F388126

General Info

Members Datasets Scaffolds Average Seq Length
287 179 574 218

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_1004964|Ga0436361_1004964_1408_2172
Length 254
Sequence LRQFDRIPAARQVGLPVSHESSVASIANATNNDQYSMSPLKLLSVNVGMPREVDWQGRLVRTSIFKSPMLGPVRVTTLNLQGDEQSDLTVHGGVHKAVYAYPSEHYPFWREEISGLDLPWGAFGENFTTEGFLEDAVHIGDRLRVGSAEFVVTQPRMPCFKLGIRFGRPEIVKGFQRSGRTGFYLAVLQEGRVTAGDSMESLTRDEHGVTVADIVKLYKADATNQELLRRASELPALPPFWRDYFRKRLWDPDR

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
121 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
124 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
138 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
139 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
166 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
167 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
168 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
169 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.05
Rhizosphere 98.95
Stem 0
Stem Tuber 0
Unclassified 33.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_1004964 3300039447 Unclassified 2513
2 JGI25406J46586_10000355 3300003203 Bacteria 20797
3 Ga0065704_10007339 3300005289 Bacteria 3865
4 Ga0070658_10664650 3300005327 Unclassified 904
5 Ga0070683_100503938 3300005329 Bacteria 1156
6 Ga0070670_100528442 3300005331 Bacteria 1051
7 Ga0070670_100580126 3300005331 Unclassified 1002
8 Ga0068869_100019680 3300005334 Unclassified 4618
9 Ga0070682_100466478 3300005337 Bacteria 971
10 Ga0068868_100912840 3300005338 Bacteria 799
11 Ga0070660_100355597 3300005339 Bacteria 1207
12 Ga0070661_100454644 3300005344 Unclassified 1019
13 Ga0070668_100302472 3300005347 Unclassified 1342
14 Ga0070675_100114919 3300005354 Bacteria 2281
15 Ga0070675_100230721 3300005354 Bacteria 1615
16 Ga0070675_100466725 3300005354 Bacteria 1134
17 Ga0070673_100119827 3300005364 Bacteria 2193
18 Ga0070688_100022114 3300005365 Bacteria 3722
19 Ga0070659_100133313 3300005366 Bacteria 2019
20 Ga0070659_100694409 3300005366 Bacteria 880
21 Ga0070709_10012020 3300005434 Unclassified 4840
22 Ga0070709_10356785 3300005434 Unclassified 1082
23 Ga0070714_100000188 3300005435 Bacteria 49788
24 Ga0070714_100023767 3300005435 Bacteria 5040
25 Ga0070713_100072756 3300005436 Bacteria 2908
26 Ga0070713_100366399 3300005436 Bacteria 1340
27 Ga0070711_100003168 3300005439 Bacteria 9549
28 Ga0070711_100004985 3300005439 Bacteria 7885
29 Ga0070694_100249299 3300005444 Bacteria 1342
30 Ga0070708_100081243 3300005445 Unclassified 2934
31 Ga0070708_100177300 3300005445 Bacteria 1992
32 Ga0070663_100112650 3300005455 Bacteria 2046
33 Ga0070706_100006649 3300005467 Bacteria 10907
34 Ga0070706_100023869 3300005467 Bacteria 5631
35 Ga0070706_100041222 3300005467 Unclassified 4262
36 Ga0070706_100058902 3300005467 Unclassified 3544
37 Ga0070706_100073203 3300005467 Bacteria 3171
38 Ga0070706_100109263 3300005467 Bacteria 2573
39 Ga0070706_100138859 3300005467 Unclassified 2268
40 Ga0070706_100388784 3300005467 Unclassified 1298
41 Ga0070707_100087823 3300005468 Bacteria 3008
42 Ga0070707_100120408 3300005468 Unclassified 2548
43 Ga0070707_100136829 3300005468 Unclassified 2383
44 Ga0070707_100141235 3300005468 Bacteria 2344
45 Ga0070707_100178704 3300005468 Bacteria 2069
46 Ga0070707_100317387 3300005468 Bacteria 1514
47 Ga0070698_100049355 3300005471 Bacteria 4296
48 Ga0070698_100058822 3300005471 Bacteria 3884
49 Ga0070698_100153198 3300005471 Bacteria 2251
50 Ga0070698_100183531 3300005471 Unclassified 2030
51 Ga0070698_100473630 3300005471 Bacteria 1189
52 Ga0070699_100014776 3300005518 Bacteria 6714
53 Ga0070699_100045623 3300005518 Bacteria 3793
54 Ga0070699_100647285 3300005518 Bacteria 965
55 Ga0070679_100037744 3300005530 Bacteria 4800
56 Ga0070697_100029179 3300005536 Bacteria 4421
57 Ga0070697_100030996 3300005536 Bacteria 4298
58 Ga0070697_100246888 3300005536 Bacteria 1526
59 Ga0070697_100268144 3300005536 Unclassified 1463
60 Ga0070697_100327829 3300005536 Unclassified 1319
61 Ga0070697_100824351 3300005536 Unclassified 821
62 Ga0070695_100372369 3300005545 Unclassified 1076
63 Ga0070696_100317669 3300005546 Bacteria 1198
64 Ga0070693_100259824 3300005547 Bacteria 1154
65 Ga0070665_100001114 3300005548 Bacteria 33120
66 Ga0070665_100102621 3300005548 Unclassified 2863
67 Ga0070665_100720603 3300005548 Bacteria 1010
68 Ga0070704_100153981 3300005549 Bacteria 1811
69 Ga0070664_100397072 3300005564 Bacteria 1260
70 Ga0070664_100660961 3300005564 Unclassified 972
71 Ga0068857_100601174 3300005577 Bacteria 1040
72 Ga0068859_100772445 3300005617 Bacteria 1049
73 Ga0068866_10423172 3300005718 Bacteria 864
74 Ga0068870_10374423 3300005840 Unclassified 920
75 Ga0068858_100231177 3300005842 Unclassified 1753
76 Ga0068858_100373818 3300005842 Unclassified 1367
77 Ga0081455_10025511 3300005937 Bacteria 5454
78 Ga0081539_10000065 3300005985 Bacteria 246571
79 Ga0070717_10005765 3300006028 Bacteria 9069
80 Ga0070717_10040519 3300006028 Bacteria 3794
81 Ga0070717_10048357 3300006028 Bacteria 3488
82 Ga0070717_10138648 3300006028 Unclassified 2096
83 Ga0070717_10367898 3300006028 Bacteria 1288
84 Ga0070717_10393469 3300006028 Unclassified 1244
85 Ga0070717_10489739 3300006028 Unclassified 1111
86 Ga0070715_10000019 3300006163 Bacteria 122990
87 Ga0070716_100077162 3300006173 Bacteria 1976
88 Ga0070716_100824121 3300006173 Unclassified 720
89 Ga0070712_100013661 3300006175 Bacteria 5194
90 Ga0070712_100106555 3300006175 Bacteria 2084
91 Ga0070712_100940395 3300006175 Bacteria 746
92 Ga0075427_10038792 3300006194 Bacteria 798
93 Ga0068871_100453511 3300006358 Bacteria 1150
94 Ga0075428_100083198 3300006844 Bacteria 3491
95 Ga0075430_100143418 3300006846 Unclassified 1989
96 Ga0075431_100084304 3300006847 Bacteria 3281
97 Ga0075433_10057134 3300006852 Bacteria 3410
98 Ga0075433_10995912 3300006852 Unclassified 730
99 Ga0075434_100001350 3300006871 Bacteria 20603
100 Ga0075429_100025673 3300006880 Bacteria 5115
101 Ga0075429_100237782 3300006880 Bacteria 1595
102 Ga0068865_100631317 3300006881 Bacteria 908
103 Ga0075436_100043776 3300006914 Bacteria 3086
104 Ga0097620_100772332 3300006931 Bacteria 1049
105 Ga0075435_100011776 3300007076 Bacteria 6453
106 Ga0099794_10058149 3300007265 Unclassified 1874
107 Ga0099794_10130199 3300007265 Unclassified 1270
108 Ga0099794_10193049 3300007265 Bacteria 1042
109 Ga0111539_10003194 3300009094 Bacteria 21690
110 Ga0111539_10622974 3300009094 Bacteria 1256
111 Ga0105247_10030022 3300009101 Unclassified 3295
112 Ga0105247_10190120 3300009101 Unclassified 1374
113 Ga0114129_10080575 3300009147 Bacteria 4525
114 Ga0114129_10130998 3300009147 Bacteria 3444
115 Ga0114129_10525041 3300009147 Unclassified 1543
116 Ga0105243_10431337 3300009148 Bacteria 1232
117 Ga0105248_10191716 3300009177 Bacteria 2303
118 Ga0157370_10016620 3300013104 Bacteria 7445
119 Ga0157369_10259154 3300013105 Bacteria 1814
120 Ga0157374_10126106 3300013296 Unclassified 2475
121 Ga0157374_10443471 3300013296 Bacteria 1299
122 Ga0157378_10677700 3300013297 Unclassified 1049
123 Ga0157378_11157407 3300013297 Unclassified 812
124 Ga0163162_10067183 3300013306 Bacteria 3635
125 Ga0163162_10212525 3300013306 Unclassified 2064
126 Ga0163162_10279132 3300013306 Bacteria 1803
127 Ga0157375_10417755 3300013308 Unclassified 1507
128 Ga0157375_10789181 3300013308 Unclassified 1099
129 Ga0163163_10038064 3300014325 Unclassified 4684
130 Ga0157380_10901258 3300014326 Bacteria 910
131 Ga0157379_10182983 3300014968 Bacteria 1893
132 Ga0157376_10157522 3300014969 Bacteria 2055
133 Ga0157376_10164777 3300014969 Bacteria 2013
134 Ga0157376_10555635 3300014969 Bacteria 1137
135 Ga0213872_10042589 3300021361 Unclassified 2070
136 Ga0213871_10027341 3300021441 Unclassified 1464
137 Ga0207697_10023690 3300025315 Bacteria 2513
138 Ga0207697_10033919 3300025315 Bacteria 2089
139 Ga0207710_10015331 3300025900 Unclassified 3236
140 Ga0207685_10000021 3300025905 Bacteria 131248
141 Ga0207699_10012687 3300025906 Unclassified 4290
142 Ga0207684_10006555 3300025910 Bacteria 10598
143 Ga0207684_10020629 3300025910 Bacteria 5631
144 Ga0207684_10022136 3300025910 Bacteria 5428
145 Ga0207684_10062194 3300025910 Bacteria 3170
146 Ga0207684_10066009 3300025910 Unclassified 3073
147 Ga0207684_10287066 3300025910 Bacteria 1419
148 Ga0207684_10624789 3300025910 Unclassified 919
149 Ga0207684_10701045 3300025910 Unclassified 860
150 Ga0207693_10024083 3300025915 Bacteria 4833
151 Ga0207693_10148700 3300025915 Bacteria 1842
152 Ga0207693_10237036 3300025915 Bacteria 1432
153 Ga0207693_10329699 3300025915 Unclassified 1195
154 Ga0207693_10446327 3300025915 Unclassified 1011
155 Ga0207663_10013619 3300025916 Bacteria 4425
156 Ga0207663_10014032 3300025916 Bacteria 4374
157 Ga0207649_10374919 3300025920 Bacteria 1059
158 Ga0207646_10039545 3300025922 Bacteria 4245
159 Ga0207646_10081776 3300025922 Bacteria 2888
160 Ga0207646_10197932 3300025922 Unclassified 1815
161 Ga0207646_10216317 3300025922 Bacteria 1731
162 Ga0207646_10791814 3300025922 Unclassified 845
163 Ga0207681_10142241 3300025923 Bacteria 1788
164 Ga0207681_10170622 3300025923 Unclassified 1649
165 Ga0207650_10599760 3300025925 Bacteria 926
166 Ga0207650_10753530 3300025925 Unclassified 824
167 Ga0207659_10005644 3300025926 Bacteria 7610
168 Ga0207659_10839166 3300025926 Bacteria 790
169 Ga0207700_10022135 3300025928 Bacteria 4354
170 Ga0207700_10469324 3300025928 Unclassified 1111
171 Ga0207700_10638332 3300025928 Unclassified 949
172 Ga0207664_10000370 3300025929 Bacteria 32851
173 Ga0207664_10493447 3300025929 Bacteria 1096
174 Ga0207644_10362630 3300025931 Unclassified 1179
175 Ga0207706_10024881 3300025933 Bacteria 5367
176 Ga0207706_10693196 3300025933 Bacteria 870
177 Ga0207669_10358119 3300025937 Unclassified 1130
178 Ga0207665_10083581 3300025939 Unclassified 2202
179 Ga0207665_10120886 3300025939 Unclassified 1850
180 Ga0207691_10170375 3300025940 Bacteria 1907
181 Ga0207711_10435170 3300025941 Unclassified 1221
182 Ga0207711_10675058 3300025941 Bacteria 964
183 Ga0207689_10008791 3300025942 Bacteria 8779
184 Ga0207661_10051559 3300025944 Bacteria 3284
185 Ga0207679_10983715 3300025945 Unclassified 773
186 Ga0207651_10080992 3300025960 Bacteria 2339
187 Ga0207703_10268883 3300026035 Unclassified 1544
188 Ga0207678_10002242 3300026067 Bacteria 17491
189 Ga0207702_10439148 3300026078 Unclassified 1265
190 Ga0207648_10240236 3300026089 Unclassified 1613
191 Ga0207648_10670209 3300026089 Unclassified 960
192 Ga0207683_10008895 3300026121 Bacteria 8561
193 Ga0209588_1056375 3300027671 Unclassified 1270
194 Ga0268266_10004254 3300028379 Bacteria 13770
195 Ga0265338_10024192 3300028800 Bacteria 6214
196 Ga0265338_10234192 3300028800 Bacteria 1364
197 Ga0265762_1000075 3300030760 Bacteria 13358
198 Ga0265339_10123878 3300031249 Bacteria 1326
199 Ga0265331_10024022 3300031250 Bacteria 3090
200 Ga0265316_10202315 3300031344 Bacteria 1471
201 Ga0307408_100558664 3300031548 Unclassified 1011
202 Ga0265313_10113343 3300031595 Bacteria 1190
203 Ga0307413_10418828 3300031824 Unclassified 1054
204 Ga0307409_100810756 3300031995 Unclassified 944
205 Ga0307414_10037991 3300032004 Bacteria 3229
206 Ga0307411_10194393 3300032005 Unclassified 1552
207 Ga0307415_100083839 3300032126 Bacteria 2285
208 Ga0373934_0021226 3300035086 Bacteria 2501
209 Ga0373923_0003069 3300035111 Bacteria 5287
210 Ga0373936_0010321 3300035113 Bacteria 3524
211 Ga0373954_0004895 3300035118 Bacteria 5780
212 Ga0373956_0014438 3300035119 Bacteria 3300
213 Ga0373943_0012516 3300035170 Bacteria 3822
214 Ga0373931_0230101 3300035691 Bacteria 1120
215 Ga0373935_0000747 3300035692 Bacteria 17271
216 Ga0373935_0010715 3300035692 Bacteria 5506
217 Ga0373935_0275411 3300035692 Bacteria 1184
218 Ga0373935_0531905 3300035692 Unclassified 856
219 Ga0373927_0000705 3300035695 Bacteria 25605
220 Ga0373927_0306879 3300035695 Bacteria 1045
221 Ga0373933_0032622 3300035724 Bacteria 3027
222 Ga0373947_0000098 3300035725 Bacteria 44133
223 Ga0373947_0106529 3300035725 Bacteria 1767
224 Ga0373947_0183460 3300035725 Unclassified 1363
225 Ga0373947_0928003 3300035725 Unclassified 594
226 Ga0373937_0177029 3300036401 Bacteria 2002
227 Ga0373925_0002146 3300037068 Bacteria 16118
228 Ga0373925_0141378 3300037068 Unclassified 1884
229 Ga0373925_0459183 3300037068 Unclassified 1044
230 Ga0395900_0015805 3300037418 Bacteria 7694
231 Ga0395898_0036359 3300037466 Bacteria 4890
232 Ga0395901_0054918 3300038443 Bacteria 4141
233 Ga0436360_0530536 3300039438 Bacteria 4170
234 Ga0436360_1052465 3300039438 Bacteria 2853
235 Ga0436361_0322531 3300039447 Bacteria 5436
236 Ga0436361_0387828 3300039447 Unclassified 1673
237 Ga0436362_0473252 3300039453 Bacteria 8132
238 Ga0439448_0057526 3300042005 Unclassified 1281
239 Ga0439455_0017721 3300042012 Bacteria 1663
240 Ga0451577_0000081 3300042876 Bacteria 216944
241 Ga0453683_0017640 3300044673 Bacteria 4595
242 Ga0453684_0002440 3300044712 Bacteria 45185
243 Ga0451576_1024822 3300045051 Bacteria 865
244 Ga0495629_0504462 3300046459 Unclassified 816
245 Ga0495641_0174629 3300046461 Bacteria 961
246 Ga0495651_0353915 3300046462 Unclassified 970
247 Ga0495653_0165235 3300046463 Unclassified 1533
248 Ga0495580_0030582 3300046472 Bacteria 3898
249 Ga0495580_0223005 3300046472 Bacteria 1295
250 Ga0495664_0115269 3300046477 Unclassified 1624
251 Ga0495664_0138645 3300046477 Bacteria 1474
252 Ga0495630_0250132 3300046517 Bacteria 1354
253 Ga0495586_0311338 3300046535 Bacteria 903
254 Ga0495598_0157448 3300046537 Unclassified 797
255 Ga0495645_0196290 3300046543 Bacteria 1372
256 Ga0495659_0055068 3300046664 Unclassified 1457
257 Ga0495624_0045633 3300046690 Bacteria 2789
258 Ga0495624_0097041 3300046690 Bacteria 1816
259 Ga0495581_0161264 3300047315 Bacteria 1311
260 Ga0495604_0032705 3300047317 Bacteria 4121
261 Ga0495674_0028291 3300047319 Bacteria 5114
262 Ga0495593_0187317 3300047673 Unclassified 1042
263 Ga0495593_0205402 3300047673 Bacteria 990
264 Ga0495602_0051834 3300048088 Bacteria 3651
265 Ga0495602_0307915 3300048088 Unclassified 1157
266 Ga0496104_0165114 3300048907 Bacteria 2123
267 Ga0496105_0071780 3300048908 Bacteria 2861
268 Ga0496109_0898213 3300048912 Unclassified 824
269 Ga0501077_0043631 3300049593 Bacteria 2850
270 Ga0501230_003903 3300049667 Unclassified 2014
271 Ga0501233_050753 3300049668 Unclassified 1004
272 Ga0501235_038622 3300049669 Unclassified 1089
273 Ga0501243_029073 3300049675 Unclassified 938
274 Ga0501251_021964 3300049681 Unclassified 854
275 nmdc:mga05p37_2970_c1 3300050507 Bacteria 19691
276 nmdc:mga05p37_358473_c1 3300050507 Bacteria 1715
277 nmdc:mga09592_102398_c1 3300050508 Unclassified 2453
278 nmdc:mga09592_10857_c1 3300050508 Bacteria 7411
279 nmdc:mga0qj67_129388_c1 3300050509 Unclassified 2044
280 nmdc:mga0qj67_28949_c1 3300050509 Unclassified 4300
281 nmdc:mga08y16_11081_c1 3300050511 Bacteria 9466
282 nmdc:mga0n895_17489_c1 3300050512 Bacteria 6608
283 nmdc:mga0rr50_18132_c1 3300050513 Bacteria 4720
284 nmdc:mga0a205_54288_c1 3300050515 Bacteria 3409
285 Ga0495601_0011177 3300053077 Bacteria 5362
286 Ga0501082_0361024 3300060353 Bacteria 1267
287 Ga0466962_0246282 3300061719 Bacteria 878
288 Ga0436361_1004964
289 JGI25406J46586_10000355
290 Ga0065704_10007339
291 Ga0070658_10664650
292 Ga0070683_100503938
293 Ga0070670_100528442
294 Ga0070670_100580126
295 Ga0068869_100019680
296 Ga0070682_100466478
297 Ga0068868_100912840
298 Ga0070660_100355597
299 Ga0070661_100454644
300 Ga0070668_100302472
301 Ga0070675_100114919
302 Ga0070675_100230721
303 Ga0070675_100466725
304 Ga0070673_100119827
305 Ga0070688_100022114
306 Ga0070659_100133313
307 Ga0070659_100694409
308 Ga0070709_10012020
309 Ga0070709_10356785
310 Ga0070714_100000188
311 Ga0070714_100023767
312 Ga0070713_100072756
313 Ga0070713_100366399
314 Ga0070711_100003168
315 Ga0070711_100004985
316 Ga0070694_100249299
317 Ga0070708_100081243
318 Ga0070708_100177300
319 Ga0070663_100112650
320 Ga0070706_100006649
321 Ga0070706_100023869
322 Ga0070706_100041222
323 Ga0070706_100058902
324 Ga0070706_100073203
325 Ga0070706_100109263
326 Ga0070706_100138859
327 Ga0070706_100388784
328 Ga0070707_100087823
329 Ga0070707_100120408
330 Ga0070707_100136829
331 Ga0070707_100141235
332 Ga0070707_100178704
333 Ga0070707_100317387
334 Ga0070698_100049355
335 Ga0070698_100058822
336 Ga0070698_100153198
337 Ga0070698_100183531
338 Ga0070698_100473630
339 Ga0070699_100014776
340 Ga0070699_100045623
341 Ga0070699_100647285
342 Ga0070679_100037744
343 Ga0070697_100029179
344 Ga0070697_100030996
345 Ga0070697_100246888
346 Ga0070697_100268144
347 Ga0070697_100327829
348 Ga0070697_100824351
349 Ga0070695_100372369
350 Ga0070696_100317669
351 Ga0070693_100259824
352 Ga0070665_100001114
353 Ga0070665_100102621
354 Ga0070665_100720603
355 Ga0070704_100153981
356 Ga0070664_100397072
357 Ga0070664_100660961
358 Ga0068857_100601174
359 Ga0068859_100772445
360 Ga0068866_10423172
361 Ga0068870_10374423
362 Ga0068858_100231177
363 Ga0068858_100373818
364 Ga0081455_10025511
365 Ga0081539_10000065
366 Ga0070717_10005765
367 Ga0070717_10040519
368 Ga0070717_10048357
369 Ga0070717_10138648
370 Ga0070717_10367898
371 Ga0070717_10393469
372 Ga0070717_10489739
373 Ga0070715_10000019
374 Ga0070716_100077162
375 Ga0070716_100824121
376 Ga0070712_100013661
377 Ga0070712_100106555
378 Ga0070712_100940395
379 Ga0075427_10038792
380 Ga0068871_100453511
381 Ga0075428_100083198
382 Ga0075430_100143418
383 Ga0075431_100084304
384 Ga0075433_10057134
385 Ga0075433_10995912
386 Ga0075434_100001350
387 Ga0075429_100025673
388 Ga0075429_100237782
389 Ga0068865_100631317
390 Ga0075436_100043776
391 Ga0097620_100772332
392 Ga0075435_100011776
393 Ga0099794_10058149
394 Ga0099794_10130199
395 Ga0099794_10193049
396 Ga0111539_10003194
397 Ga0111539_10622974
398 Ga0105247_10030022
399 Ga0105247_10190120
400 Ga0114129_10080575
401 Ga0114129_10130998
402 Ga0114129_10525041
403 Ga0105243_10431337
404 Ga0105248_10191716
405 Ga0157370_10016620
406 Ga0157369_10259154
407 Ga0157374_10126106
408 Ga0157374_10443471
409 Ga0157378_10677700
410 Ga0157378_11157407
411 Ga0163162_10067183
412 Ga0163162_10212525
413 Ga0163162_10279132
414 Ga0157375_10417755
415 Ga0157375_10789181
416 Ga0163163_10038064
417 Ga0157380_10901258
418 Ga0157379_10182983
419 Ga0157376_10157522
420 Ga0157376_10164777
421 Ga0157376_10555635
422 Ga0213872_10042589
423 Ga0213871_10027341
424 Ga0207697_10023690
425 Ga0207697_10033919
426 Ga0207710_10015331
427 Ga0207685_10000021
428 Ga0207699_10012687
429 Ga0207684_10006555
430 Ga0207684_10020629
431 Ga0207684_10022136
432 Ga0207684_10062194
433 Ga0207684_10066009
434 Ga0207684_10287066
435 Ga0207684_10624789
436 Ga0207684_10701045
437 Ga0207693_10024083
438 Ga0207693_10148700
439 Ga0207693_10237036
440 Ga0207693_10329699
441 Ga0207693_10446327
442 Ga0207663_10013619
443 Ga0207663_10014032
444 Ga0207649_10374919
445 Ga0207646_10039545
446 Ga0207646_10081776
447 Ga0207646_10197932
448 Ga0207646_10216317
449 Ga0207646_10791814
450 Ga0207681_10142241
451 Ga0207681_10170622
452 Ga0207650_10599760
453 Ga0207650_10753530
454 Ga0207659_10005644
455 Ga0207659_10839166
456 Ga0207700_10022135
457 Ga0207700_10469324
458 Ga0207700_10638332
459 Ga0207664_10000370
460 Ga0207664_10493447
461 Ga0207644_10362630
462 Ga0207706_10024881
463 Ga0207706_10693196
464 Ga0207669_10358119
465 Ga0207665_10083581
466 Ga0207665_10120886
467 Ga0207691_10170375
468 Ga0207711_10435170
469 Ga0207711_10675058
470 Ga0207689_10008791
471 Ga0207661_10051559
472 Ga0207679_10983715
473 Ga0207651_10080992
474 Ga0207703_10268883
475 Ga0207678_10002242
476 Ga0207702_10439148
477 Ga0207648_10240236
478 Ga0207648_10670209
479 Ga0207683_10008895
480 Ga0209588_1056375
481 Ga0268266_10004254
482 Ga0265338_10024192
483 Ga0265338_10234192
484 Ga0265762_1000075
485 Ga0265339_10123878
486 Ga0265331_10024022
487 Ga0265316_10202315
488 Ga0307408_100558664
489 Ga0265313_10113343
490 Ga0307413_10418828
491 Ga0307409_100810756
492 Ga0307414_10037991
493 Ga0307411_10194393
494 Ga0307415_100083839
495 Ga0373934_0021226
496 Ga0373923_0003069
497 Ga0373936_0010321
498 Ga0373954_0004895
499 Ga0373956_0014438
500 Ga0373943_0012516
501 Ga0373931_0230101
502 Ga0373935_0000747
503 Ga0373935_0010715
504 Ga0373935_0275411
505 Ga0373935_0531905
506 Ga0373927_0000705
507 Ga0373927_0306879
508 Ga0373933_0032622
509 Ga0373947_0000098
510 Ga0373947_0106529
511 Ga0373947_0183460
512 Ga0373947_0928003
513 Ga0373937_0177029
514 Ga0373925_0002146
515 Ga0373925_0141378
516 Ga0373925_0459183
517 Ga0395900_0015805
518 Ga0395898_0036359
519 Ga0395901_0054918
520 Ga0436360_0530536
521 Ga0436360_1052465
522 Ga0436361_0322531
523 Ga0436361_0387828
524 Ga0436362_0473252
525 Ga0439448_0057526
526 Ga0439455_0017721
527 Ga0451577_0000081
528 Ga0453683_0017640
529 Ga0453684_0002440
530 Ga0451576_1024822
531 Ga0495629_0504462
532 Ga0495641_0174629
533 Ga0495651_0353915
534 Ga0495653_0165235
535 Ga0495580_0030582
536 Ga0495580_0223005
537 Ga0495664_0115269
538 Ga0495664_0138645
539 Ga0495630_0250132
540 Ga0495586_0311338
541 Ga0495598_0157448
542 Ga0495645_0196290
543 Ga0495659_0055068
544 Ga0495624_0045633
545 Ga0495624_0097041
546 Ga0495581_0161264
547 Ga0495604_0032705
548 Ga0495674_0028291
549 Ga0495593_0187317
550 Ga0495593_0205402
551 Ga0495602_0051834
552 Ga0495602_0307915
553 Ga0496104_0165114
554 Ga0496105_0071780
555 Ga0496109_0898213
556 Ga0501077_0043631
557 Ga0501230_003903
558 Ga0501233_050753
559 Ga0501235_038622
560 Ga0501243_029073
561 Ga0501251_021964
562 nmdc:mga05p37_2970_c1
563 nmdc:mga05p37_358473_c1
564 nmdc:mga09592_102398_c1
565 nmdc:mga09592_10857_c1
566 nmdc:mga0qj67_129388_c1
567 nmdc:mga0qj67_28949_c1
568 nmdc:mga08y16_11081_c1
569 nmdc:mga0n895_17489_c1
570 nmdc:mga0rr50_18132_c1
571 nmdc:mga0a205_54288_c1
572 Ga0495601_0011177
573 Ga0501082_0361024
574 Ga0466962_0246282

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03475

YiiM_3-alpha

YiiM-like, 3-alpha helix domain

209

249

0.99

PF03473

MOSC

MOSC domain

87

200

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yhh-assembly1.cif.gz_A crystal structure of yiim from geobacillus stearothermophilus 0.9056 2 211
5yhi-assembly1.cif.gz_B crystal structure of yiim from escherichia coli 0.9055 28 210
5yhh-assembly1.cif.gz_A crystal structure of yiim from geobacillus stearothermophilus 0.8922 2 211
1o65-assembly2.cif.gz_B crystal structure of an hypothetical protein 0.8784 1 208
1o67-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.872 3 208
ID Description Score Start End Superfamily
af_Q2FVS9_1_216_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.9139 1 210 2.40.33.20
af_Q2FVS9_1_216_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.9058 1 210 2.40.33.20
5yhiA00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8979 1 210 2.40.33.20
af_P95151_15_247_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8696 2 208 2.40.33.20
af_P95151_15_247_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8502 2 208 2.40.33.20
ID Description Score Start End GO Terms
AF-A0A533WWI9-F1-model_v4 MOSC domain-containing protein 0.9934 2 120 GO:0003824
GO:0030151
GO:0030170
AF-A0A533UZB9-F1-model_v4 MOSC domain-containing protein 0.9928 1 162 GO:0003824
GO:0030151
GO:0030170
AF-A0A2V9XXP7-F1-model_v4 MOSC domain-containing protein 0.9911 1 144 GO:0003824
GO:0030151
GO:0030170
AF-A0A1W1I8Z5-F1-model_v4 MOSC domain containing protein 0.988 1 174 GO:0003824
GO:0030151
GO:0030170
AF-A0A1Z4PZ72-F1-model_v4 deleted 0.9876 1 101

Map