F388003
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 287 | 159 | 285 | 392 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10007731|Ga0105238_100077316 |
| Length | 425 |
| Sequence | MGLRHGVETQKSPVCSCFLLCEETLMKIDLLSPQSFAAGHPLAQYRWLRDNAPVFWHEEPNGPGFWAVMRYKDVWTVDRDFQNFSSEPTIMIQDPAAEQAMGFGGYKMMLMMDPPQHTAYRKLIRNEFTQPVSAGRAPRLNELARRIVDAVIDRGECDFVEHVAGEMPSYVIAELLGIPLDDGRELYKLTEAIHTAPEAQDPGAGGMAVMKMFEYGRGVIEEKRARPKDDLATKLLQAEVDGKKLNDIEFLLFFLLLVDAGGDTTRNLLSSGLIALFENPAQLAWLQADLDARLPSAREELLRYTTPVIYMRRTAKHDVVLGGEQIEEGDKVVMYFGSANRDPEKFDAPDALNLARNPNEHIAFGTGPHGCLGQHIARLEIDAILREVLTRLDDLKIGSAEWLPSNFISGPKHLPVTFKPARRAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 4 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 18 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 21 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 23 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 28 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 29 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 33 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 34 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 35 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 55 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 56 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 90 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 91 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 92 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 93 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 94 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 95 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 96 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 98 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 99 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 100 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 101 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 102 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 104 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 105 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 106 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 107 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 110 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 111 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 112 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 113 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 114 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 115 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 116 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 117 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 118 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 131 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 132 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 133 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 134 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 157 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 158 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.3 |
| Metatranscriptomes | 0 |
| Isolates | 0.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.79 |
| Nodule | 0 |
| Rhizoplane | 1.39 |
| Rhizosphere | 91.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10075661 | 3300003320 | Bacteria | 6877 |
| 2 | Ga0055530_10000148 | 3300003791 | Bacteria | 63227 |
| 3 | Ga0055531_10010689 | 3300003794 | Bacteria | 4528 |
| 4 | Ga0070658_10104415 | 3300005327 | Bacteria | 2344 |
| 5 | Ga0070680_100001903 | 3300005336 | Bacteria | 15329 |
| 6 | Ga0070680_100002769 | 3300005336 | Bacteria | 13017 |
| 7 | Ga0070680_100097040 | 3300005336 | Bacteria | 2444 |
| 8 | Ga0070660_100025061 | 3300005339 | Bacteria | 4431 |
| 9 | Ga0070691_10008776 | 3300005341 | Bacteria | 4628 |
| 10 | Ga0070691_10022070 | 3300005341 | Bacteria | 2951 |
| 11 | Ga0070661_100000176 | 3300005344 | Bacteria | 52370 |
| 12 | Ga0070661_100012159 | 3300005344 | Bacteria | 6019 |
| 13 | Ga0070661_100088065 | 3300005344 | Bacteria | 2297 |
| 14 | Ga0070659_100000145 | 3300005366 | Bacteria | 54825 |
| 15 | Ga0070659_100027072 | 3300005366 | Bacteria | 4414 |
| 16 | Ga0070714_100100793 | 3300005435 | Bacteria | 2544 |
| 17 | Ga0070714_100105537 | 3300005435 | Unclassified | 2488 |
| 18 | Ga0070713_100000221 | 3300005436 | Bacteria | 37775 |
| 19 | Ga0070711_100058720 | 3300005439 | Bacteria | 2668 |
| 20 | Ga0070708_100194592 | 3300005445 | Unclassified | 1897 |
| 21 | Ga0070681_10000005 | 3300005458 | Bacteria | 183053 |
| 22 | Ga0070681_10011519 | 3300005458 | Bacteria | 8753 |
| 23 | Ga0070679_100000988 | 3300005530 | Bacteria | 24750 |
| 24 | Ga0068853_100003037 | 3300005539 | Bacteria | 12820 |
| 25 | Ga0068853_100033884 | 3300005539 | Bacteria | 4333 |
| 26 | Ga0068853_100049364 | 3300005539 | Bacteria | 3616 |
| 27 | Ga0068853_100140729 | 3300005539 | Bacteria | 2166 |
| 28 | Ga0070695_100009701 | 3300005545 | Bacteria | 5733 |
| 29 | Ga0070665_100000194 | 3300005548 | Bacteria | 107719 |
| 30 | Ga0068855_100000010 | 3300005563 | Bacteria | 246022 |
| 31 | Ga0068855_100004622 | 3300005563 | Bacteria | 16797 |
| 32 | Ga0068855_100021493 | 3300005563 | Bacteria | 7738 |
| 33 | Ga0068855_100031988 | 3300005563 | Bacteria | 6281 |
| 34 | Ga0068855_100094000 | 3300005563 | Bacteria | 3457 |
| 35 | Ga0068855_100103308 | 3300005563 | Bacteria | 3279 |
| 36 | Ga0068855_100231968 | 3300005563 | Bacteria | 2066 |
| 37 | Ga0070664_100064245 | 3300005564 | Bacteria | 3130 |
| 38 | Ga0068857_100004085 | 3300005577 | Bacteria | 12298 |
| 39 | Ga0068856_100004310 | 3300005614 | Bacteria | 14204 |
| 40 | Ga0068852_100020459 | 3300005616 | Bacteria | 5264 |
| 41 | Ga0068852_100036115 | 3300005616 | Unclassified | 4131 |
| 42 | Ga0068852_100074539 | 3300005616 | Bacteria | 2989 |
| 43 | Ga0068852_100116990 | 3300005616 | Bacteria | 2433 |
| 44 | Ga0068859_100030404 | 3300005617 | Bacteria | 5419 |
| 45 | Ga0068863_100053295 | 3300005841 | Bacteria | 3834 |
| 46 | Ga0068863_100099596 | 3300005841 | Bacteria | 2762 |
| 47 | Ga0068862_100069949 | 3300005844 | Bacteria | 3030 |
| 48 | Ga0068862_100197020 | 3300005844 | Bacteria | 1815 |
| 49 | Ga0081539_10023478 | 3300005985 | Bacteria | 4040 |
| 50 | Ga0070716_100010955 | 3300006173 | Unclassified | 4562 |
| 51 | Ga0070712_100000063 | 3300006175 | Bacteria | 53564 |
| 52 | Ga0070712_100000091 | 3300006175 | Bacteria | 45150 |
| 53 | Ga0097621_100053739 | 3300006237 | Bacteria | 3283 |
| 54 | Ga0075434_100102829 | 3300006871 | Unclassified | 2864 |
| 55 | Ga0068865_100006097 | 3300006881 | Bacteria | 7354 |
| 56 | Ga0075436_100000054 | 3300006914 | Bacteria | 68580 |
| 57 | Ga0075436_100107936 | 3300006914 | Bacteria | 1941 |
| 58 | Ga0097620_100030404 | 3300006931 | Bacteria | 5419 |
| 59 | Ga0075435_100135973 | 3300007076 | Bacteria | 2059 |
| 60 | Ga0105240_10000675 | 3300009093 | Bacteria | 62663 |
| 61 | Ga0105240_10004713 | 3300009093 | Bacteria | 20588 |
| 62 | Ga0105240_10005438 | 3300009093 | Bacteria | 18985 |
| 63 | Ga0105240_10043887 | 3300009093 | Bacteria | 5686 |
| 64 | Ga0105240_10119792 | 3300009093 | Bacteria | 3170 |
| 65 | Ga0105240_10319462 | 3300009093 | Bacteria | 1770 |
| 66 | Ga0105247_10076895 | 3300009101 | Bacteria | 2097 |
| 67 | Ga0105241_10185101 | 3300009174 | Bacteria | 1730 |
| 68 | Ga0105242_10029252 | 3300009176 | Bacteria | 4392 |
| 69 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 70 | Ga0105248_10000115 | 3300009177 | Bacteria | 90607 |
| 71 | Ga0105248_10068074 | 3300009177 | Bacteria | 3998 |
| 72 | Ga0105248_10102489 | 3300009177 | Bacteria | 3226 |
| 73 | Ga0105237_10247598 | 3300009545 | Bacteria | 1784 |
| 74 | Ga0105238_10007731 | 3300009551 | Bacteria | 10750 |
| 75 | Ga0105238_10014297 | 3300009551 | Bacteria | 8024 |
| 76 | Ga0105238_10021455 | 3300009551 | Bacteria | 6578 |
| 77 | Ga0105238_10030394 | 3300009551 | Bacteria | 5498 |
| 78 | Ga0105238_10040588 | 3300009551 | Bacteria | 4715 |
| 79 | Ga0105249_10014253 | 3300009553 | Bacteria | 7028 |
| 80 | Ga0105239_10001127 | 3300010375 | Bacteria | 36856 |
| 81 | Ga0105239_10009679 | 3300010375 | Bacteria | 10837 |
| 82 | Ga0105239_10062541 | 3300010375 | Unclassified | 4085 |
| 83 | Ga0157373_10013658 | 3300013100 | Bacteria | 5954 |
| 84 | Ga0157373_10022480 | 3300013100 | Bacteria | 4576 |
| 85 | Ga0157370_10001490 | 3300013104 | Bacteria | 29004 |
| 86 | Ga0157370_10024393 | 3300013104 | Bacteria | 5990 |
| 87 | Ga0157370_10044410 | 3300013104 | Bacteria | 4272 |
| 88 | Ga0157369_10009924 | 3300013105 | Bacteria | 10880 |
| 89 | Ga0157369_10016283 | 3300013105 | Bacteria | 8370 |
| 90 | Ga0157369_10039464 | 3300013105 | Bacteria | 5159 |
| 91 | Ga0157378_10064491 | 3300013297 | Bacteria | 3277 |
| 92 | Ga0163162_10132086 | 3300013306 | Unclassified | 2606 |
| 93 | Ga0157372_10017682 | 3300013307 | Bacteria | 7652 |
| 94 | Ga0157372_10055166 | 3300013307 | Bacteria | 4437 |
| 95 | Ga0157372_10070975 | 3300013307 | Bacteria | 3921 |
| 96 | Ga0157372_10268373 | 3300013307 | Unclassified | 1982 |
| 97 | Ga0163163_10044187 | 3300014325 | Bacteria | 4370 |
| 98 | Ga0157379_10001216 | 3300014968 | Bacteria | 20925 |
| 99 | Ga0157379_10012689 | 3300014968 | Bacteria | 7363 |
| 100 | Ga0157379_10040017 | 3300014968 | Bacteria | 4183 |
| 101 | Ga0213876_10000777 | 3300021384 | Bacteria | 21847 |
| 102 | Ga0209026_1003775 | 3300025250 | Bacteria | 4804 |
| 103 | Ga0209758_1000733 | 3300025297 | Bacteria | 47932 |
| 104 | Ga0209050_1000029 | 3300025298 | Bacteria | 465801 |
| 105 | Ga0209257_1000714 | 3300025304 | Bacteria | 51177 |
| 106 | Ga0209257_1002598 | 3300025304 | Bacteria | 17521 |
| 107 | Ga0207710_10046664 | 3300025900 | Bacteria | 1934 |
| 108 | Ga0207699_10000853 | 3300025906 | Bacteria | 14498 |
| 109 | Ga0207705_10000629 | 3300025909 | Bacteria | 29508 |
| 110 | Ga0207705_10000647 | 3300025909 | Bacteria | 28998 |
| 111 | Ga0207707_10000005 | 3300025912 | Bacteria | 382024 |
| 112 | Ga0207707_10007787 | 3300025912 | Bacteria | 9325 |
| 113 | Ga0207707_10010988 | 3300025912 | Bacteria | 7877 |
| 114 | Ga0207707_10038929 | 3300025912 | Bacteria | 4156 |
| 115 | Ga0207695_10000003 | 3300025913 | Bacteria | 1368691 |
| 116 | Ga0207695_10003482 | 3300025913 | Bacteria | 22145 |
| 117 | Ga0207695_10004818 | 3300025913 | Bacteria | 18247 |
| 118 | Ga0207695_10010733 | 3300025913 | Bacteria | 11178 |
| 119 | Ga0207695_10057936 | 3300025913 | Bacteria | 4023 |
| 120 | Ga0207695_10229324 | 3300025913 | Bacteria | 1762 |
| 121 | Ga0207671_10013993 | 3300025914 | Bacteria | 6364 |
| 122 | Ga0207693_10000277 | 3300025915 | Bacteria | 47557 |
| 123 | Ga0207693_10000314 | 3300025915 | Bacteria | 45167 |
| 124 | Ga0207663_10001862 | 3300025916 | Bacteria | 9981 |
| 125 | Ga0207660_10000520 | 3300025917 | Bacteria | 25691 |
| 126 | Ga0207660_10000720 | 3300025917 | Bacteria | 22059 |
| 127 | Ga0207660_10000769 | 3300025917 | Bacteria | 21337 |
| 128 | Ga0207660_10040659 | 3300025917 | Bacteria | 3256 |
| 129 | Ga0207660_10185483 | 3300025917 | Bacteria | 1618 |
| 130 | Ga0207657_10000704 | 3300025919 | Bacteria | 35496 |
| 131 | Ga0207657_10002443 | 3300025919 | Bacteria | 20074 |
| 132 | Ga0207657_10005106 | 3300025919 | Bacteria | 13753 |
| 133 | Ga0207649_10000031 | 3300025920 | Bacteria | 146217 |
| 134 | Ga0207652_10000623 | 3300025921 | Bacteria | 35115 |
| 135 | Ga0207652_10001317 | 3300025921 | Bacteria | 22056 |
| 136 | Ga0207652_10002779 | 3300025921 | Bacteria | 14710 |
| 137 | Ga0207652_10011406 | 3300025921 | Bacteria | 7165 |
| 138 | Ga0207694_10000011 | 3300025924 | Bacteria | 417640 |
| 139 | Ga0207694_10015719 | 3300025924 | Bacteria | 5709 |
| 140 | Ga0207694_10033976 | 3300025924 | Bacteria | 3909 |
| 141 | Ga0207694_10123568 | 3300025924 | Bacteria | 2068 |
| 142 | Ga0207700_10001559 | 3300025928 | Bacteria | 12989 |
| 143 | Ga0207700_10034938 | 3300025928 | Bacteria | 3615 |
| 144 | Ga0207664_10038987 | 3300025929 | Unclassified | 3686 |
| 145 | Ga0207664_10134757 | 3300025929 | Bacteria | 2083 |
| 146 | Ga0207644_10190446 | 3300025931 | Bacteria | 1612 |
| 147 | Ga0207686_10025265 | 3300025934 | Bacteria | 3453 |
| 148 | Ga0207704_10016185 | 3300025938 | Bacteria | 3825 |
| 149 | Ga0207711_10000002 | 3300025941 | Bacteria | 1228676 |
| 150 | Ga0207711_10001863 | 3300025941 | Bacteria | 19217 |
| 151 | Ga0207711_10109412 | 3300025941 | Bacteria | 2456 |
| 152 | Ga0207711_10169957 | 3300025941 | Bacteria | 1978 |
| 153 | Ga0207679_10049973 | 3300025945 | Bacteria | 3053 |
| 154 | Ga0207667_10000093 | 3300025949 | Bacteria | 145814 |
| 155 | Ga0207667_10001457 | 3300025949 | Bacteria | 29683 |
| 156 | Ga0207667_10008517 | 3300025949 | Bacteria | 12179 |
| 157 | Ga0207667_10045932 | 3300025949 | Bacteria | 4624 |
| 158 | Ga0207667_10071037 | 3300025949 | Bacteria | 3621 |
| 159 | Ga0207712_10065460 | 3300025961 | Bacteria | 2594 |
| 160 | Ga0207712_10103670 | 3300025961 | Bacteria | 2120 |
| 161 | Ga0207639_10001289 | 3300026041 | Bacteria | 16914 |
| 162 | Ga0207639_10008657 | 3300026041 | Bacteria | 6984 |
| 163 | Ga0207639_10017743 | 3300026041 | Bacteria | 5047 |
| 164 | Ga0207639_10037669 | 3300026041 | Bacteria | 3593 |
| 165 | Ga0207702_10000030 | 3300026078 | Bacteria | 178718 |
| 166 | Ga0207702_10001030 | 3300026078 | Bacteria | 28588 |
| 167 | Ga0207641_10157096 | 3300026088 | Bacteria | 2064 |
| 168 | Ga0207674_10000374 | 3300026116 | Bacteria | 58155 |
| 169 | Ga0207683_10071933 | 3300026121 | Bacteria | 3058 |
| 170 | Ga0207698_10143665 | 3300026142 | Bacteria | 2060 |
| 171 | Ga0268266_10000005 | 3300028379 | Bacteria | 1448194 |
| 172 | Ga0268266_10019125 | 3300028379 | Bacteria | 5833 |
| 173 | Ga0268265_10173624 | 3300028380 | Bacteria | 1845 |
| 174 | Ga0268265_10255089 | 3300028380 | Bacteria | 1556 |
| 175 | Ga0265318_10000052 | 3300028577 | Bacteria | 116086 |
| 176 | Ga0307517_10046161 | 3300028786 | Bacteria | 4556 |
| 177 | Ga0265338_10000153 | 3300028800 | Bacteria | 126163 |
| 178 | Ga0265338_10006667 | 3300028800 | Bacteria | 14602 |
| 179 | Ga0265338_10013367 | 3300028800 | Bacteria | 9274 |
| 180 | Ga0265338_10037140 | 3300028800 | Bacteria | 4644 |
| 181 | Ga0307511_10080949 | 3300030521 | Bacteria | 2284 |
| 182 | Ga0265332_10013224 | 3300031238 | Bacteria | 3660 |
| 183 | Ga0265320_10026248 | 3300031240 | Bacteria | 3051 |
| 184 | Ga0265325_10000001 | 3300031241 | Bacteria | 726814 |
| 185 | Ga0265325_10000027 | 3300031241 | Bacteria | 106598 |
| 186 | Ga0265325_10036377 | 3300031241 | Bacteria | 2608 |
| 187 | Ga0265339_10000630 | 3300031249 | Bacteria | 27291 |
| 188 | Ga0265339_10000745 | 3300031249 | Bacteria | 25163 |
| 189 | Ga0265331_10000037 | 3300031250 | Bacteria | 197251 |
| 190 | Ga0265331_10070987 | 3300031250 | Bacteria | 1629 |
| 191 | Ga0265331_10082213 | 3300031250 | Bacteria | 1495 |
| 192 | Ga0265327_10000505 | 3300031251 | Bacteria | 67742 |
| 193 | Ga0265316_10078804 | 3300031344 | Bacteria | 2528 |
| 194 | Ga0307513_10003498 | 3300031456 | Bacteria | 21262 |
| 195 | Ga0307513_10215790 | 3300031456 | Bacteria | 1745 |
| 196 | Ga0265313_10003454 | 3300031595 | Bacteria | 12787 |
| 197 | Ga0265314_10008687 | 3300031711 | Bacteria | 8689 |
| 198 | Ga0265314_10016100 | 3300031711 | Bacteria | 5920 |
| 199 | Ga0265314_10017140 | 3300031711 | Bacteria | 5694 |
| 200 | Ga0265314_10026560 | 3300031711 | Bacteria | 4349 |
| 201 | Ga0265342_10025936 | 3300031712 | Bacteria | 3679 |
| 202 | Ga0307516_10009947 | 3300031730 | Bacteria | 10535 |
| 203 | Ga0373936_0008453 | 3300035113 | Bacteria | 3876 |
| 204 | Ga0373955_0052798 | 3300035172 | Bacteria | 2218 |
| 205 | Ga0373937_0003263 | 3300036401 | Bacteria | 13613 |
| 206 | Ga0373925_0056729 | 3300037068 | Bacteria | 2934 |
| 207 | Ga0395899_0000880 | 3300037312 | Bacteria | 28530 |
| 208 | Ga0395900_0000016 | 3300037418 | Bacteria | 382407 |
| 209 | Ga0395900_0013015 | 3300037418 | Bacteria | 8502 |
| 210 | Ga0395898_0035462 | 3300037466 | Bacteria | 4960 |
| 211 | Ga0395905_0001348 | 3300037471 | Bacteria | 29903 |
| 212 | Ga0395905_0048498 | 3300037471 | Bacteria | 3980 |
| 213 | Ga0395905_0081350 | 3300037471 | Bacteria | 3036 |
| 214 | Ga0395905_0082291 | 3300037471 | Bacteria | 3017 |
| 215 | Ga0395905_0202242 | 3300037471 | Bacteria | 1862 |
| 216 | Ga0395905_0234214 | 3300037471 | Bacteria | 1717 |
| 217 | Ga0395901_0000022 | 3300038443 | Bacteria | 296356 |
| 218 | Ga0436365_0167933 | 3300039437 | Bacteria | 86872 |
| 219 | Ga0436361_0177120 | 3300039447 | Bacteria | 8563 |
| 220 | Ga0466961_0046324 | 3300044693 | Bacteria | 2782 |
| 221 | Ga0466961_0114254 | 3300044693 | Bacteria | 1697 |
| 222 | Ga0453684_0376381 | 3300044712 | Bacteria | 1595 |
| 223 | Ga0495641_0062237 | 3300046461 | Bacteria | 1684 |
| 224 | Ga0495594_0120186 | 3300046499 | Bacteria | 1485 |
| 225 | Ga0495583_0028327 | 3300046506 | Bacteria | 2755 |
| 226 | Ga0495628_0061877 | 3300046516 | Bacteria | 2935 |
| 227 | Ga0495642_0001388 | 3300046528 | Bacteria | 10837 |
| 228 | Ga0495668_0009070 | 3300046616 | Bacteria | 6141 |
| 229 | Ga0495634_0110619 | 3300046642 | Bacteria | 1767 |
| 230 | Ga0495611_0027174 | 3300046648 | Bacteria | 2500 |
| 231 | Ga0495635_0060084 | 3300046663 | Bacteria | 2613 |
| 232 | Ga0495680_0063608 | 3300047322 | Bacteria | 2833 |
| 233 | Ga0495677_0042896 | 3300047445 | Bacteria | 1658 |
| 234 | Ga0495686_0122621 | 3300047472 | Bacteria | 1547 |
| 235 | Ga0496107_0109236 | 3300048910 | Bacteria | 2032 |
| 236 | Ga0496111_0187224 | 3300048914 | Bacteria | 1539 |
| 237 | Ga0496115_0000237 | 3300048918 | Bacteria | 50057 |
| 238 | Ga0496115_0026055 | 3300048918 | Bacteria | 4560 |
| 239 | Ga0496126_0000432 | 3300048929 | Bacteria | 84190 |
| 240 | Ga0495682_0001385 | 3300049460 | Bacteria | 13229 |
| 241 | Ga0501033_0070433 | 3300049570 | Bacteria | 2569 |
| 242 | Ga0501034_0008547 | 3300049571 | Bacteria | 10806 |
| 243 | Ga0501034_0023229 | 3300049571 | Bacteria | 6319 |
| 244 | Ga0501036_0013931 | 3300049572 | Bacteria | 6687 |
| 245 | Ga0501037_0199289 | 3300049573 | Bacteria | 1415 |
| 246 | Ga0501038_0015781 | 3300049574 | Bacteria | 6864 |
| 247 | Ga0501043_0089673 | 3300049579 | Unclassified | 2417 |
| 248 | Ga0501043_0229203 | 3300049579 | Bacteria | 1435 |
| 249 | Ga0501046_0153304 | 3300049580 | Unclassified | 1737 |
| 250 | Ga0501047_0001450 | 3300049581 | Bacteria | 23225 |
| 251 | Ga0501047_0003511 | 3300049581 | Bacteria | 14815 |
| 252 | Ga0501047_0007464 | 3300049581 | Bacteria | 10292 |
| 253 | Ga0501047_0019998 | 3300049581 | Bacteria | 6427 |
| 254 | Ga0501047_0248861 | 3300049581 | Bacteria | 1626 |
| 255 | Ga0501048_0124607 | 3300049582 | Bacteria | 1822 |
| 256 | Ga0501069_0008148 | 3300049585 | Bacteria | 5504 |
| 257 | Ga0501070_0000020 | 3300049586 | Bacteria | 169025 |
| 258 | Ga0501070_0010089 | 3300049586 | Bacteria | 7993 |
| 259 | Ga0501070_0012940 | 3300049586 | Bacteria | 7033 |
| 260 | Ga0501070_0042421 | 3300049586 | Bacteria | 3789 |
| 261 | Ga0501070_0095498 | 3300049586 | Bacteria | 2460 |
| 262 | Ga0501072_0018295 | 3300049588 | Bacteria | 5392 |
| 263 | Ga0501073_0005981 | 3300049589 | Bacteria | 9077 |
| 264 | Ga0501073_0075833 | 3300049589 | Bacteria | 2340 |
| 265 | Ga0501074_0022761 | 3300049590 | Bacteria | 4555 |
| 266 | Ga0501079_0020049 | 3300049741 | Bacteria | 5108 |
| 267 | Ga0501080_0007775 | 3300049742 | Bacteria | 9691 |
| 268 | Ga0501080_0034380 | 3300049742 | Bacteria | 4731 |
| 269 | Ga0501080_0152821 | 3300049742 | Bacteria | 2133 |
| 270 | Ga0501083_0070858 | 3300049744 | Bacteria | 2318 |
| 271 | Ga0501035_0006911 | 3300049822 | Bacteria | 10599 |
| 272 | Ga0501044_0001220 | 3300049823 | Bacteria | 30540 |
| 273 | Ga0501044_0004505 | 3300049823 | Bacteria | 15579 |
| 274 | Ga0501044_0015914 | 3300049823 | Bacteria | 8094 |
| 275 | Ga0501044_0025544 | 3300049823 | Bacteria | 6261 |
| 276 | Ga0501044_0052311 | 3300049823 | Bacteria | 4209 |
| 277 | Ga0501044_0092152 | 3300049823 | Unclassified | 3056 |
| 278 | Ga0501044_0253938 | 3300049823 | Bacteria | 1698 |
| 279 | nmdc:mga0n895_117069_c1 | 3300050512 | Unclassified | 2684 |
| 280 | nmdc:mga08x19_167_c1 | 3300050514 | Bacteria | 54732 |
| 281 | Ga0500595_022974 | 3300053119 | Bacteria | 2197 |
| 282 | Ga0500645_003763 | 3300053730 | Bacteria | 6045 |
| 283 | Ga0501084_0000236 | 3300054114 | Bacteria | 41685 |
| 284 | Ga0501082_0160753 | 3300060353 | Bacteria | 1952 |
| 285 | Ga0501082_0285853 | 3300060353 | Bacteria | 1436 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300060353 | Ga0501082_0285853 | Ga0501082_0285853_62_1066 | 327 |
| 2 | 3300009093 | Ga0105240_10004713 | Ga0105240_100047133 | 347 |
| 3 | 3300025913 | Ga0207695_10004818 | Ga0207695_100048183 | 347 |
| 4 | 3300044712 | Ga0453684_0376381 | Ga0453684_0376381_309_1421 | 347 |
| 5 | 3300005327 | Ga0070658_10104415 | Ga0070658_101044152 | 372 |
| 6 | 3300005366 | Ga0070659_100000145 | Ga0070659_10000014543 | 372 |
| 7 | 3300005366 | Ga0070659_100027072 | Ga0070659_1000270722 | 372 |
| 8 | 3300005539 | Ga0068853_100033884 | Ga0068853_1000338842 | 372 |
| 9 | 3300005548 | Ga0070665_100000194 | Ga0070665_10000019440 | 372 |
| 10 | 3300005563 | Ga0068855_100004622 | Ga0068855_1000046226 | 372 |
| 11 | 3300025909 | Ga0207705_10000629 | Ga0207705_1000062924 | 372 |
| 12 | 3300025912 | Ga0207707_10010988 | Ga0207707_100109886 | 372 |
| 13 | 3300025917 | Ga0207660_10000769 | Ga0207660_1000076917 | 372 |
| 14 | 3300025919 | Ga0207657_10000704 | Ga0207657_100007046 | 372 |
| 15 | 3300025919 | Ga0207657_10005106 | Ga0207657_100051069 | 372 |
| 16 | 3300025921 | Ga0207652_10011406 | Ga0207652_100114065 | 372 |
| 17 | 3300025924 | Ga0207694_10123568 | Ga0207694_101235681 | 372 |
| 18 | 3300025949 | Ga0207667_10001457 | Ga0207667_100014576 | 372 |
| 19 | 3300026041 | Ga0207639_10008657 | Ga0207639_100086573 | 372 |
| 20 | 3300028379 | Ga0268266_10000005 | Ga0268266_10000005522 | 372 |
| 21 | 3300049579 | Ga0501043_0089673 | Ga0501043_0089673_20_1138 | 372 |
| 22 | 3300035113 | Ga0373936_0008453 | Ga0373936_0008453_1566_2756 | 373 |
| 23 | 3300037471 | Ga0395905_0202242 | Ga0395905_0202242_291_1496 | 374 |
| 24 | 3300044693 | Ga0466961_0114254 | Ga0466961_0114254_328_1524 | 375 |
| 25 | 3300048918 | Ga0496115_0026055 | Ga0496115_0026055_820_2013 | 375 |
| 26 | 3300009551 | Ga0105238_10021455 | Ga0105238_100214555 | 376 |
| 27 | 3300005985 | Ga0081539_10023478 | Ga0081539_100234781 | 377 |
| 28 | 3300028800 | Ga0265338_10013367 | Ga0265338_100133678 | 377 |
| 29 | 3300037312 | Ga0395899_0000880 | Ga0395899_0000880_26832_28034 | 377 |
| 30 | 3300037418 | Ga0395900_0000016 | Ga0395900_0000016_141341_142543 | 377 |
| 31 | 3300038443 | Ga0395901_0000022 | Ga0395901_0000022_179423_180625 | 377 |
| 32 | 3300048914 | Ga0496111_0187224 | Ga0496111_0187224_51_1259 | 377 |
| 33 | 3300003791 | Ga0055530_10000148 | Ga0055530_1000014831 | 378 |
| 34 | 3300003794 | Ga0055531_10010689 | Ga0055531_100106892 | 378 |
| 35 | 3300005563 | Ga0068855_100103308 | Ga0068855_1001033084 | 378 |
| 36 | 3300005841 | Ga0068863_100053295 | Ga0068863_1000532952 | 378 |
| 37 | 3300025297 | Ga0209758_1000733 | Ga0209758_100073316 | 378 |
| 38 | 3300025298 | Ga0209050_1000029 | Ga0209050_1000029359 | 378 |
| 39 | 3300025304 | Ga0209257_1000714 | Ga0209257_100071411 | 378 |
| 40 | 3300030521 | Ga0307511_10080949 | Ga0307511_100809492 | 378 |
| 41 | 3300048918 | Ga0496115_0000237 | Ga0496115_0000237_32260_33453 | 378 |
| 42 | 3300053119 | Ga0500595_022974 | Ga0500595_022974_150_1340 | 378 |
| 43 | 3300006237 | Ga0097621_100053739 | Ga0097621_1000537393 | 379 |
| 44 | 3300009093 | Ga0105240_10119792 | Ga0105240_101197924 | 379 |
| 45 | 3300009177 | Ga0105248_10102489 | Ga0105248_101024891 | 379 |
| 46 | 3300025931 | Ga0207644_10190446 | Ga0207644_101904462 | 379 |
| 47 | 3300025941 | Ga0207711_10169957 | Ga0207711_101699572 | 379 |
| 48 | 3300026121 | Ga0207683_10071933 | Ga0207683_100719331 | 379 |
| 49 | 3300028379 | Ga0268266_10019125 | Ga0268266_100191251 | 379 |
| 50 | 3300028786 | Ga0307517_10046161 | Ga0307517_100461613 | 379 |
| 51 | 3300031456 | Ga0307513_10003498 | Ga0307513_1000349823 | 379 |
| 52 | 3300046506 | Ga0495583_0028327 | Ga0495583_0028327_196_1386 | 379 |
| 53 | 3300046528 | Ga0495642_0001388 | Ga0495642_0001388_9516_10706 | 379 |
| 54 | 3300046648 | Ga0495611_0027174 | Ga0495611_0027174_464_1654 | 379 |
| 55 | 3300047445 | Ga0495677_0042896 | Ga0495677_0042896_248_1438 | 379 |
| 56 | 3300048910 | Ga0496107_0109236 | Ga0496107_0109236_614_1852 | 379 |
| 57 | 3300005336 | Ga0070680_100002769 | Ga0070680_1000027693 | 380 |
| 58 | 3300005563 | Ga0068855_100021493 | Ga0068855_1000214933 | 380 |
| 59 | 3300005563 | Ga0068855_100094000 | Ga0068855_1000940002 | 380 |
| 60 | 3300005616 | Ga0068852_100074539 | Ga0068852_1000745392 | 380 |
| 61 | 3300007076 | Ga0075435_100135973 | Ga0075435_1001359731 | 380 |
| 62 | 3300009093 | Ga0105240_10319462 | Ga0105240_103194622 | 380 |
| 63 | 3300009177 | Ga0105248_10068074 | Ga0105248_100680741 | 380 |
| 64 | 3300009551 | Ga0105238_10040588 | Ga0105238_100405884 | 380 |
| 65 | 3300013104 | Ga0157370_10044410 | Ga0157370_100444103 | 380 |
| 66 | 3300013307 | Ga0157372_10055166 | Ga0157372_100551664 | 380 |
| 67 | 3300025250 | Ga0209026_1003775 | Ga0209026_10037753 | 380 |
| 68 | 3300025912 | Ga0207707_10007787 | Ga0207707_100077873 | 380 |
| 69 | 3300025913 | Ga0207695_10010733 | Ga0207695_100107335 | 380 |
| 70 | 3300025917 | Ga0207660_10040659 | Ga0207660_100406594 | 380 |
| 71 | 3300025941 | Ga0207711_10109412 | Ga0207711_101094121 | 380 |
| 72 | 3300025949 | Ga0207667_10045932 | Ga0207667_100459322 | 380 |
| 73 | 3300035172 | Ga0373955_0052798 | Ga0373955_0052798_975_2174 | 380 |
| 74 | 3300046616 | Ga0495668_0009070 | Ga0495668_0009070_3978_5168 | 380 |
| 75 | 3300047472 | Ga0495686_0122621 | Ga0495686_0122621_61_1251 | 380 |
| 76 | 3300049581 | Ga0501047_0248861 | Ga0501047_0248861_107_1300 | 380 |
| 77 | 3300053730 | Ga0500645_003763 | Ga0500645_003763_1857_3047 | 380 |
| 78 | 3300006881 | Ga0068865_100006097 | Ga0068865_1000060974 | 381 |
| 79 | 3300009177 | Ga0105248_10000115 | Ga0105248_1000011544 | 381 |
| 80 | 3300014325 | Ga0163163_10044187 | Ga0163163_100441872 | 381 |
| 81 | 3300025913 | Ga0207695_10003482 | Ga0207695_1000348221 | 381 |
| 82 | 3300025938 | Ga0207704_10016185 | Ga0207704_100161852 | 381 |
| 83 | 3300025941 | Ga0207711_10001863 | Ga0207711_100018634 | 381 |
| 84 | 3300049581 | Ga0501047_0007464 | Ga0501047_0007464_3531_4724 | 381 |
| 85 | 3300005336 | Ga0070680_100097040 | Ga0070680_1000970403 | 382 |
| 86 | 3300005435 | Ga0070714_100100793 | Ga0070714_1001007932 | 382 |
| 87 | 3300005458 | Ga0070681_10011519 | Ga0070681_100115192 | 382 |
| 88 | 3300005563 | Ga0068855_100231968 | Ga0068855_1002319682 | 382 |
| 89 | 3300025913 | Ga0207695_10229324 | Ga0207695_102293242 | 382 |
| 90 | 3300025917 | Ga0207660_10185483 | Ga0207660_101854831 | 382 |
| 91 | 3300025928 | Ga0207700_10034938 | Ga0207700_100349382 | 382 |
| 92 | 3300025929 | Ga0207664_10134757 | Ga0207664_101347572 | 382 |
| 93 | 3300049823 | Ga0501044_0004505 | Ga0501044_0004505_6763_7959 | 382 |
| 94 | 3300044693 | Ga0466961_0046324 | Ga0466961_0046324_1535_2734 | 385 |
| 95 | 3300005341 | Ga0070691_10008776 | Ga0070691_100087761 | 386 |
| 96 | 3300005344 | Ga0070661_100000176 | Ga0070661_10000017632 | 386 |
| 97 | 3300005344 | Ga0070661_100088065 | Ga0070661_1000880651 | 386 |
| 98 | 3300005539 | Ga0068853_100049364 | Ga0068853_1000493641 | 386 |
| 99 | 3300005545 | Ga0070695_100009701 | Ga0070695_1000097015 | 386 |
| 100 | 3300005564 | Ga0070664_100064245 | Ga0070664_1000642452 | 386 |
| 101 | 3300005577 | Ga0068857_100004085 | Ga0068857_10000408511 | 386 |
| 102 | 3300005616 | Ga0068852_100036115 | Ga0068852_1000361152 | 386 |
| 103 | 3300009093 | Ga0105240_10005438 | Ga0105240_1000543811 | 386 |
| 104 | 3300009545 | Ga0105237_10247598 | Ga0105237_102475981 | 386 |
| 105 | 3300009551 | Ga0105238_10030394 | Ga0105238_100303945 | 386 |
| 106 | 3300010375 | Ga0105239_10062541 | Ga0105239_100625413 | 386 |
| 107 | 3300013100 | Ga0157373_10013658 | Ga0157373_100136583 | 386 |
| 108 | 3300013104 | Ga0157370_10001490 | Ga0157370_1000149024 | 386 |
| 109 | 3300013105 | Ga0157369_10039464 | Ga0157369_100394641 | 386 |
| 110 | 3300013306 | Ga0163162_10132086 | Ga0163162_101320862 | 386 |
| 111 | 3300013307 | Ga0157372_10017682 | Ga0157372_100176825 | 386 |
| 112 | 3300014968 | Ga0157379_10012689 | Ga0157379_100126893 | 386 |
| 113 | 3300025913 | Ga0207695_10057936 | Ga0207695_100579364 | 386 |
| 114 | 3300025914 | Ga0207671_10013993 | Ga0207671_100139934 | 386 |
| 115 | 3300025920 | Ga0207649_10000031 | Ga0207649_1000003111 | 386 |
| 116 | 3300025924 | Ga0207694_10015719 | Ga0207694_100157193 | 386 |
| 117 | 3300025945 | Ga0207679_10049973 | Ga0207679_100499732 | 386 |
| 118 | 3300025949 | Ga0207667_10008517 | Ga0207667_100085177 | 386 |
| 119 | 3300026078 | Ga0207702_10001030 | Ga0207702_1000103018 | 386 |
| 120 | 3300026116 | Ga0207674_10000374 | Ga0207674_100003747 | 386 |
| 121 | 3300049580 | Ga0501046_0153304 | Ga0501046_0153304_479_1693 | 386 |
| 122 | 3300005435 | Ga0070714_100105537 | Ga0070714_1001055372 | 387 |
| 123 | 3300005436 | Ga0070713_100000221 | Ga0070713_1000002218 | 387 |
| 124 | 3300005445 | Ga0070708_100194592 | Ga0070708_1001945922 | 387 |
| 125 | 3300005614 | Ga0068856_100004310 | Ga0068856_1000043105 | 387 |
| 126 | 3300006173 | Ga0070716_100010955 | Ga0070716_1000109553 | 387 |
| 127 | 3300006175 | Ga0070712_100000091 | Ga0070712_1000000912 | 387 |
| 128 | 3300006871 | Ga0075434_100102829 | Ga0075434_1001028293 | 387 |
| 129 | 3300006914 | Ga0075436_100000054 | Ga0075436_10000005443 | 387 |
| 130 | 3300025906 | Ga0207699_10000853 | Ga0207699_100008536 | 387 |
| 131 | 3300025915 | Ga0207693_10000314 | Ga0207693_1000031440 | 387 |
| 132 | 3300025928 | Ga0207700_10001559 | Ga0207700_100015593 | 387 |
| 133 | 3300025929 | Ga0207664_10038987 | Ga0207664_100389872 | 387 |
| 134 | 3300026078 | Ga0207702_10000030 | Ga0207702_1000003051 | 387 |
| 135 | 3300031250 | Ga0265331_10000037 | Ga0265331_10000037110 | 387 |
| 136 | 3300031711 | Ga0265314_10016100 | Ga0265314_100161004 | 387 |
| 137 | 3300050512 | nmdc:mga0n895_117069_c1 | nmdc:mga0n895_117069_c1_120_1328 | 387 |
| 138 | 3300050514 | nmdc:mga08x19_167_c1 | nmdc:mga08x19_167_c1_46084_47292 | 387 |
| 139 | 3300009093 | Ga0105240_10043887 | Ga0105240_100438872 | 388 |
| 140 | 3300013307 | Ga0157372_10268373 | Ga0157372_102683731 | 388 |
| 141 | 3300028800 | Ga0265338_10037140 | Ga0265338_100371403 | 388 |
| 142 | 3300031238 | Ga0265332_10013224 | Ga0265332_100132241 | 388 |
| 143 | 3300031241 | Ga0265325_10000027 | Ga0265325_1000002778 | 388 |
| 144 | 3300031249 | Ga0265339_10000630 | Ga0265339_1000063012 | 388 |
| 145 | 3300009177 | Ga0105248_10000001 | Ga0105248_10000001313 | 389 |
| 146 | 3300025941 | Ga0207711_10000002 | Ga0207711_100000021014 | 389 |
| 147 | 3300025304 | Ga0209257_1002598 | Ga0209257_10025985 | 390 |
| 148 | 3300031251 | Ga0265327_10000505 | Ga0265327_100005052 | 390 |
| 149 | 3300046663 | Ga0495635_0060084 | Ga0495635_0060084_916_2136 | 390 |
| 150 | 3300047322 | Ga0495680_0063608 | Ga0495680_0063608_580_1800 | 390 |
| 151 | 3300049570 | Ga0501033_0070433 | Ga0501033_0070433_1307_2515 | 390 |
| 152 | 3300049586 | Ga0501070_0095498 | Ga0501070_0095498_446_1654 | 390 |
| 153 | 3300049823 | Ga0501044_0052311 | Ga0501044_0052311_723_1931 | 390 |
| 154 | 3300054114 | Ga0501084_0000236 | Ga0501084_0000236_37502_38692 | 390 |
| 155 | 3300060353 | Ga0501082_0160753 | Ga0501082_0160753_96_1286 | 390 |
| 156 | 3300049581 | Ga0501047_0003511 | Ga0501047_0003511_2448_3650 | 392 |
| 157 | 3300049588 | Ga0501072_0018295 | Ga0501072_0018295_2771_3973 | 392 |
| 158 | 3300049589 | Ga0501073_0005981 | Ga0501073_0005981_2533_3735 | 392 |
| 159 | iso_pu_bacteria | 2870782633 | 2870788205 | 392 |
| 160 | 3300009174 | Ga0105241_10185101 | Ga0105241_101851012 | 393 |
| 161 | 3300014968 | Ga0157379_10001216 | Ga0157379_100012168 | 393 |
| 162 | 3300021384 | Ga0213876_10000777 | Ga0213876_100007776 | 393 |
| 163 | 3300031250 | Ga0265331_10070987 | Ga0265331_100709872 | 393 |
| 164 | 3300031344 | Ga0265316_10078804 | Ga0265316_100788042 | 393 |
| 165 | 3300039437 | Ga0436365_0167933 | Ga0436365_0167933_66848_68059 | 393 |
| 166 | 3300049571 | Ga0501034_0008547 | Ga0501034_0008547_5859_7082 | 393 |
| 167 | 3300049579 | Ga0501043_0229203 | Ga0501043_0229203_155_1378 | 393 |
| 168 | 3300049581 | Ga0501047_0001450 | Ga0501047_0001450_2967_4190 | 393 |
| 169 | 3300049586 | Ga0501070_0042421 | Ga0501070_0042421_1222_2445 | 393 |
| 170 | 3300049742 | Ga0501080_0152821 | Ga0501080_0152821_96_1319 | 393 |
| 171 | 3300049823 | Ga0501044_0253938 | Ga0501044_0253938_77_1300 | 393 |
| 172 | 3300005539 | Ga0068853_100003037 | Ga0068853_1000030372 | 394 |
| 173 | 3300026041 | Ga0207639_10001289 | Ga0207639_100012895 | 394 |
| 174 | 3300031240 | Ga0265320_10026248 | Ga0265320_100262481 | 394 |
| 175 | 3300031241 | Ga0265325_10036377 | Ga0265325_100363772 | 394 |
| 176 | 3300048929 | Ga0496126_0000432 | Ga0496126_0000432_58479_59684 | 394 |
| 177 | 3300049586 | Ga0501070_0012940 | Ga0501070_0012940_2793_4052 | 394 |
| 178 | 3300028577 | Ga0265318_10000052 | Ga0265318_1000005260 | 395 |
| 179 | 3300037418 | Ga0395900_0013015 | Ga0395900_0013015_4389_5579 | 395 |
| 180 | 3300037466 | Ga0395898_0035462 | Ga0395898_0035462_2039_3229 | 395 |
| 181 | 3300037471 | Ga0395905_0001348 | Ga0395905_0001348_22487_23677 | 395 |
| 182 | 3300037471 | Ga0395905_0048498 | Ga0395905_0048498_2670_3860 | 395 |
| 183 | 3300037471 | Ga0395905_0081350 | Ga0395905_0081350_567_1757 | 395 |
| 184 | 3300037471 | Ga0395905_0082291 | Ga0395905_0082291_296_1486 | 395 |
| 185 | 3300037471 | Ga0395905_0234214 | Ga0395905_0234214_162_1352 | 395 |
| 186 | 3300009176 | Ga0105242_10029252 | Ga0105242_100292523 | 396 |
| 187 | 3300025934 | Ga0207686_10025265 | Ga0207686_100252652 | 396 |
| 188 | 3300039447 | Ga0436361_0177120 | Ga0436361_0177120_3318_4520 | 397 |
| 189 | 3300005344 | Ga0070661_100012159 | Ga0070661_1000121595 | 398 |
| 190 | 3300005539 | Ga0068853_100140729 | Ga0068853_1001407292 | 398 |
| 191 | 3300005563 | Ga0068855_100000010 | Ga0068855_10000001017 | 398 |
| 192 | 3300005616 | Ga0068852_100020459 | Ga0068852_1000204593 | 398 |
| 193 | 3300005616 | Ga0068852_100116990 | Ga0068852_1001169902 | 398 |
| 194 | 3300009093 | Ga0105240_10000675 | Ga0105240_1000067541 | 398 |
| 195 | 3300009101 | Ga0105247_10076895 | Ga0105247_100768952 | 398 |
| 196 | 3300009551 | Ga0105238_10014297 | Ga0105238_100142973 | 398 |
| 197 | 3300010375 | Ga0105239_10001127 | Ga0105239_1000112728 | 398 |
| 198 | 3300013105 | Ga0157369_10009924 | Ga0157369_100099246 | 398 |
| 199 | 3300013105 | Ga0157369_10016283 | Ga0157369_100162839 | 398 |
| 200 | 3300013297 | Ga0157378_10064491 | Ga0157378_100644912 | 398 |
| 201 | 3300025900 | Ga0207710_10046664 | Ga0207710_100466642 | 398 |
| 202 | 3300025913 | Ga0207695_10000003 | Ga0207695_10000003389 | 398 |
| 203 | 3300025924 | Ga0207694_10000011 | Ga0207694_10000011372 | 398 |
| 204 | 3300025949 | Ga0207667_10000093 | Ga0207667_100000935 | 398 |
| 205 | 3300026041 | Ga0207639_10037669 | Ga0207639_100376693 | 398 |
| 206 | 3300026142 | Ga0207698_10143665 | Ga0207698_101436652 | 398 |
| 207 | 3300031456 | Ga0307513_10215790 | Ga0307513_102157901 | 398 |
| 208 | 3300031730 | Ga0307516_10009947 | Ga0307516_1000994710 | 398 |
| 209 | 3300049460 | Ga0495682_0001385 | Ga0495682_0001385_6687_7886 | 398 |
| 210 | 3300049571 | Ga0501034_0023229 | Ga0501034_0023229_3607_4809 | 398 |
| 211 | 3300049572 | Ga0501036_0013931 | Ga0501036_0013931_210_1412 | 398 |
| 212 | 3300049581 | Ga0501047_0019998 | Ga0501047_0019998_2256_3458 | 398 |
| 213 | 3300049582 | Ga0501048_0124607 | Ga0501048_0124607_549_1802 | 398 |
| 214 | 3300049585 | Ga0501069_0008148 | Ga0501069_0008148_1071_2273 | 398 |
| 215 | 3300049586 | Ga0501070_0010089 | Ga0501070_0010089_2834_4036 | 398 |
| 216 | 3300049589 | Ga0501073_0075833 | Ga0501073_0075833_1035_2237 | 398 |
| 217 | 3300049590 | Ga0501074_0022761 | Ga0501074_0022761_2056_3258 | 398 |
| 218 | 3300049741 | Ga0501079_0020049 | Ga0501079_0020049_962_2164 | 398 |
| 219 | 3300049742 | Ga0501080_0034380 | Ga0501080_0034380_1909_3111 | 398 |
| 220 | 3300049744 | Ga0501083_0070858 | Ga0501083_0070858_951_2153 | 398 |
| 221 | 3300049823 | Ga0501044_0025544 | Ga0501044_0025544_4397_5599 | 398 |
| 222 | iso_pu_bacteria | 2870782633 | 2870786488 | 398 |
| 223 | 3300005336 | Ga0070680_100001903 | Ga0070680_1000019039 | 399 |
| 224 | 3300005439 | Ga0070711_100058720 | Ga0070711_1000587202 | 399 |
| 225 | 3300005458 | Ga0070681_10000005 | Ga0070681_10000005160 | 399 |
| 226 | 3300005530 | Ga0070679_100000988 | Ga0070679_10000098811 | 399 |
| 227 | 3300006175 | Ga0070712_100000063 | Ga0070712_10000006317 | 399 |
| 228 | 3300006914 | Ga0075436_100107936 | Ga0075436_1001079361 | 399 |
| 229 | 3300010375 | Ga0105239_10009679 | Ga0105239_100096793 | 399 |
| 230 | 3300014968 | Ga0157379_10040017 | Ga0157379_100400172 | 399 |
| 231 | 3300025912 | Ga0207707_10000005 | Ga0207707_10000005317 | 399 |
| 232 | 3300025915 | Ga0207693_10000277 | Ga0207693_100002777 | 399 |
| 233 | 3300025916 | Ga0207663_10001862 | Ga0207663_100018629 | 399 |
| 234 | 3300025917 | Ga0207660_10000520 | Ga0207660_100005202 | 399 |
| 235 | 3300025921 | Ga0207652_10000623 | Ga0207652_1000062313 | 399 |
| 236 | 3300028800 | Ga0265338_10000153 | Ga0265338_1000015327 | 399 |
| 237 | 3300031241 | Ga0265325_10000001 | Ga0265325_10000001153 | 399 |
| 238 | 3300031249 | Ga0265339_10000745 | Ga0265339_100007459 | 399 |
| 239 | 3300031250 | Ga0265331_10082213 | Ga0265331_100822131 | 399 |
| 240 | 3300031595 | Ga0265313_10003454 | Ga0265313_100034542 | 399 |
| 241 | 3300031711 | Ga0265314_10017140 | Ga0265314_100171402 | 399 |
| 242 | 3300031711 | Ga0265314_10026560 | Ga0265314_100265602 | 399 |
| 243 | 3300036401 | Ga0373937_0003263 | Ga0373937_0003263_3127_4329 | 399 |
| 244 | 3300037068 | Ga0373925_0056729 | Ga0373925_0056729_1029_2231 | 399 |
| 245 | 3300046516 | Ga0495628_0061877 | Ga0495628_0061877_621_1826 | 399 |
| 246 | 3300049742 | Ga0501080_0007775 | Ga0501080_0007775_7153_8355 | 399 |
| 247 | 3300003320 | rootH2_10075661 | rootH2_100756614 | 400 |
| 248 | 3300005339 | Ga0070660_100025061 | Ga0070660_1000250613 | 400 |
| 249 | 3300005341 | Ga0070691_10022070 | Ga0070691_100220702 | 400 |
| 250 | 3300005563 | Ga0068855_100031988 | Ga0068855_1000319882 | 400 |
| 251 | 3300005617 | Ga0068859_100030404 | Ga0068859_1000304045 | 400 |
| 252 | 3300005841 | Ga0068863_100099596 | Ga0068863_1000995962 | 400 |
| 253 | 3300005844 | Ga0068862_100069949 | Ga0068862_1000699491 | 400 |
| 254 | 3300005844 | Ga0068862_100197020 | Ga0068862_1001970202 | 400 |
| 255 | 3300006931 | Ga0097620_100030404 | Ga0097620_1000304045 | 400 |
| 256 | 3300009551 | Ga0105238_10007731 | Ga0105238_100077316 | 400 |
| 257 | 3300009553 | Ga0105249_10014253 | Ga0105249_100142532 | 400 |
| 258 | 3300013100 | Ga0157373_10022480 | Ga0157373_100224802 | 400 |
| 259 | 3300013104 | Ga0157370_10024393 | Ga0157370_100243934 | 400 |
| 260 | 3300013307 | Ga0157372_10070975 | Ga0157372_100709753 | 400 |
| 261 | 3300025909 | Ga0207705_10000647 | Ga0207705_1000064722 | 400 |
| 262 | 3300025912 | Ga0207707_10038929 | Ga0207707_100389292 | 400 |
| 263 | 3300025917 | Ga0207660_10000720 | Ga0207660_1000072010 | 400 |
| 264 | 3300025919 | Ga0207657_10002443 | Ga0207657_1000244316 | 400 |
| 265 | 3300025921 | Ga0207652_10001317 | Ga0207652_1000131714 | 400 |
| 266 | 3300025921 | Ga0207652_10002779 | Ga0207652_100027798 | 400 |
| 267 | 3300025924 | Ga0207694_10033976 | Ga0207694_100339762 | 400 |
| 268 | 3300025949 | Ga0207667_10071037 | Ga0207667_100710373 | 400 |
| 269 | 3300025961 | Ga0207712_10065460 | Ga0207712_100654602 | 400 |
| 270 | 3300025961 | Ga0207712_10103670 | Ga0207712_101036702 | 400 |
| 271 | 3300026041 | Ga0207639_10017743 | Ga0207639_100177433 | 400 |
| 272 | 3300026088 | Ga0207641_10157096 | Ga0207641_101570962 | 400 |
| 273 | 3300028380 | Ga0268265_10173624 | Ga0268265_101736242 | 400 |
| 274 | 3300028380 | Ga0268265_10255089 | Ga0268265_102550892 | 400 |
| 275 | 3300028800 | Ga0265338_10006667 | Ga0265338_1000666713 | 400 |
| 276 | 3300031711 | Ga0265314_10008687 | Ga0265314_100086874 | 400 |
| 277 | 3300031712 | Ga0265342_10025936 | Ga0265342_100259364 | 400 |
| 278 | 3300046461 | Ga0495641_0062237 | Ga0495641_0062237_340_1545 | 400 |
| 279 | 3300046499 | Ga0495594_0120186 | Ga0495594_0120186_161_1366 | 400 |
| 280 | 3300046642 | Ga0495634_0110619 | Ga0495634_0110619_484_1689 | 400 |
| 281 | 3300049573 | Ga0501037_0199289 | Ga0501037_0199289_159_1361 | 400 |
| 282 | 3300049574 | Ga0501038_0015781 | Ga0501038_0015781_5070_6272 | 400 |
| 283 | 3300049586 | Ga0501070_0000020 | Ga0501070_0000020_63675_64877 | 400 |
| 284 | 3300049822 | Ga0501035_0006911 | Ga0501035_0006911_4318_5520 | 400 |
| 285 | 3300049823 | Ga0501044_0001220 | Ga0501044_0001220_2770_3972 | 400 |
| 286 | 3300049823 | Ga0501044_0015914 | Ga0501044_0015914_6276_7478 | 400 |
| 287 | 3300049823 | Ga0501044_0092152 | Ga0501044_0092152_87_1289 | 400 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6t0l-assembly1.cif.gz_A | crystal structure of cyp124 in complex with inhibitor compound 5' | 0.9419 | 2 | 390 |
| 6t0g-assembly1.cif.gz_A | crystal structure of cyp124 in complex with vitamin d3 | 0.9388 | 2 | 390 |
| 6bld-assembly1.cif.gz_A | mycobacterium marinum cytochrome p450 cyp268a2 in complex with pseudoionone | 0.9256 | 1 | 389 |
| 6t0l-assembly1.cif.gz_A | crystal structure of cyp124 in complex with inhibitor compound 5' | 0.9235 | 2 | 390 |
| 6t0g-assembly1.cif.gz_A | crystal structure of cyp124 in complex with vitamin d3 | 0.9205 | 2 | 390 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ejbD01 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2; | 0.9456 | 281 | 312 | 3.30.43.20 |
| 2x5wA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 | 0.9398 | 3 | 388 | 1.10.630.10 |
| 6bldA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 | 0.9256 | 1 | 389 | 1.10.630.10 |
| 2x5wA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 | 0.9144 | 3 | 388 | 1.10.630.10 |
| 6cvcA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 | 0.9082 | 2 | 390 | 1.10.630.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538AG46-F1-model_v4 | Cytochrome P450 | 0.9781 | 264 | 388 |
GO:0004497
GO:0005506 GO:0016705 GO:0020037 |
| AF-A0A499UEL5-F1-model_v4 | Cytochrome P450 | 0.9748 | 273 | 393 |
GO:0005506
GO:0006707 GO:0008395 GO:0020037 GO:0036199 |
| AF-A0A4Y8LQH6-F1-model_v4 | deleted | 0.9662 | 184 | 389 |
|
| AF-A0A7C3QNC8-F1-model_v4 | Cytochrome P450 | 0.966 | 238 | 389 |
GO:0004497
GO:0005506 GO:0016705 GO:0020037 |
| AF-A0A7K0LW52-F1-model_v4 | Cytochrome P450 | 0.9583 | 270 | 390 |
GO:0004497
GO:0005506 GO:0016705 GO:0020037 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar