F388118

General Info

Members Datasets Scaffolds Average Seq Length
287 201 574 88

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0021656|Ga0395898_0021656_3354_3635
Length 93
Sequence VNSKLEKVEKVSYKPVGLLLGIAAGAVAGLIFKQVWKLASGDDDAPDATDENRGWGEIIIAAALQGAIFAVVKALVDRGGATGVRKITGTWPD

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
115 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
116 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
117 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
118 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
128 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
129 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
130 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
131 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
157 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
158 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
159 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
160 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
161 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
162 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
163 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
164 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
165 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
166 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
167 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
168 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
169 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
170 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
171 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
175 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
176 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
177 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
178 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
179 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
180 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
181 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
182 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
183 2855683550 Micromonospora sp. RP3T Isolate Unclassified
184 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
185 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
186 2858882152 Micromonospora noduli MED15 Isolate Nodule
187 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
188 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
189 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
190 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
191 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
192 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
193 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
194 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
195 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
196 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
197 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
198 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
199 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
200 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
201 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 81.18
Metatranscriptomes 9.06
Isolates 9.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.23
Nodule 1.74
Rhizoplane 2.44
Rhizosphere 75.26
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0021656 3300037466 Bacteria 6516
2 Ga0006778J45830_1082839 3300003162 Bacteria 1137
3 Ga0006778J45830_1101705 3300003162 Bacteria 693
4 Ga0006777J48905_1026119 3300003308 Bacteria 543
5 Ga0006777J48905_1026845 3300003308 Bacteria 1246
6 rootH1_10074106 3300003316 Bacteria 2254
7 rootH2_10103106 3300003320 Bacteria 2149
8 rootH2_10198378 3300003320 Bacteria 1670
9 rootL2_10031737 3300003322 Bacteria 1214
10 rootL2_10074624 3300003322 Bacteria 2019
11 Ga0007416J51690_1063129 3300003577 Bacteria 1160
12 Ga0007429J51699_1042183 3300003579 Bacteria 1121
13 Ga0007429J51699_1061302 3300003579 Bacteria 1171
14 Ga0032354_1025730 3300003693 Bacteria 1165
15 Ga0032354_1029296 3300003693 Bacteria 1241
16 Ga0070658_11048546 3300005327 Bacteria 709
17 Ga0070658_11094644 3300005327 Bacteria 693
18 Ga0070670_101387185 3300005331 Bacteria 644
19 Ga0070682_101743674 3300005337 Bacteria 542
20 Ga0070661_101535851 3300005344 Bacteria 562
21 Ga0070661_101657537 3300005344 Bacteria 541
22 Ga0070668_100006332 3300005347 Bacteria 8767
23 Ga0070668_100061386 3300005347 Bacteria 2912
24 Ga0070671_100495613 3300005355 Bacteria 1050
25 Ga0070674_101464779 3300005356 Bacteria 613
26 Ga0070673_100250761 3300005364 Bacteria 1543
27 Ga0070673_100626778 3300005364 Bacteria 983
28 Ga0070688_100292218 3300005365 Bacteria 1175
29 Ga0070714_100701866 3300005435 Bacteria 976
30 Ga0070711_100504463 3300005439 Bacteria 998
31 Ga0070705_100581700 3300005440 Bacteria 863
32 Ga0070663_101644050 3300005455 Bacteria 573
33 Ga0070663_101975712 3300005455 Bacteria 525
34 Ga0070663_102056618 3300005455 Unclassified 514
35 Ga0070678_101758410 3300005456 Bacteria 584
36 Ga0068867_100923453 3300005459 Bacteria 787
37 Ga0070685_10126142 3300005466 Bacteria 1595
38 Ga0070706_100902664 3300005467 Bacteria 816
39 Ga0070706_101768331 3300005467 Bacteria 562
40 Ga0070679_100147650 3300005530 Bacteria 2329
41 Ga0070679_100531672 3300005530 Bacteria 1120
42 Ga0070684_100004172 3300005535 Bacteria 10946
43 Ga0070696_101787330 3300005546 Bacteria 531
44 Ga0070665_100211002 3300005548 Bacteria 1942
45 Ga0070665_100231808 3300005548 Bacteria 1846
46 Ga0070664_100012655 3300005564 Bacteria 6868
47 Ga0068857_100588213 3300005577 Bacteria 1051
48 Ga0068856_100377249 3300005614 Bacteria 1437
49 Ga0068856_101599078 3300005614 Bacteria 665
50 Ga0070702_101707865 3300005615 Bacteria 523
51 Ga0068859_100296266 3300005617 Bacteria 1711
52 Ga0068864_101892774 3300005618 Bacteria 602
53 Ga0068861_100255067 3300005719 Bacteria 1499
54 Ga0068870_10391554 3300005840 Bacteria 902
55 Ga0068863_100079631 3300005841 Bacteria 3102
56 Ga0068858_100016326 3300005842 Bacteria 6975
57 Ga0068860_100310559 3300005843 Bacteria 1546
58 Ga0068862_100100369 3300005844 Bacteria 2531
59 Ga0081540_1203247 3300005983 Bacteria 719
60 Ga0081539_10004749 3300005985 Bacteria 14675
61 Ga0070717_10417338 3300006028 Bacteria 1207
62 Ga0070717_11892795 3300006028 Bacteria 538
63 Ga0097621_101166590 3300006237 Bacteria 725
64 Ga0068871_101133766 3300006358 Bacteria 732
65 Ga0068871_101153809 3300006358 Bacteria 726
66 Ga0075428_100045398 3300006844 Bacteria 4827
67 Ga0075428_100065981 3300006844 Bacteria 3964
68 Ga0075428_100179491 3300006844 Bacteria 2292
69 Ga0075430_100256297 3300006846 Bacteria 1449
70 Ga0075431_100219596 3300006847 Bacteria 1939
71 Ga0097620_100296262 3300006931 Bacteria 1711
72 Ga0114129_11995780 3300009147 Unclassified 702
73 Ga0114129_12627652 3300009147 Bacteria 601
74 Ga0105243_12406206 3300009148 Bacteria 565
75 Ga0105249_10915917 3300009553 Bacteria 944
76 Ga0105239_13526443 3300010375 Bacteria 508
77 Ga0157374_10596248 3300013296 Bacteria 1114
78 Ga0157378_10669841 3300013297 Bacteria 1055
79 Ga0163163_10388673 3300014325 Bacteria 1453
80 Ga0163163_10561120 3300014325 Bacteria 1204
81 Ga0163163_11905788 3300014325 Bacteria 654
82 Ga0157380_11584762 3300014326 Bacteria 710
83 Ga0157380_12962993 3300014326 Bacteria 541
84 Ga0157377_10591446 3300014745 Bacteria 790
85 Ga0157379_10487321 3300014968 Bacteria 1142
86 Ga0157379_12188514 3300014968 Bacteria 549
87 Ga0157376_10263606 3300014969 Bacteria 1615
88 Ga0197907_10658842 3300020069 Bacteria 2987
89 Ga0206356_11584224 3300020070 Bacteria 571
90 Ga0206349_1285386 3300020075 Bacteria 702
91 Ga0206349_1606679 3300020075 Bacteria 632
92 Ga0206349_1702649 3300020075 Bacteria 2897
93 Ga0206351_10804673 3300020077 Bacteria 702
94 Ga0206350_10971910 3300020080 Bacteria 2276
95 Ga0206350_11334707 3300020080 Bacteria 1110
96 Ga0206354_10028728 3300020081 Bacteria 514
97 Ga0206354_10074721 3300020081 Bacteria 1172
98 Ga0206354_11648055 3300020081 Bacteria 528
99 Ga0224712_10007500 3300022467 Bacteria 3180
100 Ga0224712_10087515 3300022467 Bacteria 1298
101 Ga0224712_10110150 3300022467 Bacteria 1180
102 Ga0207692_11209062 3300025898 Bacteria 502
103 Ga0207684_10732773 3300025910 Bacteria 839
104 Ga0207657_10412745 3300025919 Bacteria 1061
105 Ga0207652_10102625 3300025921 Bacteria 2528
106 Ga0207652_10702948 3300025921 Bacteria 902
107 Ga0207650_10859786 3300025925 Bacteria 770
108 Ga0207700_10151839 3300025928 Bacteria 1915
109 Ga0207664_10599694 3300025929 Bacteria 989
110 Ga0207664_10693510 3300025929 Bacteria 916
111 Ga0207709_11738470 3300025935 Bacteria 519
112 Ga0207669_11313129 3300025937 Bacteria 615
113 Ga0207689_10682957 3300025942 Bacteria 865
114 Ga0207661_10034450 3300025944 Bacteria 3937
115 Ga0207679_10065757 3300025945 Bacteria 2715
116 Ga0207651_10589150 3300025960 Bacteria 971
117 Ga0207668_10012142 3300025972 Bacteria 5264
118 Ga0207668_10013265 3300025972 Bacteria 5069
119 Ga0207668_11176783 3300025972 Bacteria 689
120 Ga0207703_10613005 3300026035 Bacteria 1030
121 Ga0207678_10827642 3300026067 Bacteria 818
122 Ga0207702_10296752 3300026078 Bacteria 1533
123 Ga0207641_10209887 3300026088 Bacteria 1800
124 Ga0207648_11344802 3300026089 Bacteria 671
125 Ga0207674_10599759 3300026116 Bacteria 1064
126 Ga0207675_100501728 3300026118 Bacteria 1208
127 Ga0207675_100805586 3300026118 Bacteria 953
128 Ga0207675_101565598 3300026118 Bacteria 680
129 Ga0207683_11587552 3300026121 Bacteria 603
130 Ga0268266_10242613 3300028379 Bacteria 1664
131 Ga0268266_11052585 3300028379 Bacteria 787
132 Ga0268265_10347846 3300028380 Bacteria 1352
133 Ga0268265_10534466 3300028380 Bacteria 1110
134 Ga0268264_10279069 3300028381 Bacteria 1564
135 Ga0307517_10108267 3300028786 Bacteria 2135
136 Ga0307515_10011201 3300028794 Bacteria 17047
137 Ga0307515_10028654 3300028794 Bacteria 9453
138 Ga0307515_10054200 3300028794 Bacteria 5894
139 Ga0307512_10021541 3300030522 Bacteria 5810
140 Ga0307512_10081321 3300030522 Bacteria 2325
141 Ga0307512_10106336 3300030522 Bacteria 1873
142 Ga0307512_10221180 3300030522 Bacteria 989
143 Ga0307513_10008787 3300031456 Bacteria 12865
144 Ga0307513_10034217 3300031456 Bacteria 5704
145 Ga0307509_10005942 3300031507 Bacteria 16697
146 Ga0307408_100840058 3300031548 Bacteria 836
147 Ga0307508_10000224 3300031616 Bacteria 68776
148 Ga0307508_10002986 3300031616 Bacteria 17445
149 Ga0307516_10076605 3300031730 Bacteria 3196
150 Ga0307516_10695781 3300031730 Bacteria 673
151 Ga0307405_10022101 3300031731 Bacteria 3590
152 Ga0307405_10185187 3300031731 Bacteria 1498
153 Ga0307405_10374273 3300031731 Bacteria 1107
154 Ga0307405_10497761 3300031731 Bacteria 976
155 Ga0307405_11983962 3300031731 Bacteria 520
156 Ga0307405_12140442 3300031731 Bacteria 503
157 Ga0307413_10022371 3300031824 Bacteria 3406
158 Ga0307413_10198396 3300031824 Bacteria 1447
159 Ga0307413_10873443 3300031824 Bacteria 762
160 Ga0307413_12182051 3300031824 Bacteria 502
161 Ga0307410_10500513 3300031852 Bacteria 1000
162 Ga0307410_10667421 3300031852 Bacteria 873
163 Ga0307410_10963881 3300031852 Bacteria 734
164 Ga0307410_11283812 3300031852 Bacteria 640
165 Ga0307410_11421597 3300031852 Bacteria 609
166 Ga0326468_10001318 3300031889 Bacteria 2184
167 Ga0307406_10005291 3300031901 Bacteria 7058
168 Ga0307406_10426857 3300031901 Bacteria 1057
169 Ga0307406_10585312 3300031901 Bacteria 918
170 Ga0307406_10652886 3300031901 Bacteria 873
171 Ga0307406_11308270 3300031901 Bacteria 633
172 Ga0307406_11757827 3300031901 Bacteria 550
173 Ga0307406_12103452 3300031901 Bacteria 506
174 Ga0307407_10057384 3300031903 Bacteria 2258
175 Ga0307407_10409555 3300031903 Bacteria 975
176 Ga0307407_10712025 3300031903 Bacteria 757
177 Ga0307412_10043263 3300031911 Bacteria 2932
178 Ga0307412_10784408 3300031911 Bacteria 826
179 Ga0307409_100000242 3300031995 Bacteria 21986
180 Ga0307409_100286232 3300031995 Bacteria 1526
181 Ga0307416_100014054 3300032002 Bacteria 5466
182 Ga0307411_10065776 3300032005 Bacteria 2433
183 Ga0307411_10490779 3300032005 Bacteria 1036
184 Ga0307411_10641329 3300032005 Bacteria 918
185 Ga0307415_100021057 3300032126 Bacteria 3998
186 Ga0307415_100215416 3300032126 Bacteria 1535
187 Ga0307415_100314907 3300032126 Bacteria 1302
188 Ga0307415_100453040 3300032126 Bacteria 1110
189 Ga0307415_100664105 3300032126 Bacteria 936
190 Ga0307415_101678440 3300032126 Bacteria 612
191 Ga0307510_10189674 3300033180 Bacteria 1605
192 Ga0307510_10490738 3300033180 Bacteria 670
193 Ga0307510_10512452 3300033180 Bacteria 643
194 Ga0373948_0010708 3300034817 Bacteria 1607
195 Ga0373938_0009012 3300034957 Bacteria 1796
196 Ga0373940_0002443 3300035088 Bacteria 3615
197 Ga0373951_0000184 3300035091 Bacteria 22487
198 Ga0373941_0012893 3300035115 Bacteria 2196
199 Ga0373962_0001703 3300035242 Bacteria 5229
200 Ga0373935_0013891 3300035692 Bacteria 4862
201 Ga0373937_0273127 3300036401 Bacteria 1596
202 Ga0373925_1558178 3300037068 Bacteria 540
203 Ga0395905_0140158 3300037471 Bacteria 2275
204 Ga0436364_1295561 3300037853 Bacteria 1203
205 Ga0395901_0079225 3300038443 Bacteria 3430
206 Ga0451791_1790024 3300041451 Bacteria 523
207 Ga0451795_0757019 3300041456 Bacteria 739
208 Ga0451802_0792482 3300041460 Bacteria 662
209 Ga0451833_0095635 3300041491 Bacteria 517
210 Ga0451837_0183861 3300041494 Bacteria 630
211 Ga0451853_0673941 3300041512 Bacteria 1686
212 Ga0451853_4004562 3300041512 Bacteria 607
213 Ga0439448_0028590 3300042005 Bacteria 1762
214 Ga0466969_0017255 3300044656 Bacteria 3772
215 Ga0466969_0246857 3300044656 Bacteria 809
216 Ga0466966_0365454 3300044684 Bacteria 867
217 Ga0466961_0113240 3300044693 Bacteria 1706
218 Ga0466970_0134382 3300044765 Bacteria 1360
219 Ga0466957_0304961 3300044842 Bacteria 1071
220 Ga0466959_0299095 3300045049 Bacteria 1102
221 Ga0466958_1159106 3300045836 Bacteria 505
222 Ga0495638_0202195 3300046460 Bacteria 1121
223 Ga0495594_0486345 3300046499 Bacteria 701
224 Ga0495608_0144914 3300046511 Bacteria 1515
225 Ga0495632_0035857 3300046519 Bacteria 2527
226 Ga0495657_0150575 3300046675 Bacteria 1445
227 Ga0495649_0390757 3300046694 Bacteria 699
228 Ga0496108_0000294 3300048911 Bacteria 42903
229 Ga0496108_0255624 3300048911 Bacteria 1524
230 Ga0496108_1084617 3300048911 Bacteria 681
231 Ga0496109_1366173 3300048912 Bacteria 644
232 Ga0496126_0071755 3300048929 Bacteria 3082
233 nmdc:mga05p37_1742664_c1 3300050507 Bacteria 605
234 nmdc:mga09592_1389845_c1 3300050508 Bacteria 574
235 nmdc:mga0qj67_116367_c2 3300050509 Bacteria 1235
236 nmdc:mga0qj67_666022_c1 3300050509 Bacteria 830
237 nmdc:mga06r32_1672309_c1 3300050510 Bacteria 574
238 nmdc:mga06r32_385490_c1 3300050510 Bacteria 1384
239 nmdc:mga06r32_78289_c1 3300050510 Bacteria 3213
240 nmdc:mga08y16_700831_c1 3300050511 Bacteria 1012
241 Ga0495601_0042620 3300053077 Bacteria 2848
242 Ga0500646_0154578 3300053090 Bacteria 762
243 Ga0500651_0115728 3300053093 Bacteria 1632
244 Ga0500641_0146934 3300053096 Bacteria 1018
245 Ga0500650_0038717 3300053098 Bacteria 2195
246 Ga0500562_060926 3300053108 Bacteria 1014
247 Ga0500569_006091 3300053109 Bacteria 2629
248 Ga0500594_0249108 3300053118 Bacteria 591
249 Ga0500652_027604 3300053131 Bacteria 2196
250 Ga0500559_0276039 3300053136 Bacteria 791
251 Ga0500579_054799 3300053143 Bacteria 2412
252 Ga0500600_0048080 3300053149 Bacteria 2430
253 Ga0500604_0352434 3300053151 Bacteria 511
254 Ga0500630_122254 3300053159 Bacteria 1151
255 Ga0500633_0229876 3300053160 Bacteria 691
256 Ga0500611_027604 3300053727 Bacteria 1145
257 Ga0587073_0302946 3300059492 Bacteria 521
258 Ga0587082_027953 3300059504 Bacteria 965
259 Ga0587128_049357 3300059630 Bacteria 763
260 2515494788 2515154088 Bacteria 5526283
261 2515718794 2515154129 Bacteria 5584369
262 2515755450 2515154137 Bacteria 5711575
263 2516083001 2515154202 Bacteria 5471270
264 2516090086 2515154203 Bacteria 5458536
265 2753269077 2751185782 Bacteria 11227053
266 2772644368 2772190715 Bacteria 6959372
267 2855674463 2855670206 Bacteria 7120389
268 2855678451 2855676851 Bacteria 7063653
269 2855687167 2855683550 Bacteria 7134265
270 2857292978 2857288857 Bacteria 7189066
271 2858854881 2858848962 Bacteria 6963058
272 2858885829 2858882152 Bacteria 7230291
273 2858890817 2858888857 Bacteria 7060307
274 2858899511 2858895516 Bacteria 7378898
275 2867305140 2867302475 Bacteria 7087181
276 2869049177 2869048445 Bacteria 6875584
277 2869064773 2869061728 Bacteria 7112407
278 2869073286 2869068681 Bacteria 7205615
279 2880492201 2880489317 Bacteria 7096270
280 2880500084 2880495981 Bacteria 7340502
281 2929228643 2929226422 Bacteria 7248583
282 8003833085 8003830390 Bacteria 6541657
283 8003876401 8003870546 Bacteria 7396674
284 8054707516 8054704163 Bacteria 7247792
285 8054732255 8054727385 Bacteria 7558670
286 8054739554 8054734606 Bacteria 6947278
287 8055069127 8055066027 Bacteria 9479577
288 Ga0395898_0021656
289 Ga0006778J45830_1082839
290 Ga0006778J45830_1101705
291 Ga0006777J48905_1026119
292 Ga0006777J48905_1026845
293 rootH1_10074106
294 rootH2_10103106
295 rootH2_10198378
296 rootL2_10031737
297 rootL2_10074624
298 Ga0007416J51690_1063129
299 Ga0007429J51699_1042183
300 Ga0007429J51699_1061302
301 Ga0032354_1025730
302 Ga0032354_1029296
303 Ga0070658_11048546
304 Ga0070658_11094644
305 Ga0070670_101387185
306 Ga0070682_101743674
307 Ga0070661_101535851
308 Ga0070661_101657537
309 Ga0070668_100006332
310 Ga0070668_100061386
311 Ga0070671_100495613
312 Ga0070674_101464779
313 Ga0070673_100250761
314 Ga0070673_100626778
315 Ga0070688_100292218
316 Ga0070714_100701866
317 Ga0070711_100504463
318 Ga0070705_100581700
319 Ga0070663_101644050
320 Ga0070663_101975712
321 Ga0070663_102056618
322 Ga0070678_101758410
323 Ga0068867_100923453
324 Ga0070685_10126142
325 Ga0070706_100902664
326 Ga0070706_101768331
327 Ga0070679_100147650
328 Ga0070679_100531672
329 Ga0070684_100004172
330 Ga0070696_101787330
331 Ga0070665_100211002
332 Ga0070665_100231808
333 Ga0070664_100012655
334 Ga0068857_100588213
335 Ga0068856_100377249
336 Ga0068856_101599078
337 Ga0070702_101707865
338 Ga0068859_100296266
339 Ga0068864_101892774
340 Ga0068861_100255067
341 Ga0068870_10391554
342 Ga0068863_100079631
343 Ga0068858_100016326
344 Ga0068860_100310559
345 Ga0068862_100100369
346 Ga0081540_1203247
347 Ga0081539_10004749
348 Ga0070717_10417338
349 Ga0070717_11892795
350 Ga0097621_101166590
351 Ga0068871_101133766
352 Ga0068871_101153809
353 Ga0075428_100045398
354 Ga0075428_100065981
355 Ga0075428_100179491
356 Ga0075430_100256297
357 Ga0075431_100219596
358 Ga0097620_100296262
359 Ga0114129_11995780
360 Ga0114129_12627652
361 Ga0105243_12406206
362 Ga0105249_10915917
363 Ga0105239_13526443
364 Ga0157374_10596248
365 Ga0157378_10669841
366 Ga0163163_10388673
367 Ga0163163_10561120
368 Ga0163163_11905788
369 Ga0157380_11584762
370 Ga0157380_12962993
371 Ga0157377_10591446
372 Ga0157379_10487321
373 Ga0157379_12188514
374 Ga0157376_10263606
375 Ga0197907_10658842
376 Ga0206356_11584224
377 Ga0206349_1285386
378 Ga0206349_1606679
379 Ga0206349_1702649
380 Ga0206351_10804673
381 Ga0206350_10971910
382 Ga0206350_11334707
383 Ga0206354_10028728
384 Ga0206354_10074721
385 Ga0206354_11648055
386 Ga0224712_10007500
387 Ga0224712_10087515
388 Ga0224712_10110150
389 Ga0207692_11209062
390 Ga0207684_10732773
391 Ga0207657_10412745
392 Ga0207652_10102625
393 Ga0207652_10702948
394 Ga0207650_10859786
395 Ga0207700_10151839
396 Ga0207664_10599694
397 Ga0207664_10693510
398 Ga0207709_11738470
399 Ga0207669_11313129
400 Ga0207689_10682957
401 Ga0207661_10034450
402 Ga0207679_10065757
403 Ga0207651_10589150
404 Ga0207668_10012142
405 Ga0207668_10013265
406 Ga0207668_11176783
407 Ga0207703_10613005
408 Ga0207678_10827642
409 Ga0207702_10296752
410 Ga0207641_10209887
411 Ga0207648_11344802
412 Ga0207674_10599759
413 Ga0207675_100501728
414 Ga0207675_100805586
415 Ga0207675_101565598
416 Ga0207683_11587552
417 Ga0268266_10242613
418 Ga0268266_11052585
419 Ga0268265_10347846
420 Ga0268265_10534466
421 Ga0268264_10279069
422 Ga0307517_10108267
423 Ga0307515_10011201
424 Ga0307515_10028654
425 Ga0307515_10054200
426 Ga0307512_10021541
427 Ga0307512_10081321
428 Ga0307512_10106336
429 Ga0307512_10221180
430 Ga0307513_10008787
431 Ga0307513_10034217
432 Ga0307509_10005942
433 Ga0307408_100840058
434 Ga0307508_10000224
435 Ga0307508_10002986
436 Ga0307516_10076605
437 Ga0307516_10695781
438 Ga0307405_10022101
439 Ga0307405_10185187
440 Ga0307405_10374273
441 Ga0307405_10497761
442 Ga0307405_11983962
443 Ga0307405_12140442
444 Ga0307413_10022371
445 Ga0307413_10198396
446 Ga0307413_10873443
447 Ga0307413_12182051
448 Ga0307410_10500513
449 Ga0307410_10667421
450 Ga0307410_10963881
451 Ga0307410_11283812
452 Ga0307410_11421597
453 Ga0326468_10001318
454 Ga0307406_10005291
455 Ga0307406_10426857
456 Ga0307406_10585312
457 Ga0307406_10652886
458 Ga0307406_11308270
459 Ga0307406_11757827
460 Ga0307406_12103452
461 Ga0307407_10057384
462 Ga0307407_10409555
463 Ga0307407_10712025
464 Ga0307412_10043263
465 Ga0307412_10784408
466 Ga0307409_100000242
467 Ga0307409_100286232
468 Ga0307416_100014054
469 Ga0307411_10065776
470 Ga0307411_10490779
471 Ga0307411_10641329
472 Ga0307415_100021057
473 Ga0307415_100215416
474 Ga0307415_100314907
475 Ga0307415_100453040
476 Ga0307415_100664105
477 Ga0307415_101678440
478 Ga0307510_10189674
479 Ga0307510_10490738
480 Ga0307510_10512452
481 Ga0373948_0010708
482 Ga0373938_0009012
483 Ga0373940_0002443
484 Ga0373951_0000184
485 Ga0373941_0012893
486 Ga0373962_0001703
487 Ga0373935_0013891
488 Ga0373937_0273127
489 Ga0373925_1558178
490 Ga0395905_0140158
491 Ga0436364_1295561
492 Ga0395901_0079225
493 Ga0451791_1790024
494 Ga0451795_0757019
495 Ga0451802_0792482
496 Ga0451833_0095635
497 Ga0451837_0183861
498 Ga0451853_0673941
499 Ga0451853_4004562
500 Ga0439448_0028590
501 Ga0466969_0017255
502 Ga0466969_0246857
503 Ga0466966_0365454
504 Ga0466961_0113240
505 Ga0466970_0134382
506 Ga0466957_0304961
507 Ga0466959_0299095
508 Ga0466958_1159106
509 Ga0495638_0202195
510 Ga0495594_0486345
511 Ga0495608_0144914
512 Ga0495632_0035857
513 Ga0495657_0150575
514 Ga0495649_0390757
515 Ga0496108_0000294
516 Ga0496108_0255624
517 Ga0496108_1084617
518 Ga0496109_1366173
519 Ga0496126_0071755
520 nmdc:mga05p37_1742664_c1
521 nmdc:mga09592_1389845_c1
522 nmdc:mga0qj67_116367_c2
523 nmdc:mga0qj67_666022_c1
524 nmdc:mga06r32_1672309_c1
525 nmdc:mga06r32_385490_c1
526 nmdc:mga06r32_78289_c1
527 nmdc:mga08y16_700831_c1
528 Ga0495601_0042620
529 Ga0500646_0154578
530 Ga0500651_0115728
531 Ga0500641_0146934
532 Ga0500650_0038717
533 Ga0500562_060926
534 Ga0500569_006091
535 Ga0500594_0249108
536 Ga0500652_027604
537 Ga0500559_0276039
538 Ga0500579_054799
539 Ga0500600_0048080
540 Ga0500604_0352434
541 Ga0500630_122254
542 Ga0500633_0229876
543 Ga0500611_027604
544 Ga0587073_0302946
545 Ga0587082_027953
546 Ga0587128_049357
547 2515494788
548 2515718794
549 2515755450
550 2516083001
551 2516090086
552 2753269077
553 2772644368
554 2855674463
555 2855678451
556 2855687167
557 2857292978
558 2858854881
559 2858885829
560 2858890817
561 2858899511
562 2867305140
563 2869049177
564 2869064773
565 2869073286
566 2880492201
567 2880500084
568 2929228643
569 8003833085
570 8003876401
571 8054707516
572 8054732255
573 8054739554
574 8055069127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14019

DUF4235

Protein of unknown function (DUF4235)

13

89

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cgp-assembly1.cif.gz_E cryo-em structure of the human mitochondrial translocase tim22 complex at 3.7 angstrom. 0.642 18 81
5mbv-assembly1.cif.gz_A cryo-em structure of lambda phage protein gams bound to recbcd. 0.6215 5 75
7cgp-assembly1.cif.gz_E cryo-em structure of the human mitochondrial translocase tim22 complex at 3.7 angstrom. 0.5866 18 81
4y28-assembly1.cif.gz_K the structure of plant photosystem i super-complex at 2.8 angstrom resolution. 0.5165 18 71
6lo8-assembly1.cif.gz_E cryo-em structure of the tim22 complex from yeast 0.5165 1 80
ID Description Score Start End Superfamily
af_Q556G9_87_392_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.731 12 73 1.50.40.10
af_Q4DEN8_11_297_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.6834 12 72 1.50.40.10
2uuzA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Host-nuclease inhibitor protein Gam 0.5742 5 76 1.10.10.2020
af_A3FIN4_284_534_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.556 1 83 3.40.1110.10
af_F4JTI1_459_631_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5344 17 85 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A6G2MXI6-F1-model_v4 DUF4235 domain-containing protein 0.9788 13 89 GO:0004364
GO:0005737
GO:0016020
AF-F5XPD5-F1-model_v4 DUF4235 domain-containing protein 0.9574 1 88 GO:0016020
AF-A0A7V8ZKE7-F1-model_v4 DUF4235 domain-containing protein 0.9517 6 89
AF-A0A2W5YEA3-F1-model_v4 DUF4235 domain-containing protein 0.9497 4 89
AF-A0A7W1NHS5-F1-model_v4 deleted 0.9385 8 89

Map