F388909

General Info

Members Datasets Scaffolds Average Seq Length
288 198 576 215

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2857576091|2857580632
Length 220
Sequence SHAAVPLRRTGLLDALINEVDRGLQVLSGAVRASRPNPAGRADVGMDAAMTPEERRHAAGLMRVNHVGEVCAQALYRGQAAMTRNAGTRTLLEHAAAEEVDHLAWLNERLNELGARPSLLNPVWYAGAFSLGLLAGRVGDAVSLGFMAETERQVEAHLDSHLEDLPASDLRSRRIVAQMCEDERGHRVTAQQHGGVDLPAPVRAGMRASAKVMTTTAYRI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
4 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
40 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
41 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
45 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
71 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
89 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
90 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
91 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
92 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
93 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
94 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
95 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
96 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
97 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
98 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
99 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
100 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
107 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
108 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
111 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
112 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
113 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
118 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
121 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
130 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
133 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
157 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
162 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
163 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
164 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
165 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
166 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
167 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
168 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
169 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
170 2643221695 Lysobacter sp. Root494 Isolate Unclassified
171 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
172 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
173 2818991457 Xanthomonas translucens 569 Isolate Unclassified
174 2821131069 Duganella sp. 1224 Isolate Unclassified
175 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
176 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
177 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
178 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
179 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
180 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
181 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
182 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
183 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
184 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
185 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
186 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
187 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
188 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
189 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
190 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
191 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
192 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
193 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
194 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
195 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
196 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
197 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
198 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.5
Metatranscriptomes 0
Isolates 12.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.51
Nodule 0.35
Rhizoplane 5.56
Rhizosphere 70.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_474540 2162886007 Bacteria 2210
2 rootL2_10081468 3300003322 Bacteria 4203
3 rootL2_10167573 3300003322 Bacteria 2929
4 Ga0055529_1000027 3300003763 Bacteria 292744
5 Ga0058692_1000004 3300003856 Bacteria 431119
6 Ga0065714_10009048 3300005288 Bacteria 2401
7 Ga0070670_100000322 3300005331 Bacteria 40720
8 Ga0070670_100046698 3300005331 Bacteria 3724
9 Ga0070670_100191928 3300005331 Bacteria 1774
10 Ga0070677_10124732 3300005333 Bacteria 1168
11 Ga0068869_100100405 3300005334 Bacteria 2188
12 Ga0070668_100070120 3300005347 Bacteria 2728
13 Ga0070668_100149538 3300005347 Bacteria 1887
14 Ga0070671_100012332 3300005355 Bacteria 6881
15 Ga0070671_100033045 3300005355 Bacteria 4277
16 Ga0070671_100549853 3300005355 Bacteria 995
17 Ga0070659_100313367 3300005366 Bacteria 1310
18 Ga0070667_100051063 3300005367 Bacteria 3486
19 Ga0070667_100818994 3300005367 Bacteria 865
20 Ga0070663_100942693 3300005455 Bacteria 748
21 Ga0070678_100059420 3300005456 Bacteria 2810
22 Ga0070678_100099165 3300005456 Bacteria 2254
23 Ga0068853_100314401 3300005539 Bacteria 1451
24 Ga0070672_100094387 3300005543 Bacteria 2418
25 Ga0070693_100006639 3300005547 Bacteria 5617
26 Ga0070665_100019287 3300005548 Bacteria 6843
27 Ga0070664_100348989 3300005564 Bacteria 1346
28 Ga0068854_100933075 3300005578 Bacteria 765
29 Ga0068859_100164111 3300005617 Bacteria 2300
30 Ga0068861_100569194 3300005719 Bacteria 1035
31 Ga0075364_10001058 3300006051 Bacteria 14669
32 Ga0075364_10114201 3300006051 Bacteria 1804
33 Ga0068871_100064949 3300006358 Bacteria 2988
34 Ga0097620_100164105 3300006931 Bacteria 2300
35 Ga0105251_10000077 3300009011 Bacteria 93505
36 Ga0105244_10037250 3300009036 Bacteria 2544
37 Ga0105240_10010018 3300009093 Bacteria 13351
38 Ga0105240_10477821 3300009093 Bacteria 1390
39 Ga0105248_10009377 3300009177 Bacteria 10774
40 Ga0157327_1000893 3300012512 Bacteria 1746
41 Ga0157373_10142546 3300013100 Bacteria 1685
42 Ga0157369_10077822 3300013105 Bacteria 3555
43 Ga0157374_10105444 3300013296 Bacteria 2707
44 Ga0157378_10275849 3300013297 Bacteria 1619
45 Ga0163162_10103277 3300013306 Bacteria 2944
46 Ga0157372_10053979 3300013307 Bacteria 4480
47 Ga0157375_10001924 3300013308 Bacteria 17865
48 Ga0157375_10036944 3300013308 Bacteria 4676
49 Ga0157375_10721134 3300013308 Bacteria 1150
50 Ga0182008_10000056 3300014497 Bacteria 101905
51 Ga0182006_1000030 3300015261 Bacteria 242894
52 Ga0182007_10000037 3300015262 Bacteria 123677
53 Ga0182005_1000021 3300015265 Bacteria 272185
54 Ga0163161_10165179 3300017792 Bacteria 1690
55 Ga0163161_10172644 3300017792 Bacteria 1654
56 Ga0209674_101745 3300025226 Bacteria 5331
57 Ga0209437_100931 3300025233 Bacteria 11096
58 Ga0209148_1002030 3300025254 Bacteria 7881
59 Ga0209455_1000033 3300025272 Bacteria 504606
60 Ga0209676_1007998 3300025292 Bacteria 4818
61 Ga0209257_1000067 3300025304 Bacteria 342468
62 Ga0207713_1000381 3300025735 Bacteria 48031
63 Ga0207695_10015421 3300025913 Bacteria 8997
64 Ga0207657_10032873 3300025919 Bacteria 4681
65 Ga0207652_10115570 3300025921 Bacteria 2383
66 Ga0207681_10006857 3300025923 Bacteria 6985
67 Ga0207681_10361709 3300025923 Bacteria 1164
68 Ga0207650_10027074 3300025925 Bacteria 4099
69 Ga0207650_10106277 3300025925 Bacteria 2167
70 Ga0207650_10293848 3300025925 Bacteria 1325
71 Ga0207644_10043225 3300025931 Bacteria 3196
72 Ga0207706_10153754 3300025933 Bacteria 2024
73 Ga0207669_10022394 3300025937 Bacteria 3356
74 Ga0207691_10004261 3300025940 Bacteria 13886
75 Ga0207691_10148253 3300025940 Bacteria 2064
76 Ga0207711_10002794 3300025941 Bacteria 15353
77 Ga0207679_10078453 3300025945 Bacteria 2515
78 Ga0207668_10020081 3300025972 Bacteria 4237
79 Ga0207641_11069703 3300026088 Bacteria 805
80 Ga0207648_10112755 3300026089 Bacteria 2387
81 Ga0207683_10229346 3300026121 Bacteria 1693
82 Ga0207683_10338273 3300026121 Bacteria 1380
83 Ga0207698_10759331 3300026142 Bacteria 969
84 Ga0209371_1000018 3300027312 Bacteria 614700
85 Ga0209983_1000220 3300027665 Bacteria 11396
86 Ga0209971_1000437 3300027682 Bacteria 11128
87 Ga0209974_10007915 3300027876 Bacteria 3644
88 Ga0209974_10024703 3300027876 Bacteria 1988
89 Ga0268256_1000016 3300030500 Bacteria 614700
90 Ga0316180_1147040 3300030736 Bacteria 890
91 Ga0307509_10266831 3300031507 Bacteria 1482
92 Ga0307408_100125338 3300031548 Bacteria 1996
93 Ga0307405_10210778 3300031731 Bacteria 1418
94 Ga0307413_10004831 3300031824 Bacteria 5921
95 Ga0307413_10016408 3300031824 Bacteria 3825
96 Ga0307413_10426111 3300031824 Bacteria 1046
97 Ga0307410_10466839 3300031852 Bacteria 1033
98 Ga0307410_10951697 3300031852 Bacteria 738
99 Ga0307406_10471395 3300031901 Bacteria 1012
100 Ga0307412_10102059 3300031911 Bacteria 2030
101 Ga0307416_100088334 3300032002 Bacteria 2650
102 Ga0307416_100301943 3300032002 Bacteria 1592
103 Ga0307416_100615957 3300032002 Bacteria 1167
104 Ga0307416_101324335 3300032002 Bacteria 826
105 Ga0307414_10172200 3300032004 Bacteria 1732
106 Ga0307414_10257760 3300032004 Bacteria 1453
107 Ga0307414_10291653 3300032004 Bacteria 1375
108 Ga0307414_10293589 3300032004 Bacteria 1371
109 Ga0307414_10412872 3300032004 Bacteria 1175
110 Ga0307414_10617047 3300032004 Bacteria 974
111 Ga0307411_10027999 3300032005 Bacteria 3419
112 Ga0307411_10029177 3300032005 Bacteria 3365
113 Ga0307411_10074244 3300032005 Bacteria 2316
114 Ga0307411_10216953 3300032005 Bacteria 1481
115 Ga0307411_10345568 3300032005 Bacteria 1211
116 Ga0307415_100060660 3300032126 Bacteria 2615
117 Ga0307415_100435881 3300032126 Bacteria 1129
118 Ga0307415_100790414 3300032126 Bacteria 865
119 Ga0395899_0089751 3300037312 Bacteria 2229
120 Ga0395900_0058779 3300037418 Bacteria 3958
121 Ga0395900_0142764 3300037418 Bacteria 2451
122 Ga0395898_0142930 3300037466 Bacteria 2291
123 Ga0395898_0203912 3300037466 Bacteria 1887
124 Ga0395898_0360716 3300037466 Bacteria 1386
125 Ga0395905_0003783 3300037471 Bacteria 16014
126 Ga0395905_0011004 3300037471 Bacteria 8755
127 Ga0395905_0059813 3300037471 Bacteria 3562
128 Ga0395901_0063125 3300038443 Bacteria 3855
129 Ga0237819_00035 3300038705 Bacteria 46366
130 Ga0439436_0003865 3300041404 Bacteria 4587
131 Ga0439436_0023629 3300041404 Bacteria 1818
132 Ga0439465_0002452 3300041413 Bacteria 6064
133 Ga0451797_1309842 3300041453 Bacteria 1500
134 Ga0451807_2358896 3300041486 Bacteria 913
135 Ga0451837_0147753 3300041494 Bacteria 1070
136 Ga0451837_0767823 3300041494 Bacteria 973
137 Ga0451837_0881631 3300041494 Bacteria 1971
138 Ga0451843_0498232 3300041509 Bacteria 1428
139 Ga0439448_0136336 3300042005 Bacteria 848
140 Ga0439432_020560 3300042006 Bacteria 2193
141 Ga0439432_044631 3300042006 Bacteria 1396
142 Ga0439432_071562 3300042006 Bacteria 1057
143 Ga0439449_0000008 3300042007 Bacteria 62060
144 Ga0439449_0002642 3300042007 Bacteria 6974
145 Ga0439449_0003195 3300042007 Bacteria 6386
146 Ga0439449_0064272 3300042007 Bacteria 1353
147 Ga0439449_0084032 3300042007 Bacteria 1174
148 Ga0439462_0004631 3300042015 Bacteria 3362
149 Ga0439462_0046343 3300042015 Bacteria 1165
150 Ga0450911_005495 3300042115 Bacteria 1963
151 Ga0450908_000117 3300042184 Bacteria 16292
152 Ga0466972_0092230 3300044658 Bacteria 1436
153 Ga0466964_0033988 3300044706 Bacteria 2033
154 Ga0453684_0036674 3300044712 Bacteria 6751
155 Ga0451576_0022979 3300045051 Bacteria 6757
156 Ga0495584_0040353 3300046491 Bacteria 2357
157 Ga0495610_0050655 3300046512 Bacteria 2026
158 Ga0495616_0069817 3300046513 Bacteria 1702
159 Ga0495632_0000014 3300046519 Bacteria 243913
160 Ga0495648_0094398 3300046524 Bacteria 1666
161 Ga0495598_0001041 3300046537 Bacteria 5327
162 Ga0495609_0053504 3300046538 Bacteria 1794
163 Ga0495656_0003190 3300046615 Bacteria 5523
164 Ga0495656_0016914 3300046615 Bacteria 2774
165 Ga0495656_0033889 3300046615 Bacteria 2087
166 Ga0495659_0009383 3300046664 Bacteria 3122
167 Ga0495660_0003084 3300046810 Bacteria 10386
168 Ga0495636_0001234 3300047318 Bacteria 9664
169 Ga0495636_0005678 3300047318 Bacteria 4890
170 Ga0495672_0108126 3300047320 Bacteria 1497
171 Ga0495685_010426 3300047447 Bacteria 3116
172 Ga0495681_0004264 3300047470 Bacteria 9810
173 Ga0495681_0053903 3300047470 Bacteria 1881
174 Ga0495686_0007669 3300047472 Bacteria 8054
175 Ga0495615_0043338 3300048090 Bacteria 1132
176 Ga0495626_0193801 3300048091 Bacteria 836
177 Ga0496100_0437698 3300048903 Bacteria 1001
178 Ga0496107_0578436 3300048910 Bacteria 831
179 Ga0496108_0024210 3300048911 Bacteria 4998
180 Ga0496109_0432953 3300048912 Bacteria 1242
181 Ga0496109_0493296 3300048912 Bacteria 1156
182 Ga0496109_1262728 3300048912 Bacteria 675
183 Ga0496110_0117254 3300048913 Bacteria 2397
184 Ga0496110_0261660 3300048913 Bacteria 1574
185 Ga0496110_0695939 3300048913 Bacteria 918
186 Ga0496112_0897182 3300048915 Bacteria 808
187 Ga0496115_0148216 3300048918 Bacteria 1937
188 Ga0496115_0311012 3300048918 Bacteria 1290
189 Ga0496115_0670202 3300048918 Bacteria 818
190 Ga0496116_0077825 3300048919 Bacteria 2071
191 Ga0496116_0102596 3300048919 Bacteria 1705
192 Ga0496116_0103931 3300048919 Bacteria 1689
193 Ga0496116_0240981 3300048919 Bacteria 908
194 Ga0496117_0000056 3300048920 Bacteria 271417
195 Ga0496117_0001919 3300048920 Bacteria 27825
196 Ga0496117_0268082 3300048920 Bacteria 921
197 Ga0496118_0000047 3300048921 Bacteria 271417
198 Ga0496118_0085572 3300048921 Bacteria 2194
199 Ga0496119_0001413 3300048922 Bacteria 29073
200 Ga0496119_0201246 3300048922 Bacteria 1030
201 Ga0496120_0000162 3300048923 Bacteria 112200
202 Ga0496120_0186711 3300048923 Bacteria 1013
203 Ga0496121_0004406 3300048924 Bacteria 18971
204 Ga0496121_0005981 3300048924 Bacteria 15372
205 Ga0496121_0043119 3300048924 Bacteria 3912
206 Ga0496121_0116900 3300048924 Bacteria 2021
207 Ga0496122_0000049 3300048925 Bacteria 268493
208 Ga0496122_0023037 3300048925 Bacteria 5510
209 Ga0496122_0052585 3300048925 Bacteria 3081
210 Ga0496122_0244154 3300048925 Bacteria 1009
211 Ga0496123_0000042 3300048926 Bacteria 254481
212 Ga0496123_0002489 3300048926 Bacteria 22741
213 Ga0496123_0018272 3300048926 Bacteria 5583
214 Ga0496123_0205221 3300048926 Bacteria 1006
215 Ga0496124_0000621 3300048927 Bacteria 59443
216 Ga0496124_0027755 3300048927 Bacteria 5073
217 Ga0496124_0452102 3300048927 Bacteria 875
218 Ga0496125_0023252 3300048928 Bacteria 5725
219 Ga0496125_0294896 3300048928 Bacteria 996
220 Ga0496126_0137933 3300048929 Bacteria 2102
221 Ga0501290_011091 3300049513 Bacteria 1156
222 Ga0501031_0030071 3300049568 Bacteria 3542
223 Ga0501032_0008408 3300049569 Bacteria 7527
224 Ga0501032_0054134 3300049569 Bacteria 2701
225 Ga0501033_0001438 3300049570 Bacteria 21135
226 Ga0501033_0002236 3300049570 Bacteria 16608
227 Ga0501034_0003550 3300049571 Bacteria 17721
228 Ga0501034_0003962 3300049571 Bacteria 16637
229 Ga0501034_0210082 3300049571 Bacteria 1902
230 Ga0501036_0022817 3300049572 Bacteria 5269
231 Ga0501037_0025171 3300049573 Bacteria 4397
232 Ga0501038_0002917 3300049574 Bacteria 15938
233 Ga0501039_0064626 3300049575 Bacteria 2837
234 Ga0501039_0092411 3300049575 Bacteria 2358
235 Ga0501043_0053329 3300049579 Bacteria 3175
236 Ga0501043_0189261 3300049579 Bacteria 1601
237 Ga0501046_0044638 3300049580 Bacteria 3524
238 Ga0501047_0012326 3300049581 Bacteria 8091
239 Ga0501048_0046092 3300049582 Bacteria 3113
240 Ga0501067_0365577 3300049583 Bacteria 804
241 Ga0501070_0470058 3300049586 Bacteria 1012
242 Ga0501073_0009853 3300049589 Bacteria 7030
243 Ga0501225_0002466 3300049705 Bacteria 5716
244 Ga0501265_003002 3300049762 Bacteria 1918
245 Ga0501035_0003039 3300049822 Bacteria 16092
246 Ga0501035_0118284 3300049822 Bacteria 2318
247 Ga0501044_0015267 3300049823 Bacteria 8273
248 Ga0501044_0620020 3300049823 Bacteria 973
249 nmdc:mga00v17_122595_c1 3300050491 Bacteria 1656
250 nmdc:mga00v17_25_c1 3300050491 Bacteria 101679
251 Ga0500651_0004800 3300053093 Bacteria 7625
252 Ga0500597_151861 3300053120 Bacteria 994
253 2857580632 2857576091 Bacteria 5465855
254 2525558211 2524614729 Bacteria 3091755
255 2572254908 2571042365 Bacteria 3289345
256 2595449123 2593339238 Bacteria 4182970
257 2595452782 2593339239 Bacteria 4124669
258 2601671939 2600255292 Bacteria 6300551
259 2630650014 2627854209 Bacteria 3093011
260 2644530635 2643221695 Bacteria 3441323
261 2765580829 2765235840 Bacteria 4663337
262 2816518182 2816332141 Bacteria 4436036
263 2819662217 2818991457 Bacteria 5323295
264 2821136184 2821131069 Bacteria 6108407
265 2842395140 2842391507 Bacteria 4486072
266 2852688082 2852684882 Bacteria 5463342
267 2874223475 2874220319 Bacteria 4594709
268 2894417076 2894414249 Bacteria 4405451
269 2895499823 2895498888 Bacteria 5283788
270 2895512798 2895511927 Bacteria 6802080
271 2895522813 2895522137 Bacteria 3284416
272 2895525413 2895525241 Bacteria 3388457
273 2919092237 2919089067 Bacteria 4560942
274 2919132858 2919130084 Bacteria 5301837
275 2923519555 2923516293 Bacteria 3716336
276 2928497141 2928496128 Bacteria 4631123
277 2929199505 2929195423 Bacteria 5325372
278 2931383113 2931380184 Bacteria 4455911
279 2932415127 2932410948 Bacteria 6312192
280 2932421225 2932416698 Bacteria 6315112
281 2937614044 2937610967 Bacteria 4618818
282 2939630809 2939626828 Bacteria 4695272
283 2961050239 2961047084 Bacteria 4594415
284 2961064615 2961064222 Bacteria 4749990
285 8002869845 8002869464 Bacteria 3588529
286 8021625388 8021622325 Bacteria 4844743
287 8021626644 8021626552 Bacteria 4665214
288 8021649279 8021648035 Bacteria 4772378
289 SwRhRL2b_contig_474540
290 rootL2_10081468
291 rootL2_10167573
292 Ga0055529_1000027
293 Ga0058692_1000004
294 Ga0065714_10009048
295 Ga0070670_100000322
296 Ga0070670_100046698
297 Ga0070670_100191928
298 Ga0070677_10124732
299 Ga0068869_100100405
300 Ga0070668_100070120
301 Ga0070668_100149538
302 Ga0070671_100012332
303 Ga0070671_100033045
304 Ga0070671_100549853
305 Ga0070659_100313367
306 Ga0070667_100051063
307 Ga0070667_100818994
308 Ga0070663_100942693
309 Ga0070678_100059420
310 Ga0070678_100099165
311 Ga0068853_100314401
312 Ga0070672_100094387
313 Ga0070693_100006639
314 Ga0070665_100019287
315 Ga0070664_100348989
316 Ga0068854_100933075
317 Ga0068859_100164111
318 Ga0068861_100569194
319 Ga0075364_10001058
320 Ga0075364_10114201
321 Ga0068871_100064949
322 Ga0097620_100164105
323 Ga0105251_10000077
324 Ga0105244_10037250
325 Ga0105240_10010018
326 Ga0105240_10477821
327 Ga0105248_10009377
328 Ga0157327_1000893
329 Ga0157373_10142546
330 Ga0157369_10077822
331 Ga0157374_10105444
332 Ga0157378_10275849
333 Ga0163162_10103277
334 Ga0157372_10053979
335 Ga0157375_10001924
336 Ga0157375_10036944
337 Ga0157375_10721134
338 Ga0182008_10000056
339 Ga0182006_1000030
340 Ga0182007_10000037
341 Ga0182005_1000021
342 Ga0163161_10165179
343 Ga0163161_10172644
344 Ga0209674_101745
345 Ga0209437_100931
346 Ga0209148_1002030
347 Ga0209455_1000033
348 Ga0209676_1007998
349 Ga0209257_1000067
350 Ga0207713_1000381
351 Ga0207695_10015421
352 Ga0207657_10032873
353 Ga0207652_10115570
354 Ga0207681_10006857
355 Ga0207681_10361709
356 Ga0207650_10027074
357 Ga0207650_10106277
358 Ga0207650_10293848
359 Ga0207644_10043225
360 Ga0207706_10153754
361 Ga0207669_10022394
362 Ga0207691_10004261
363 Ga0207691_10148253
364 Ga0207711_10002794
365 Ga0207679_10078453
366 Ga0207668_10020081
367 Ga0207641_11069703
368 Ga0207648_10112755
369 Ga0207683_10229346
370 Ga0207683_10338273
371 Ga0207698_10759331
372 Ga0209371_1000018
373 Ga0209983_1000220
374 Ga0209971_1000437
375 Ga0209974_10007915
376 Ga0209974_10024703
377 Ga0268256_1000016
378 Ga0316180_1147040
379 Ga0307509_10266831
380 Ga0307408_100125338
381 Ga0307405_10210778
382 Ga0307413_10004831
383 Ga0307413_10016408
384 Ga0307413_10426111
385 Ga0307410_10466839
386 Ga0307410_10951697
387 Ga0307406_10471395
388 Ga0307412_10102059
389 Ga0307416_100088334
390 Ga0307416_100301943
391 Ga0307416_100615957
392 Ga0307416_101324335
393 Ga0307414_10172200
394 Ga0307414_10257760
395 Ga0307414_10291653
396 Ga0307414_10293589
397 Ga0307414_10412872
398 Ga0307414_10617047
399 Ga0307411_10027999
400 Ga0307411_10029177
401 Ga0307411_10074244
402 Ga0307411_10216953
403 Ga0307411_10345568
404 Ga0307415_100060660
405 Ga0307415_100435881
406 Ga0307415_100790414
407 Ga0395899_0089751
408 Ga0395900_0058779
409 Ga0395900_0142764
410 Ga0395898_0142930
411 Ga0395898_0203912
412 Ga0395898_0360716
413 Ga0395905_0003783
414 Ga0395905_0011004
415 Ga0395905_0059813
416 Ga0395901_0063125
417 Ga0237819_00035
418 Ga0439436_0003865
419 Ga0439436_0023629
420 Ga0439465_0002452
421 Ga0451797_1309842
422 Ga0451807_2358896
423 Ga0451837_0147753
424 Ga0451837_0767823
425 Ga0451837_0881631
426 Ga0451843_0498232
427 Ga0439448_0136336
428 Ga0439432_020560
429 Ga0439432_044631
430 Ga0439432_071562
431 Ga0439449_0000008
432 Ga0439449_0002642
433 Ga0439449_0003195
434 Ga0439449_0064272
435 Ga0439449_0084032
436 Ga0439462_0004631
437 Ga0439462_0046343
438 Ga0450911_005495
439 Ga0450908_000117
440 Ga0466972_0092230
441 Ga0466964_0033988
442 Ga0453684_0036674
443 Ga0451576_0022979
444 Ga0495584_0040353
445 Ga0495610_0050655
446 Ga0495616_0069817
447 Ga0495632_0000014
448 Ga0495648_0094398
449 Ga0495598_0001041
450 Ga0495609_0053504
451 Ga0495656_0003190
452 Ga0495656_0016914
453 Ga0495656_0033889
454 Ga0495659_0009383
455 Ga0495660_0003084
456 Ga0495636_0001234
457 Ga0495636_0005678
458 Ga0495672_0108126
459 Ga0495685_010426
460 Ga0495681_0004264
461 Ga0495681_0053903
462 Ga0495686_0007669
463 Ga0495615_0043338
464 Ga0495626_0193801
465 Ga0496100_0437698
466 Ga0496107_0578436
467 Ga0496108_0024210
468 Ga0496109_0432953
469 Ga0496109_0493296
470 Ga0496109_1262728
471 Ga0496110_0117254
472 Ga0496110_0261660
473 Ga0496110_0695939
474 Ga0496112_0897182
475 Ga0496115_0148216
476 Ga0496115_0311012
477 Ga0496115_0670202
478 Ga0496116_0077825
479 Ga0496116_0102596
480 Ga0496116_0103931
481 Ga0496116_0240981
482 Ga0496117_0000056
483 Ga0496117_0001919
484 Ga0496117_0268082
485 Ga0496118_0000047
486 Ga0496118_0085572
487 Ga0496119_0001413
488 Ga0496119_0201246
489 Ga0496120_0000162
490 Ga0496120_0186711
491 Ga0496121_0004406
492 Ga0496121_0005981
493 Ga0496121_0043119
494 Ga0496121_0116900
495 Ga0496122_0000049
496 Ga0496122_0023037
497 Ga0496122_0052585
498 Ga0496122_0244154
499 Ga0496123_0000042
500 Ga0496123_0002489
501 Ga0496123_0018272
502 Ga0496123_0205221
503 Ga0496124_0000621
504 Ga0496124_0027755
505 Ga0496124_0452102
506 Ga0496125_0023252
507 Ga0496125_0294896
508 Ga0496126_0137933
509 Ga0501290_011091
510 Ga0501031_0030071
511 Ga0501032_0008408
512 Ga0501032_0054134
513 Ga0501033_0001438
514 Ga0501033_0002236
515 Ga0501034_0003550
516 Ga0501034_0003962
517 Ga0501034_0210082
518 Ga0501036_0022817
519 Ga0501037_0025171
520 Ga0501038_0002917
521 Ga0501039_0064626
522 Ga0501039_0092411
523 Ga0501043_0053329
524 Ga0501043_0189261
525 Ga0501046_0044638
526 Ga0501047_0012326
527 Ga0501048_0046092
528 Ga0501067_0365577
529 Ga0501070_0470058
530 Ga0501073_0009853
531 Ga0501225_0002466
532 Ga0501265_003002
533 Ga0501035_0003039
534 Ga0501035_0118284
535 Ga0501044_0015267
536 Ga0501044_0620020
537 nmdc:mga00v17_122595_c1
538 nmdc:mga00v17_25_c1
539 Ga0500651_0004800
540 Ga0500597_151861
541 2857580632
542 2525558211
543 2572254908
544 2595449123
545 2595452782
546 2601671939
547 2630650014
548 2644530635
549 2765580829
550 2816518182
551 2819662217
552 2821136184
553 2842395140
554 2852688082
555 2874223475
556 2894417076
557 2895499823
558 2895512798
559 2895522813
560 2895525413
561 2919092237
562 2919132858
563 2923519555
564 2928497141
565 2929199505
566 2931383113
567 2932415127
568 2932421225
569 2937614044
570 2939630809
571 2961050239
572 2961064615
573 8002869845
574 8021625388
575 8021626644
576 8021649279

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03232

COQ7

Ubiquinone biosynthesis protein COQ7

56

217

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ssp-assembly1.cif.gz_H structure of the human coq7:coq9 complex by single-particle electron cryo-microscopy, unliganded state 0.8695 49 211
1ji5-assembly1.cif.gz_A dlp-1 from bacillus anthracis 0.8563 52 181
7ssp-assembly1.cif.gz_H structure of the human coq7:coq9 complex by single-particle electron cryo-microscopy, unliganded state 0.8549 49 211
4cvp-assembly1.cif.gz_A-2 structure of apobacterioferritin 0.8503 52 180
4cvs-assembly1.cif.gz_A-2 structure of apobacterioferritin y45f variant 0.8433 52 180
ID Description Score Start End Superfamily
af_Q54VB3_38_194_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9313 48 180 1.20.1260.10
af_Q9W3W4_54_201_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9271 56 180 1.20.1260.10
af_P41735_52_233_3.15.10.10 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;Bactericidal permeability-increasing protein; domain 1 0.8907 53 211 3.15.10.10
af_F1QW05_54_223_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8898 53 211 1.20.1260.10
af_Q54XF9_6_149_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8581 46 180 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A4S3KL16-F1-model_v4 Demethoxyubiquinone hydroxylase family protein 0.9984 55 211 GO:0004497
GO:0005886
GO:0006744
GO:0046872
AF-A0A383SRU9-F1-model_v4 deleted 0.9982 1 211
AF-A0A3B9XXC9-F1-model_v4 Demethoxyubiquinone hydroxylase family protein 0.9974 48 211 GO:0004497
GO:0005886
GO:0006744
GO:0046872
AF-A0A6F8T1T5-F1-model_v4 3-demethoxyubiquinol 3-hydroxylase (DMQ hydroxylase) (EC 1.14.99.60) (2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase) 0.9953 31 211 GO:0005886
GO:0006744
GO:0008682
GO:0046872
AF-A0A7W5NTN3-F1-model_v4 3-demethoxyubiquinol 3-hydroxylase (DMQ hydroxylase) (EC 1.14.99.60) (2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase) 0.995 1 211 GO:0004497
GO:0005886
GO:0006744
GO:0046872

Map