| 225 | 3300021384 | Ga0213876_10001291 | Ga0213876_1000129112 | 157 |
| 226 | 3300025233 | Ga0209437_114966 | Ga0209437_1149662 | 157 |
| 227 | 3300025258 | Ga0209129_1000070 | Ga0209129_100007086 | 157 |
| 228 | 3300025272 | Ga0209455_1000026 | Ga0209455_1000026546 | 157 |
| 229 | 3300025294 | Ga0209025_1000175 | Ga0209025_100017584 | 157 |
| 230 | 3300025303 | Ga0209051_1019056 | Ga0209051_10190563 | 157 |
| 231 | 3300025728 | Ga0207655_1003435 | Ga0207655_100343510 | 157 |
| 232 | 3300025728 | Ga0207655_1027955 | Ga0207655_10279553 | 157 |
| 233 | 3300025735 | Ga0207713_1169585 | Ga0207713_11695851 | 157 |
| 234 | 3300025735 | Ga0207713_1220038 | Ga0207713_12200381 | 157 |
| 235 | 3300025941 | Ga0207711_10118002 | Ga0207711_101180024 | 157 |
| 236 | 3300027111 | Ga0209281_1011961 | Ga0209281_10119611 | 157 |
| 237 | 3300027364 | Ga0209967_1008959 | Ga0209967_10089592 | 157 |
| 238 | 3300027424 | Ga0209984_1000733 | Ga0209984_10007331 | 157 |
| 239 | 3300027462 | Ga0210000_1001213 | Ga0210000_10012134 | 157 |
| 240 | 3300027471 | Ga0209995_1002359 | Ga0209995_10023592 | 157 |
| 241 | 3300027526 | Ga0209968_1015899 | Ga0209968_10158992 | 157 |
| 242 | 3300027543 | Ga0209999_1001087 | Ga0209999_10010876 | 157 |
| 243 | 3300027552 | Ga0209982_1001568 | Ga0209982_10015686 | 157 |
| 244 | 3300027614 | Ga0209970_1006252 | Ga0209970_10062522 | 157 |
| 245 | 3300027665 | Ga0209983_1000679 | Ga0209983_10006795 | 157 |
| 246 | 3300027666 | Ga0209282_1000056 | Ga0209282_100005657 | 157 |
| 247 | 3300027682 | Ga0209971_1000587 | Ga0209971_10005872 | 157 |
| 248 | 3300027695 | Ga0209966_1000098 | Ga0209966_100009827 | 157 |
| 249 | 3300027876 | Ga0209974_10004183 | Ga0209974_100041836 | 157 |
| 250 | 3300039437 | Ga0436365_1820187 | Ga0436365_1820187_11065_11544 | 157 |
| 251 | 3300039447 | Ga0436361_1118989 | Ga0436361_1118989_18_500 | 157 |
| 252 | 3300041443 | Ga0451789_0287469 | Ga0451789_0287469_346_819 | 157 |
| 253 | 3300045051 | Ga0451576_0208976 | Ga0451576_0208976_337_837 | 157 |
| 254 | 3300046452 | Ga0495617_051271 | Ga0495617_051271_658_1131 | 157 |
| 255 | 3300046471 | Ga0495650_0017754 | Ga0495650_0017754_1326_1799 | 157 |
| 256 | 3300046471 | Ga0495650_0034656 | Ga0495650_0034656_1343_1816 | 157 |
| 257 | 3300046474 | Ga0495605_0002358 | Ga0495605_0002358_11217_11696 | 157 |
| 258 | 3300046491 | Ga0495584_0345843 | Ga0495584_0345843_259_738 | 157 |
| 259 | 3300046500 | Ga0495596_0000151 | Ga0495596_0000151_31301_31780 | 157 |
| 260 | 3300046501 | Ga0495607_0000725 | Ga0495607_0000725_18922_19401 | 157 |
| 261 | 3300046512 | Ga0495610_0000328 | Ga0495610_0000328_17647_18126 | 157 |
| 262 | 3300046513 | Ga0495616_0000501 | Ga0495616_0000501_16072_16551 | 157 |
| 263 | 3300046518 | Ga0495631_0348215 | Ga0495631_0348215_101_580 | 157 |
| 264 | 3300046522 | Ga0495643_0196074 | Ga0495643_0196074_394_873 | 157 |
| 265 | 3300046524 | Ga0495648_0047268 | Ga0495648_0047268_875_1354 | 157 |
| 266 | 3300046529 | Ga0495652_0696765 | Ga0495652_0696765_49_522 | 157 |
| 267 | 3300046538 | Ga0495609_0001067 | Ga0495609_0001067_8661_9140 | 157 |
| 268 | 3300046542 | Ga0495597_0138961 | Ga0495597_0138961_282_761 | 157 |
| 269 | 3300046543 | Ga0495645_0258825 | Ga0495645_0258825_99_572 | 157 |
| 270 | 3300046615 | Ga0495656_0105425 | Ga0495656_0105425_76_555 | 157 |
| 271 | 3300046665 | Ga0495661_0008567 | Ga0495661_0008567_5027_5506 | 157 |
| 272 | 3300046684 | Ga0495669_0274023 | Ga0495669_0274023_30_509 | 157 |
| 273 | 3300046692 | Ga0495671_0002756 | Ga0495671_0002756_9982_10461 | 157 |
| 274 | 3300046692 | Ga0495671_0006469 | Ga0495671_0006469_3903_4376 | 157 |
| 275 | 3300046692 | Ga0495671_0010382 | Ga0495671_0010382_4422_4895 | 157 |
| 276 | 3300046692 | Ga0495671_0270316 | Ga0495671_0270316_305_778 | 157 |
| 277 | 3300046694 | Ga0495649_0008868 | Ga0495649_0008868_5027_5506 | 157 |
| 278 | 3300046794 | Ga0495589_0151757 | Ga0495589_0151757_598_1077 | 157 |
| 279 | 3300047320 | Ga0495672_0053541 | Ga0495672_0053541_949_1428 | 157 |
| 280 | 3300048916 | Ga0496113_0087604 | Ga0496113_0087604_148_621 | 157 |
| 281 | 3300048919 | Ga0496116_0004283 | Ga0496116_0004283_11864_12343 | 157 |
| 282 | 3300048924 | Ga0496121_0003458 | Ga0496121_0003458_32_511 | 157 |
| 283 | 3300048924 | Ga0496121_0129275 | Ga0496121_0129275_62_538 | 157 |
| 284 | 3300048925 | Ga0496122_0001123 | Ga0496122_0001123_29960_30439 | 157 |
| 285 | 3300048926 | Ga0496123_0000957 | Ga0496123_0000957_14775_15254 | 157 |
| 286 | 3300048927 | Ga0496124_0308592 | Ga0496124_0308592_455_928 | 157 |
| 287 | 3300049459 | Ga0495678_081271 | Ga0495678_081271_43_516 | 157 |
| 288 | 3300049744 | Ga0501083_0085260 | Ga0501083_0085260_264_743 | 157 |
| 289 | 3300049824 | Ga0501045_0616128 | Ga0501045_0616128_62_544 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2imj-assembly2.cif.gz_D | x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. | 0.999 | 5 | 153 |
| 2imj-assembly2.cif.gz_D | x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. | 0.9665 | 5 | 153 |
| 3ebt-assembly1.cif.gz_A-2 | crystal structure of a ntf2-like protein of unknown function (bpss0132) from burkholderia pseudomallei k96243 at 1.30 a resolution | 0.8821 | 17 | 127 |
| 1cqs-assembly1.cif.gz_B | crystal structure of d103e mutant with equilenineof ksi in pseudomonas putida | 0.8752 | 13 | 124 |
| 1dmm-assembly1.cif.gz_A-2 | crystal structures of mutant enzymes y57f of ketosteroid isomerase from pseudomonas putida biotype b | 0.8751 | 12 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2imjD01 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9989 | 13 | 153 | 3.10.450.50 |
| 2imjD01 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9847 | 13 | 153 | 3.10.450.50 |
| af_A0A1D8PLG7_39_140_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.89 | 40 | 127 | 3.10.450.50 |
| 3ebtA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8712 | 17 | 127 | 3.10.450.50 |
| 4u13B00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8606 | 21 | 125 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A176FRT9-F1-model_v4 | DUF4440 domain-containing protein | 1.005 | 5 | 122 |
|
| AF-A0A529HV08-F1-model_v4 | deleted | 1.005 | 6 | 93 |
|
| AF-A0A1M5PD77-F1-model_v4 | DUF4440 domain-containing protein | 1.004 | 9 | 136 |
|
| AF-A0A436F433-F1-model_v4 | DUF1348 family protein | 1.004 | 6 | 106 |
|
| AF-A0A533J3Y5-F1-model_v4 | deleted | 1.004 | 6 | 104 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar