F389226

General Info

Members Datasets Scaffolds Average Seq Length
289 177 578 203

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10140896|Ga0207645_101408962
Length 227
Sequence VRYCTIGFDPIANLDDGDMWPTSFAILEIGPAEGRRVTVARTTDETDITITLGIDGEGHRAIDTGIGFYDHLLGSMAHHGLFDLAISSDGDLQVDEHHTVEDVALVLGSAFATALGDRAGIARFGESAVPMDEAIARAVVDIGGRPYAVVELPFRGERVGNLPLQLVEHAIEAFARTAGFTIHLTGTGRNDHHLAEAAFKALGRALRVACEPDPRRTGVASTKGVLG

Samples

Sample ID Description Type Environment
1 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
69 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
70 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
71 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
72 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
73 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
74 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
75 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
78 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
101 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
102 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
108 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
173 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.76
Rhizosphere 87.89
Stem 0
Stem Tuber 0
Unclassified 5.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207645_10140896 3300025907 Bacteria 1571
2 Ga0065707_10413157 3300005295 Bacteria 839
3 Ga0070676_10358236 3300005328 Bacteria 1005
4 Ga0068869_100584086 3300005334 Bacteria 942
5 Ga0070666_10436124 3300005335 Bacteria 945
6 Ga0070671_100289847 3300005355 Bacteria 1393
7 Ga0070674_100081108 3300005356 Bacteria 2318
8 Ga0070659_100334506 3300005366 Bacteria 1268
9 Ga0070705_100021961 3300005440 Bacteria 3402
10 Ga0070700_100313106 3300005441 Archaea 1150
11 Ga0070694_100192896 3300005444 Bacteria 1514
12 Ga0070708_100065329 3300005445 Bacteria 3262
13 Ga0070708_100078744 3300005445 Bacteria 2980
14 Ga0070708_100235661 3300005445 Bacteria 1718
15 Ga0070708_100340685 3300005445 Bacteria 1413
16 Ga0070678_100072498 3300005456 Bacteria 2582
17 Ga0070681_10075291 3300005458 Bacteria 3336
18 Ga0070681_10545614 3300005458 Bacteria 1073
19 Ga0070706_100000277 3300005467 Bacteria 62380
20 Ga0070706_100001715 3300005467 Bacteria 22785
21 Ga0070706_100159101 3300005467 Bacteria 2109
22 Ga0070706_100767593 3300005467 Bacteria 893
23 Ga0070707_100000029 3300005468 Bacteria 123116
24 Ga0070707_100001138 3300005468 Bacteria 26187
25 Ga0070707_100003179 3300005468 Bacteria 15536
26 Ga0070707_100008539 3300005468 Bacteria 9519
27 Ga0070707_100068666 3300005468 Bacteria 3412
28 Ga0070707_100185965 3300005468 Bacteria 2026
29 Ga0070698_100000166 3300005471 Bacteria 60815
30 Ga0070698_100012745 3300005471 Bacteria 8904
31 Ga0070698_100046913 3300005471 Bacteria 4417
32 Ga0070698_100087261 3300005471 Bacteria 3106
33 Ga0070698_100498242 3300005471 Bacteria 1156
34 Ga0070698_100520701 3300005471 Bacteria 1128
35 Ga0070699_100004988 3300005518 Bacteria 11699
36 Ga0070699_100056175 3300005518 Bacteria 3409
37 Ga0070699_100062272 3300005518 Bacteria 3233
38 Ga0070699_100268925 3300005518 Bacteria 1525
39 Ga0070679_100077820 3300005530 Bacteria 3306
40 Ga0070697_100000003 3300005536 Bacteria 322584
41 Ga0070697_100011916 3300005536 Bacteria 6807
42 Ga0070697_100231839 3300005536 Bacteria 1575
43 Ga0070695_100028528 3300005545 Bacteria 3464
44 Ga0070695_100161622 3300005545 Archaea 1572
45 Ga0070695_100270288 3300005545 Bacteria 1245
46 Ga0070696_100003859 3300005546 Bacteria 10009
47 Ga0070696_100004166 3300005546 Bacteria 9634
48 Ga0070696_100052412 3300005546 Bacteria 2838
49 Ga0070696_100209515 3300005546 Bacteria 1458
50 Ga0070704_100086208 3300005549 Bacteria 2326
51 Ga0070704_100393418 3300005549 Archaea 1181
52 Ga0068855_100090306 3300005563 Bacteria 3535
53 Ga0068855_100293278 3300005563 Bacteria 1803
54 Ga0068856_100236315 3300005614 Bacteria 1843
55 Ga0068859_100232965 3300005617 Bacteria 1930
56 Ga0068864_100185696 3300005618 Bacteria 1903
57 Ga0068858_100625800 3300005842 Bacteria 1045
58 Ga0068860_100429189 3300005843 Bacteria 1311
59 Ga0068862_100024309 3300005844 Bacteria 5083
60 Ga0075428_100000397 3300006844 Bacteria 43115
61 Ga0075431_100151356 3300006847 Bacteria 2389
62 Ga0075433_10052138 3300006852 Bacteria 3564
63 Ga0075434_100104861 3300006871 Bacteria 2837
64 Ga0075434_100190502 3300006871 Bacteria 2071
65 Ga0075434_100878355 3300006871 Bacteria 912
66 Ga0068865_100113321 3300006881 Bacteria 2004
67 Ga0097620_100232957 3300006931 Bacteria 1930
68 Ga0075435_100319550 3300007076 Unclassified 1329
69 Ga0111539_10311895 3300009094 Bacteria 1831
70 Ga0111539_10369728 3300009094 Bacteria 1669
71 Ga0105245_10477498 3300009098 Bacteria 1259
72 Ga0105245_10511851 3300009098 Bacteria 1218
73 Ga0105245_11172627 3300009098 Bacteria 816
74 Ga0114129_10004865 3300009147 Bacteria 18955
75 Ga0105242_10285508 3300009176 Bacteria 1501
76 Ga0105242_10302833 3300009176 Bacteria 1460
77 Ga0105248_10320840 3300009177 Bacteria 1745
78 Ga0105248_10819261 3300009177 Bacteria 1051
79 Ga0105249_10512656 3300009553 Bacteria 1246
80 Ga0105239_10272604 3300010375 Bacteria 1903
81 Ga0105246_10336801 3300011119 Bacteria 1231
82 Ga0157326_1023992 3300012513 Bacteria 771
83 Ga0163163_10088028 3300014325 Bacteria 3117
84 Ga0163163_10752176 3300014325 Bacteria 1038
85 Ga0157380_10106635 3300014326 Bacteria 2345
86 Ga0157379_10586487 3300014968 Bacteria 1039
87 Ga0157376_10171467 3300014969 Bacteria 1976
88 Ga0207684_10000008 3300025910 Bacteria 601602
89 Ga0207684_10009188 3300025910 Bacteria 8744
90 Ga0207684_10036379 3300025910 Bacteria 4179
91 Ga0207684_10137634 3300025910 Bacteria 2098
92 Ga0207652_10224288 3300025921 Bacteria 1693
93 Ga0207646_10000142 3300025922 Bacteria 98159
94 Ga0207646_10000475 3300025922 Bacteria 53587
95 Ga0207646_10001758 3300025922 Bacteria 26266
96 Ga0207646_10001760 3300025922 Bacteria 26247
97 Ga0207646_10524600 3300025922 Bacteria 1066
98 Ga0207646_11081725 3300025922 Bacteria 706
99 Ga0207687_10076553 3300025927 Bacteria 2404
100 Ga0207644_10250595 3300025931 Bacteria 1413
101 Ga0207706_10884499 3300025933 Bacteria 755
102 Ga0207709_10506753 3300025935 Bacteria 943
103 Ga0207709_10788535 3300025935 Bacteria 766
104 Ga0207669_10024527 3300025937 Bacteria 3243
105 Ga0207669_10246143 3300025937 Archaea 1328
106 Ga0207704_10092845 3300025938 Bacteria 1988
107 Ga0207711_10228486 3300025941 Bacteria 1704
108 Ga0207712_10364169 3300025961 Bacteria 1205
109 Ga0207640_10589111 3300025981 Bacteria 940
110 Ga0207677_10486235 3300026023 Bacteria 1065
111 Ga0207648_10898714 3300026089 Bacteria 827
112 Ga0207675_100307913 3300026118 Bacteria 1544
113 Ga0207683_10169391 3300026121 Bacteria 1977
114 Ga0209974_10130198 3300027876 Unclassified 897
115 Ga0265337_1047483 3300028556 Bacteria 1217
116 Ga0265326_10002142 3300028558 Bacteria 6707
117 Ga0265326_10031107 3300028558 Bacteria 1520
118 Ga0265319_1002527 3300028563 Bacteria 9912
119 Ga0265334_10007129 3300028573 Bacteria 4796
120 Ga0265334_10008569 3300028573 Bacteria 4344
121 Ga0265334_10087911 3300028573 Bacteria 1137
122 Ga0265318_10010712 3300028577 Bacteria 3983
123 Ga0265323_10047176 3300028653 Bacteria 1542
124 Ga0265323_10047920 3300028653 Bacteria 1527
125 Ga0265322_10028183 3300028654 Bacteria 1605
126 Ga0265336_10022539 3300028666 Bacteria 2004
127 Ga0265336_10094982 3300028666 Archaea 888
128 Ga0265324_10008140 3300029957 Bacteria 4191
129 Ga0265330_10227893 3300031235 Bacteria 786
130 Ga0265328_10121565 3300031239 Unclassified 974
131 Ga0265320_10014560 3300031240 Bacteria 4471
132 Ga0265320_10159560 3300031240 Archaea 1016
133 Ga0265320_10191109 3300031240 Bacteria 915
134 Ga0265325_10016027 3300031241 Bacteria 4195
135 Ga0265325_10017629 3300031241 Bacteria 3968
136 Ga0265325_10253830 3300031241 Archaea 795
137 Ga0265329_10014029 3300031242 Bacteria 2839
138 Ga0265329_10159150 3300031242 Unclassified 733
139 Ga0265340_10015290 3300031247 Bacteria 3990
140 Ga0265340_10233047 3300031247 Bacteria 823
141 Ga0265339_10024550 3300031249 Bacteria 3472
142 Ga0265339_10025434 3300031249 Bacteria 3397
143 Ga0265331_10058517 3300031250 Bacteria 1825
144 Ga0265316_10062848 3300031344 Bacteria 2881
145 Ga0265316_10063540 3300031344 Bacteria 2862
146 Ga0265316_10133818 3300031344 Bacteria 1866
147 Ga0265316_10193820 3300031344 Bacteria 1508
148 Ga0265316_10606187 3300031344 Bacteria 776
149 Ga0265313_10110544 3300031595 Unclassified 1209
150 Ga0316575_10092436 3300031665 Bacteria 1226
151 Ga0265314_10006524 3300031711 Bacteria 10302
152 Ga0265314_10175845 3300031711 Bacteria 1288
153 Ga0265342_10038028 3300031712 Bacteria 2933
154 Ga0265342_10069377 3300031712 Bacteria 2058
155 Ga0316576_10017174 3300031727 Bacteria 4909
156 Ga0316576_10099457 3300031727 Bacteria 2173
157 Ga0316576_10235602 3300031727 Bacteria 1376
158 Ga0316578_10053288 3300031728 Bacteria 2370
159 Ga0316578_10135075 3300031728 Bacteria 1485
160 Ga0307405_10019819 3300031731 Bacteria 3746
161 Ga0316577_10032348 3300031733 Bacteria 2922
162 Ga0307413_10668132 3300031824 Bacteria 859
163 Ga0307410_10392241 3300031852 Bacteria 1120
164 Ga0307412_11037909 3300031911 Bacteria 726
165 Ga0307409_100043394 3300031995 Bacteria 3376
166 Ga0307409_100211862 3300031995 Bacteria 1742
167 Ga0307416_100027717 3300032002 Bacteria 4200
168 Ga0307415_100795683 3300032126 Unclassified 863
169 Ga0316583_10049042 3300032133 Bacteria 1486
170 Ga0316585_10179329 3300032137 Bacteria 700
171 Ga0373941_0055710 3300035115 Archaea 1272
172 Ga0373943_0106258 3300035170 Bacteria 1475
173 Ga0316574_0124686 3300035398 Bacteria 1655
174 Ga0316574_0199602 3300035398 Bacteria 1285
175 Ga0373931_0227032 3300035691 Bacteria 1127
176 Ga0373937_0141186 3300036401 Bacteria 2254
177 Ga0373937_0744267 3300036401 Bacteria 928
178 Ga0316582_0068587 3300036647 Bacteria 2290
179 Ga0316584_0036017 3300036712 Bacteria 3672
180 Ga0373925_0084918 3300037068 Bacteria 2413
181 Ga0395900_0868659 3300037418 Archaea 827
182 Ga0395905_0488753 3300037471 Archaea 1131
183 Ga0395901_0371102 3300038443 Bacteria 1474
184 Ga0439438_047437 3300041405 Bacteria 1101
185 Ga0451853_1155148 3300041512 Bacteria 2325
186 Ga0439446_0007941 3300042156 Bacteria 2804
187 Ga0453684_1021628 3300044712 Unclassified 878
188 Ga0495641_0066996 3300046461 Bacteria 1615
189 Ga0495651_0062682 3300046462 Bacteria 2844
190 Ga0495584_0329269 3300046491 Bacteria 776
191 Ga0495630_0135405 3300046517 Bacteria 1872
192 Ga0495630_0286848 3300046517 Bacteria 1258
193 Ga0495652_0491955 3300046529 Bacteria 852
194 Ga0495667_0180041 3300046559 Bacteria 1357
195 Ga0495623_0282266 3300046679 Archaea 923
196 Ga0495658_0233095 3300046683 Bacteria 1155
197 Ga0495600_0108329 3300046809 Bacteria 1810
198 Ga0495604_0764517 3300047317 Bacteria 610
199 Ga0495674_0516070 3300047319 Bacteria 954
200 Ga0495676_0376160 3300047321 Bacteria 946
201 Ga0495680_0185711 3300047322 Bacteria 1498
202 Ga0495684_0482027 3300047471 Bacteria 856
203 Ga0496100_0008507 3300048903 Bacteria 5725
204 Ga0496101_0044971 3300048904 Bacteria 3161
205 Ga0496101_0674922 3300048904 Unclassified 816
206 Ga0496101_0696571 3300048904 Bacteria 802
207 Ga0496102_0234076 3300048905 Unclassified 1732
208 Ga0496102_0468711 3300048905 Bacteria 1180
209 Ga0496104_0020069 3300048907 Bacteria 6122
210 Ga0496104_0161384 3300048907 Bacteria 2150
211 Ga0496104_0292286 3300048907 Bacteria 1542
212 Ga0496104_0463889 3300048907 Bacteria 1178
213 Ga0496104_0572529 3300048907 Unclassified 1040
214 Ga0496105_0021898 3300048908 Bacteria 5173
215 Ga0496105_0106105 3300048908 Bacteria 2319
216 Ga0496105_0582639 3300048908 Unclassified 870
217 Ga0496106_0110186 3300048909 Bacteria 2143
218 Ga0496106_0211578 3300048909 Bacteria 1545
219 Ga0496106_0865275 3300048909 Unclassified 715
220 Ga0496107_0177046 3300048910 Bacteria 1584
221 Ga0496107_0288837 3300048910 Archaea 1221
222 Ga0496108_0025151 3300048911 Bacteria 4905
223 Ga0496108_0032796 3300048911 Bacteria 4313
224 Ga0496108_0052760 3300048911 Bacteria 3409
225 Ga0496108_0414826 3300048911 Archaea 1176
226 Ga0496109_0018372 3300048912 Bacteria 6143
227 Ga0496109_0181663 3300048912 Bacteria 1976
228 Ga0496110_0031523 3300048913 Bacteria 4574
229 Ga0496110_0099611 3300048913 Bacteria 2605
230 Ga0496111_0021956 3300048914 Bacteria 4463
231 Ga0496111_0186784 3300048914 Bacteria 1541
232 Ga0496112_0317085 3300048915 Unclassified 1504
233 Ga0496113_0152894 3300048916 Bacteria 1821
234 Ga0496113_0418573 3300048916 Unclassified 1076
235 Ga0496113_0882850 3300048916 Bacteria 708
236 Ga0496114_0027829 3300048917 Bacteria 4634
237 Ga0501036_0368230 3300049572 Bacteria 1199
238 Ga0501036_0525937 3300049572 Bacteria 983
239 Ga0501037_0107530 3300049573 Bacteria 2010
240 Ga0501038_0306823 3300049574 Bacteria 1244
241 Ga0501039_0215060 3300049575 Bacteria 1511
242 Ga0501040_0046962 3300049576 Bacteria 2948
243 Ga0501040_0315234 3300049576 Bacteria 1118
244 Ga0501041_0025954 3300049577 Bacteria 3523
245 Ga0501041_0156175 3300049577 Bacteria 1425
246 Ga0501041_0391919 3300049577 Archaea 879
247 Ga0501042_0163992 3300049578 Bacteria 1603
248 Ga0501046_0252735 3300049580 Bacteria 1297
249 Ga0501048_0153581 3300049582 Bacteria 1628
250 Ga0501068_0093685 3300049584 Bacteria 1856
251 Ga0501069_0098939 3300049585 Bacteria 1655
252 Ga0501071_0058589 3300049587 Bacteria 2785
253 Ga0501071_0181403 3300049587 Bacteria 1577
254 Ga0501072_0050160 3300049588 Bacteria 3286
255 Ga0501072_0175104 3300049588 Bacteria 1711
256 Ga0501073_0359405 3300049589 Bacteria 1006
257 Ga0501074_0046526 3300049590 Bacteria 3137
258 Ga0501075_0021131 3300049591 Bacteria 4742
259 Ga0501075_0059187 3300049591 Bacteria 2885
260 Ga0501075_0165068 3300049591 Bacteria 1689
261 Ga0501075_0280459 3300049591 Archaea 1270
262 Ga0501076_0006428 3300049592 Bacteria 8521
263 Ga0501076_0134293 3300049592 Bacteria 2008
264 Ga0501076_0217558 3300049592 Bacteria 1561
265 Ga0501079_0066702 3300049741 Bacteria 2777
266 Ga0501080_0099055 3300049742 Bacteria 2705
267 Ga0501080_0729098 3300049742 Archaea 873
268 Ga0501081_0091730 3300049743 Bacteria 2137
269 Ga0501081_0269893 3300049743 Bacteria 1244
270 Ga0501081_0335770 3300049743 Bacteria 1112
271 Ga0501081_0515266 3300049743 Bacteria 892
272 Ga0501035_0262391 3300049822 Bacteria 1464
273 Ga0501045_0188880 3300049824 Bacteria 1535
274 Ga0501045_0194199 3300049824 Bacteria 1513
275 Ga0501045_0330997 3300049824 Bacteria 1133
276 nmdc:mga05p37_1732_c1 3300050507 Bacteria 25468
277 nmdc:mga05p37_309896_c1 3300050507 Bacteria 1871
278 nmdc:mga06r32_238732_c1 3300050510 Bacteria 1805
279 nmdc:mga08y16_165488_c1 3300050511 Bacteria 2297
280 nmdc:mga0n895_406169_c1 3300050512 Unclassified 1377
281 Ga0495601_0048111 3300053077 Bacteria 2686
282 Ga0495601_0070721 3300053077 Bacteria 2228
283 Ga0495612_0056096 3300053078 Bacteria 1625
284 Ga0495595_0141184 3300053084 Bacteria 1182
285 Ga0495619_0595258 3300053085 Bacteria 757
286 Ga0501084_0065508 3300054114 Bacteria 3040
287 Ga0501084_0602268 3300054114 Bacteria 928
288 Ga0501082_0907954 3300060353 Bacteria 770
289 Ga0530510_0026212 3300061734 Bacteria 4170
290 Ga0207645_10140896
291 Ga0065707_10413157
292 Ga0070676_10358236
293 Ga0068869_100584086
294 Ga0070666_10436124
295 Ga0070671_100289847
296 Ga0070674_100081108
297 Ga0070659_100334506
298 Ga0070705_100021961
299 Ga0070700_100313106
300 Ga0070694_100192896
301 Ga0070708_100065329
302 Ga0070708_100078744
303 Ga0070708_100235661
304 Ga0070708_100340685
305 Ga0070678_100072498
306 Ga0070681_10075291
307 Ga0070681_10545614
308 Ga0070706_100000277
309 Ga0070706_100001715
310 Ga0070706_100159101
311 Ga0070706_100767593
312 Ga0070707_100000029
313 Ga0070707_100001138
314 Ga0070707_100003179
315 Ga0070707_100008539
316 Ga0070707_100068666
317 Ga0070707_100185965
318 Ga0070698_100000166
319 Ga0070698_100012745
320 Ga0070698_100046913
321 Ga0070698_100087261
322 Ga0070698_100498242
323 Ga0070698_100520701
324 Ga0070699_100004988
325 Ga0070699_100056175
326 Ga0070699_100062272
327 Ga0070699_100268925
328 Ga0070679_100077820
329 Ga0070697_100000003
330 Ga0070697_100011916
331 Ga0070697_100231839
332 Ga0070695_100028528
333 Ga0070695_100161622
334 Ga0070695_100270288
335 Ga0070696_100003859
336 Ga0070696_100004166
337 Ga0070696_100052412
338 Ga0070696_100209515
339 Ga0070704_100086208
340 Ga0070704_100393418
341 Ga0068855_100090306
342 Ga0068855_100293278
343 Ga0068856_100236315
344 Ga0068859_100232965
345 Ga0068864_100185696
346 Ga0068858_100625800
347 Ga0068860_100429189
348 Ga0068862_100024309
349 Ga0075428_100000397
350 Ga0075431_100151356
351 Ga0075433_10052138
352 Ga0075434_100104861
353 Ga0075434_100190502
354 Ga0075434_100878355
355 Ga0068865_100113321
356 Ga0097620_100232957
357 Ga0075435_100319550
358 Ga0111539_10311895
359 Ga0111539_10369728
360 Ga0105245_10477498
361 Ga0105245_10511851
362 Ga0105245_11172627
363 Ga0114129_10004865
364 Ga0105242_10285508
365 Ga0105242_10302833
366 Ga0105248_10320840
367 Ga0105248_10819261
368 Ga0105249_10512656
369 Ga0105239_10272604
370 Ga0105246_10336801
371 Ga0157326_1023992
372 Ga0163163_10088028
373 Ga0163163_10752176
374 Ga0157380_10106635
375 Ga0157379_10586487
376 Ga0157376_10171467
377 Ga0207684_10000008
378 Ga0207684_10009188
379 Ga0207684_10036379
380 Ga0207684_10137634
381 Ga0207652_10224288
382 Ga0207646_10000142
383 Ga0207646_10000475
384 Ga0207646_10001758
385 Ga0207646_10001760
386 Ga0207646_10524600
387 Ga0207646_11081725
388 Ga0207687_10076553
389 Ga0207644_10250595
390 Ga0207706_10884499
391 Ga0207709_10506753
392 Ga0207709_10788535
393 Ga0207669_10024527
394 Ga0207669_10246143
395 Ga0207704_10092845
396 Ga0207711_10228486
397 Ga0207712_10364169
398 Ga0207640_10589111
399 Ga0207677_10486235
400 Ga0207648_10898714
401 Ga0207675_100307913
402 Ga0207683_10169391
403 Ga0209974_10130198
404 Ga0265337_1047483
405 Ga0265326_10002142
406 Ga0265326_10031107
407 Ga0265319_1002527
408 Ga0265334_10007129
409 Ga0265334_10008569
410 Ga0265334_10087911
411 Ga0265318_10010712
412 Ga0265323_10047176
413 Ga0265323_10047920
414 Ga0265322_10028183
415 Ga0265336_10022539
416 Ga0265336_10094982
417 Ga0265324_10008140
418 Ga0265330_10227893
419 Ga0265328_10121565
420 Ga0265320_10014560
421 Ga0265320_10159560
422 Ga0265320_10191109
423 Ga0265325_10016027
424 Ga0265325_10017629
425 Ga0265325_10253830
426 Ga0265329_10014029
427 Ga0265329_10159150
428 Ga0265340_10015290
429 Ga0265340_10233047
430 Ga0265339_10024550
431 Ga0265339_10025434
432 Ga0265331_10058517
433 Ga0265316_10062848
434 Ga0265316_10063540
435 Ga0265316_10133818
436 Ga0265316_10193820
437 Ga0265316_10606187
438 Ga0265313_10110544
439 Ga0316575_10092436
440 Ga0265314_10006524
441 Ga0265314_10175845
442 Ga0265342_10038028
443 Ga0265342_10069377
444 Ga0316576_10017174
445 Ga0316576_10099457
446 Ga0316576_10235602
447 Ga0316578_10053288
448 Ga0316578_10135075
449 Ga0307405_10019819
450 Ga0316577_10032348
451 Ga0307413_10668132
452 Ga0307410_10392241
453 Ga0307412_11037909
454 Ga0307409_100043394
455 Ga0307409_100211862
456 Ga0307416_100027717
457 Ga0307415_100795683
458 Ga0316583_10049042
459 Ga0316585_10179329
460 Ga0373941_0055710
461 Ga0373943_0106258
462 Ga0316574_0124686
463 Ga0316574_0199602
464 Ga0373931_0227032
465 Ga0373937_0141186
466 Ga0373937_0744267
467 Ga0316582_0068587
468 Ga0316584_0036017
469 Ga0373925_0084918
470 Ga0395900_0868659
471 Ga0395905_0488753
472 Ga0395901_0371102
473 Ga0439438_047437
474 Ga0451853_1155148
475 Ga0439446_0007941
476 Ga0453684_1021628
477 Ga0495641_0066996
478 Ga0495651_0062682
479 Ga0495584_0329269
480 Ga0495630_0135405
481 Ga0495630_0286848
482 Ga0495652_0491955
483 Ga0495667_0180041
484 Ga0495623_0282266
485 Ga0495658_0233095
486 Ga0495600_0108329
487 Ga0495604_0764517
488 Ga0495674_0516070
489 Ga0495676_0376160
490 Ga0495680_0185711
491 Ga0495684_0482027
492 Ga0496100_0008507
493 Ga0496101_0044971
494 Ga0496101_0674922
495 Ga0496101_0696571
496 Ga0496102_0234076
497 Ga0496102_0468711
498 Ga0496104_0020069
499 Ga0496104_0161384
500 Ga0496104_0292286
501 Ga0496104_0463889
502 Ga0496104_0572529
503 Ga0496105_0021898
504 Ga0496105_0106105
505 Ga0496105_0582639
506 Ga0496106_0110186
507 Ga0496106_0211578
508 Ga0496106_0865275
509 Ga0496107_0177046
510 Ga0496107_0288837
511 Ga0496108_0025151
512 Ga0496108_0032796
513 Ga0496108_0052760
514 Ga0496108_0414826
515 Ga0496109_0018372
516 Ga0496109_0181663
517 Ga0496110_0031523
518 Ga0496110_0099611
519 Ga0496111_0021956
520 Ga0496111_0186784
521 Ga0496112_0317085
522 Ga0496113_0152894
523 Ga0496113_0418573
524 Ga0496113_0882850
525 Ga0496114_0027829
526 Ga0501036_0368230
527 Ga0501036_0525937
528 Ga0501037_0107530
529 Ga0501038_0306823
530 Ga0501039_0215060
531 Ga0501040_0046962
532 Ga0501040_0315234
533 Ga0501041_0025954
534 Ga0501041_0156175
535 Ga0501041_0391919
536 Ga0501042_0163992
537 Ga0501046_0252735
538 Ga0501048_0153581
539 Ga0501068_0093685
540 Ga0501069_0098939
541 Ga0501071_0058589
542 Ga0501071_0181403
543 Ga0501072_0050160
544 Ga0501072_0175104
545 Ga0501073_0359405
546 Ga0501074_0046526
547 Ga0501075_0021131
548 Ga0501075_0059187
549 Ga0501075_0165068
550 Ga0501075_0280459
551 Ga0501076_0006428
552 Ga0501076_0134293
553 Ga0501076_0217558
554 Ga0501079_0066702
555 Ga0501080_0099055
556 Ga0501080_0729098
557 Ga0501081_0091730
558 Ga0501081_0269893
559 Ga0501081_0335770
560 Ga0501081_0515266
561 Ga0501035_0262391
562 Ga0501045_0188880
563 Ga0501045_0194199
564 Ga0501045_0330997
565 nmdc:mga05p37_1732_c1
566 nmdc:mga05p37_309896_c1
567 nmdc:mga06r32_238732_c1
568 nmdc:mga08y16_165488_c1
569 nmdc:mga0n895_406169_c1
570 Ga0495601_0048111
571 Ga0495601_0070721
572 Ga0495612_0056096
573 Ga0495595_0141184
574 Ga0495619_0595258
575 Ga0501084_0065508
576 Ga0501084_0602268
577 Ga0501082_0907954
578 Ga0530510_0026212

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

64

206

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9638 19 187
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9622 19 188
4mu3-assembly1.cif.gz_A the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution 0.9618 19 189
5el9-assembly1.cif.gz_A a. thaliana igpd2 in complex with the triazole-phosphonate inhibitor, (s)-c348, to 1.1a resolution 0.9504 19 196
4mu4-assembly1.cif.gz_A the form b structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and its substrate, 2r3s-igp, to 1.41 a resolution 0.9475 14 196
ID Description Score Start End Superfamily
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9855 95 183 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9726 95 187 3.30.230.40
2ae8A02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9608 95 183 3.30.230.40
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9538 95 183 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9526 95 187 3.30.230.40
ID Description Score Start End GO Terms
AF-Q17UV3-F1-model_v4 Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19) 0.9884 36 181 GO:0000105
GO:0004424
AF-Q17UV5-F1-model_v4 Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19) 0.9869 37 178 GO:0000105
GO:0004424
AF-T1LL58-F1-model_v4 deleted 0.9836 46 187
AF-Q56US8-F1-model_v4 Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19) 0.9836 54 180 GO:0000105
GO:0004424
AF-A0A2U3E5T6-F1-model_v4 Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19) 0.9826 16 184 GO:0000105
GO:0004424

Map