F388003

General Info

Members Datasets Scaffolds Average Seq Length
287 159 285 392

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10007731|Ga0105238_100077316
Length 425
Sequence MGLRHGVETQKSPVCSCFLLCEETLMKIDLLSPQSFAAGHPLAQYRWLRDNAPVFWHEEPNGPGFWAVMRYKDVWTVDRDFQNFSSEPTIMIQDPAAEQAMGFGGYKMMLMMDPPQHTAYRKLIRNEFTQPVSAGRAPRLNELARRIVDAVIDRGECDFVEHVAGEMPSYVIAELLGIPLDDGRELYKLTEAIHTAPEAQDPGAGGMAVMKMFEYGRGVIEEKRARPKDDLATKLLQAEVDGKKLNDIEFLLFFLLLVDAGGDTTRNLLSSGLIALFENPAQLAWLQADLDARLPSAREELLRYTTPVIYMRRTAKHDVVLGGEQIEEGDKVVMYFGSANRDPEKFDAPDALNLARNPNEHIAFGTGPHGCLGQHIARLEIDAILREVLTRLDDLKIGSAEWLPSNFISGPKHLPVTFKPARRAA

Samples

Sample ID Description Type Environment
1 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
157 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.79
Nodule 0
Rhizoplane 1.39
Rhizosphere 91.64
Stem 0
Stem Tuber 0
Unclassified 4.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10075661 3300003320 Bacteria 6877
2 Ga0055530_10000148 3300003791 Bacteria 63227
3 Ga0055531_10010689 3300003794 Bacteria 4528
4 Ga0070658_10104415 3300005327 Bacteria 2344
5 Ga0070680_100001903 3300005336 Bacteria 15329
6 Ga0070680_100002769 3300005336 Bacteria 13017
7 Ga0070680_100097040 3300005336 Bacteria 2444
8 Ga0070660_100025061 3300005339 Bacteria 4431
9 Ga0070691_10008776 3300005341 Bacteria 4628
10 Ga0070691_10022070 3300005341 Bacteria 2951
11 Ga0070661_100000176 3300005344 Bacteria 52370
12 Ga0070661_100012159 3300005344 Bacteria 6019
13 Ga0070661_100088065 3300005344 Bacteria 2297
14 Ga0070659_100000145 3300005366 Bacteria 54825
15 Ga0070659_100027072 3300005366 Bacteria 4414
16 Ga0070714_100100793 3300005435 Bacteria 2544
17 Ga0070714_100105537 3300005435 Unclassified 2488
18 Ga0070713_100000221 3300005436 Bacteria 37775
19 Ga0070711_100058720 3300005439 Bacteria 2668
20 Ga0070708_100194592 3300005445 Unclassified 1897
21 Ga0070681_10000005 3300005458 Bacteria 183053
22 Ga0070681_10011519 3300005458 Bacteria 8753
23 Ga0070679_100000988 3300005530 Bacteria 24750
24 Ga0068853_100003037 3300005539 Bacteria 12820
25 Ga0068853_100033884 3300005539 Bacteria 4333
26 Ga0068853_100049364 3300005539 Bacteria 3616
27 Ga0068853_100140729 3300005539 Bacteria 2166
28 Ga0070695_100009701 3300005545 Bacteria 5733
29 Ga0070665_100000194 3300005548 Bacteria 107719
30 Ga0068855_100000010 3300005563 Bacteria 246022
31 Ga0068855_100004622 3300005563 Bacteria 16797
32 Ga0068855_100021493 3300005563 Bacteria 7738
33 Ga0068855_100031988 3300005563 Bacteria 6281
34 Ga0068855_100094000 3300005563 Bacteria 3457
35 Ga0068855_100103308 3300005563 Bacteria 3279
36 Ga0068855_100231968 3300005563 Bacteria 2066
37 Ga0070664_100064245 3300005564 Bacteria 3130
38 Ga0068857_100004085 3300005577 Bacteria 12298
39 Ga0068856_100004310 3300005614 Bacteria 14204
40 Ga0068852_100020459 3300005616 Bacteria 5264
41 Ga0068852_100036115 3300005616 Unclassified 4131
42 Ga0068852_100074539 3300005616 Bacteria 2989
43 Ga0068852_100116990 3300005616 Bacteria 2433
44 Ga0068859_100030404 3300005617 Bacteria 5419
45 Ga0068863_100053295 3300005841 Bacteria 3834
46 Ga0068863_100099596 3300005841 Bacteria 2762
47 Ga0068862_100069949 3300005844 Bacteria 3030
48 Ga0068862_100197020 3300005844 Bacteria 1815
49 Ga0081539_10023478 3300005985 Bacteria 4040
50 Ga0070716_100010955 3300006173 Unclassified 4562
51 Ga0070712_100000063 3300006175 Bacteria 53564
52 Ga0070712_100000091 3300006175 Bacteria 45150
53 Ga0097621_100053739 3300006237 Bacteria 3283
54 Ga0075434_100102829 3300006871 Unclassified 2864
55 Ga0068865_100006097 3300006881 Bacteria 7354
56 Ga0075436_100000054 3300006914 Bacteria 68580
57 Ga0075436_100107936 3300006914 Bacteria 1941
58 Ga0097620_100030404 3300006931 Bacteria 5419
59 Ga0075435_100135973 3300007076 Bacteria 2059
60 Ga0105240_10000675 3300009093 Bacteria 62663
61 Ga0105240_10004713 3300009093 Bacteria 20588
62 Ga0105240_10005438 3300009093 Bacteria 18985
63 Ga0105240_10043887 3300009093 Bacteria 5686
64 Ga0105240_10119792 3300009093 Bacteria 3170
65 Ga0105240_10319462 3300009093 Bacteria 1770
66 Ga0105247_10076895 3300009101 Bacteria 2097
67 Ga0105241_10185101 3300009174 Bacteria 1730
68 Ga0105242_10029252 3300009176 Bacteria 4392
69 Ga0105248_10000001 3300009177 Bacteria 1881304
70 Ga0105248_10000115 3300009177 Bacteria 90607
71 Ga0105248_10068074 3300009177 Bacteria 3998
72 Ga0105248_10102489 3300009177 Bacteria 3226
73 Ga0105237_10247598 3300009545 Bacteria 1784
74 Ga0105238_10007731 3300009551 Bacteria 10750
75 Ga0105238_10014297 3300009551 Bacteria 8024
76 Ga0105238_10021455 3300009551 Bacteria 6578
77 Ga0105238_10030394 3300009551 Bacteria 5498
78 Ga0105238_10040588 3300009551 Bacteria 4715
79 Ga0105249_10014253 3300009553 Bacteria 7028
80 Ga0105239_10001127 3300010375 Bacteria 36856
81 Ga0105239_10009679 3300010375 Bacteria 10837
82 Ga0105239_10062541 3300010375 Unclassified 4085
83 Ga0157373_10013658 3300013100 Bacteria 5954
84 Ga0157373_10022480 3300013100 Bacteria 4576
85 Ga0157370_10001490 3300013104 Bacteria 29004
86 Ga0157370_10024393 3300013104 Bacteria 5990
87 Ga0157370_10044410 3300013104 Bacteria 4272
88 Ga0157369_10009924 3300013105 Bacteria 10880
89 Ga0157369_10016283 3300013105 Bacteria 8370
90 Ga0157369_10039464 3300013105 Bacteria 5159
91 Ga0157378_10064491 3300013297 Bacteria 3277
92 Ga0163162_10132086 3300013306 Unclassified 2606
93 Ga0157372_10017682 3300013307 Bacteria 7652
94 Ga0157372_10055166 3300013307 Bacteria 4437
95 Ga0157372_10070975 3300013307 Bacteria 3921
96 Ga0157372_10268373 3300013307 Unclassified 1982
97 Ga0163163_10044187 3300014325 Bacteria 4370
98 Ga0157379_10001216 3300014968 Bacteria 20925
99 Ga0157379_10012689 3300014968 Bacteria 7363
100 Ga0157379_10040017 3300014968 Bacteria 4183
101 Ga0213876_10000777 3300021384 Bacteria 21847
102 Ga0209026_1003775 3300025250 Bacteria 4804
103 Ga0209758_1000733 3300025297 Bacteria 47932
104 Ga0209050_1000029 3300025298 Bacteria 465801
105 Ga0209257_1000714 3300025304 Bacteria 51177
106 Ga0209257_1002598 3300025304 Bacteria 17521
107 Ga0207710_10046664 3300025900 Bacteria 1934
108 Ga0207699_10000853 3300025906 Bacteria 14498
109 Ga0207705_10000629 3300025909 Bacteria 29508
110 Ga0207705_10000647 3300025909 Bacteria 28998
111 Ga0207707_10000005 3300025912 Bacteria 382024
112 Ga0207707_10007787 3300025912 Bacteria 9325
113 Ga0207707_10010988 3300025912 Bacteria 7877
114 Ga0207707_10038929 3300025912 Bacteria 4156
115 Ga0207695_10000003 3300025913 Bacteria 1368691
116 Ga0207695_10003482 3300025913 Bacteria 22145
117 Ga0207695_10004818 3300025913 Bacteria 18247
118 Ga0207695_10010733 3300025913 Bacteria 11178
119 Ga0207695_10057936 3300025913 Bacteria 4023
120 Ga0207695_10229324 3300025913 Bacteria 1762
121 Ga0207671_10013993 3300025914 Bacteria 6364
122 Ga0207693_10000277 3300025915 Bacteria 47557
123 Ga0207693_10000314 3300025915 Bacteria 45167
124 Ga0207663_10001862 3300025916 Bacteria 9981
125 Ga0207660_10000520 3300025917 Bacteria 25691
126 Ga0207660_10000720 3300025917 Bacteria 22059
127 Ga0207660_10000769 3300025917 Bacteria 21337
128 Ga0207660_10040659 3300025917 Bacteria 3256
129 Ga0207660_10185483 3300025917 Bacteria 1618
130 Ga0207657_10000704 3300025919 Bacteria 35496
131 Ga0207657_10002443 3300025919 Bacteria 20074
132 Ga0207657_10005106 3300025919 Bacteria 13753
133 Ga0207649_10000031 3300025920 Bacteria 146217
134 Ga0207652_10000623 3300025921 Bacteria 35115
135 Ga0207652_10001317 3300025921 Bacteria 22056
136 Ga0207652_10002779 3300025921 Bacteria 14710
137 Ga0207652_10011406 3300025921 Bacteria 7165
138 Ga0207694_10000011 3300025924 Bacteria 417640
139 Ga0207694_10015719 3300025924 Bacteria 5709
140 Ga0207694_10033976 3300025924 Bacteria 3909
141 Ga0207694_10123568 3300025924 Bacteria 2068
142 Ga0207700_10001559 3300025928 Bacteria 12989
143 Ga0207700_10034938 3300025928 Bacteria 3615
144 Ga0207664_10038987 3300025929 Unclassified 3686
145 Ga0207664_10134757 3300025929 Bacteria 2083
146 Ga0207644_10190446 3300025931 Bacteria 1612
147 Ga0207686_10025265 3300025934 Bacteria 3453
148 Ga0207704_10016185 3300025938 Bacteria 3825
149 Ga0207711_10000002 3300025941 Bacteria 1228676
150 Ga0207711_10001863 3300025941 Bacteria 19217
151 Ga0207711_10109412 3300025941 Bacteria 2456
152 Ga0207711_10169957 3300025941 Bacteria 1978
153 Ga0207679_10049973 3300025945 Bacteria 3053
154 Ga0207667_10000093 3300025949 Bacteria 145814
155 Ga0207667_10001457 3300025949 Bacteria 29683
156 Ga0207667_10008517 3300025949 Bacteria 12179
157 Ga0207667_10045932 3300025949 Bacteria 4624
158 Ga0207667_10071037 3300025949 Bacteria 3621
159 Ga0207712_10065460 3300025961 Bacteria 2594
160 Ga0207712_10103670 3300025961 Bacteria 2120
161 Ga0207639_10001289 3300026041 Bacteria 16914
162 Ga0207639_10008657 3300026041 Bacteria 6984
163 Ga0207639_10017743 3300026041 Bacteria 5047
164 Ga0207639_10037669 3300026041 Bacteria 3593
165 Ga0207702_10000030 3300026078 Bacteria 178718
166 Ga0207702_10001030 3300026078 Bacteria 28588
167 Ga0207641_10157096 3300026088 Bacteria 2064
168 Ga0207674_10000374 3300026116 Bacteria 58155
169 Ga0207683_10071933 3300026121 Bacteria 3058
170 Ga0207698_10143665 3300026142 Bacteria 2060
171 Ga0268266_10000005 3300028379 Bacteria 1448194
172 Ga0268266_10019125 3300028379 Bacteria 5833
173 Ga0268265_10173624 3300028380 Bacteria 1845
174 Ga0268265_10255089 3300028380 Bacteria 1556
175 Ga0265318_10000052 3300028577 Bacteria 116086
176 Ga0307517_10046161 3300028786 Bacteria 4556
177 Ga0265338_10000153 3300028800 Bacteria 126163
178 Ga0265338_10006667 3300028800 Bacteria 14602
179 Ga0265338_10013367 3300028800 Bacteria 9274
180 Ga0265338_10037140 3300028800 Bacteria 4644
181 Ga0307511_10080949 3300030521 Bacteria 2284
182 Ga0265332_10013224 3300031238 Bacteria 3660
183 Ga0265320_10026248 3300031240 Bacteria 3051
184 Ga0265325_10000001 3300031241 Bacteria 726814
185 Ga0265325_10000027 3300031241 Bacteria 106598
186 Ga0265325_10036377 3300031241 Bacteria 2608
187 Ga0265339_10000630 3300031249 Bacteria 27291
188 Ga0265339_10000745 3300031249 Bacteria 25163
189 Ga0265331_10000037 3300031250 Bacteria 197251
190 Ga0265331_10070987 3300031250 Bacteria 1629
191 Ga0265331_10082213 3300031250 Bacteria 1495
192 Ga0265327_10000505 3300031251 Bacteria 67742
193 Ga0265316_10078804 3300031344 Bacteria 2528
194 Ga0307513_10003498 3300031456 Bacteria 21262
195 Ga0307513_10215790 3300031456 Bacteria 1745
196 Ga0265313_10003454 3300031595 Bacteria 12787
197 Ga0265314_10008687 3300031711 Bacteria 8689
198 Ga0265314_10016100 3300031711 Bacteria 5920
199 Ga0265314_10017140 3300031711 Bacteria 5694
200 Ga0265314_10026560 3300031711 Bacteria 4349
201 Ga0265342_10025936 3300031712 Bacteria 3679
202 Ga0307516_10009947 3300031730 Bacteria 10535
203 Ga0373936_0008453 3300035113 Bacteria 3876
204 Ga0373955_0052798 3300035172 Bacteria 2218
205 Ga0373937_0003263 3300036401 Bacteria 13613
206 Ga0373925_0056729 3300037068 Bacteria 2934
207 Ga0395899_0000880 3300037312 Bacteria 28530
208 Ga0395900_0000016 3300037418 Bacteria 382407
209 Ga0395900_0013015 3300037418 Bacteria 8502
210 Ga0395898_0035462 3300037466 Bacteria 4960
211 Ga0395905_0001348 3300037471 Bacteria 29903
212 Ga0395905_0048498 3300037471 Bacteria 3980
213 Ga0395905_0081350 3300037471 Bacteria 3036
214 Ga0395905_0082291 3300037471 Bacteria 3017
215 Ga0395905_0202242 3300037471 Bacteria 1862
216 Ga0395905_0234214 3300037471 Bacteria 1717
217 Ga0395901_0000022 3300038443 Bacteria 296356
218 Ga0436365_0167933 3300039437 Bacteria 86872
219 Ga0436361_0177120 3300039447 Bacteria 8563
220 Ga0466961_0046324 3300044693 Bacteria 2782
221 Ga0466961_0114254 3300044693 Bacteria 1697
222 Ga0453684_0376381 3300044712 Bacteria 1595
223 Ga0495641_0062237 3300046461 Bacteria 1684
224 Ga0495594_0120186 3300046499 Bacteria 1485
225 Ga0495583_0028327 3300046506 Bacteria 2755
226 Ga0495628_0061877 3300046516 Bacteria 2935
227 Ga0495642_0001388 3300046528 Bacteria 10837
228 Ga0495668_0009070 3300046616 Bacteria 6141
229 Ga0495634_0110619 3300046642 Bacteria 1767
230 Ga0495611_0027174 3300046648 Bacteria 2500
231 Ga0495635_0060084 3300046663 Bacteria 2613
232 Ga0495680_0063608 3300047322 Bacteria 2833
233 Ga0495677_0042896 3300047445 Bacteria 1658
234 Ga0495686_0122621 3300047472 Bacteria 1547
235 Ga0496107_0109236 3300048910 Bacteria 2032
236 Ga0496111_0187224 3300048914 Bacteria 1539
237 Ga0496115_0000237 3300048918 Bacteria 50057
238 Ga0496115_0026055 3300048918 Bacteria 4560
239 Ga0496126_0000432 3300048929 Bacteria 84190
240 Ga0495682_0001385 3300049460 Bacteria 13229
241 Ga0501033_0070433 3300049570 Bacteria 2569
242 Ga0501034_0008547 3300049571 Bacteria 10806
243 Ga0501034_0023229 3300049571 Bacteria 6319
244 Ga0501036_0013931 3300049572 Bacteria 6687
245 Ga0501037_0199289 3300049573 Bacteria 1415
246 Ga0501038_0015781 3300049574 Bacteria 6864
247 Ga0501043_0089673 3300049579 Unclassified 2417
248 Ga0501043_0229203 3300049579 Bacteria 1435
249 Ga0501046_0153304 3300049580 Unclassified 1737
250 Ga0501047_0001450 3300049581 Bacteria 23225
251 Ga0501047_0003511 3300049581 Bacteria 14815
252 Ga0501047_0007464 3300049581 Bacteria 10292
253 Ga0501047_0019998 3300049581 Bacteria 6427
254 Ga0501047_0248861 3300049581 Bacteria 1626
255 Ga0501048_0124607 3300049582 Bacteria 1822
256 Ga0501069_0008148 3300049585 Bacteria 5504
257 Ga0501070_0000020 3300049586 Bacteria 169025
258 Ga0501070_0010089 3300049586 Bacteria 7993
259 Ga0501070_0012940 3300049586 Bacteria 7033
260 Ga0501070_0042421 3300049586 Bacteria 3789
261 Ga0501070_0095498 3300049586 Bacteria 2460
262 Ga0501072_0018295 3300049588 Bacteria 5392
263 Ga0501073_0005981 3300049589 Bacteria 9077
264 Ga0501073_0075833 3300049589 Bacteria 2340
265 Ga0501074_0022761 3300049590 Bacteria 4555
266 Ga0501079_0020049 3300049741 Bacteria 5108
267 Ga0501080_0007775 3300049742 Bacteria 9691
268 Ga0501080_0034380 3300049742 Bacteria 4731
269 Ga0501080_0152821 3300049742 Bacteria 2133
270 Ga0501083_0070858 3300049744 Bacteria 2318
271 Ga0501035_0006911 3300049822 Bacteria 10599
272 Ga0501044_0001220 3300049823 Bacteria 30540
273 Ga0501044_0004505 3300049823 Bacteria 15579
274 Ga0501044_0015914 3300049823 Bacteria 8094
275 Ga0501044_0025544 3300049823 Bacteria 6261
276 Ga0501044_0052311 3300049823 Bacteria 4209
277 Ga0501044_0092152 3300049823 Unclassified 3056
278 Ga0501044_0253938 3300049823 Bacteria 1698
279 nmdc:mga0n895_117069_c1 3300050512 Unclassified 2684
280 nmdc:mga08x19_167_c1 3300050514 Bacteria 54732
281 Ga0500595_022974 3300053119 Bacteria 2197
282 Ga0500645_003763 3300053730 Bacteria 6045
283 Ga0501084_0000236 3300054114 Bacteria 41685
284 Ga0501082_0160753 3300060353 Bacteria 1952
285 Ga0501082_0285853 3300060353 Bacteria 1436

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0285853 Ga0501082_0285853_62_1066 327
2 3300009093 Ga0105240_10004713 Ga0105240_100047133 347
3 3300025913 Ga0207695_10004818 Ga0207695_100048183 347
4 3300044712 Ga0453684_0376381 Ga0453684_0376381_309_1421 347
5 3300005327 Ga0070658_10104415 Ga0070658_101044152 372
6 3300005366 Ga0070659_100000145 Ga0070659_10000014543 372
7 3300005366 Ga0070659_100027072 Ga0070659_1000270722 372
8 3300005539 Ga0068853_100033884 Ga0068853_1000338842 372
9 3300005548 Ga0070665_100000194 Ga0070665_10000019440 372
10 3300005563 Ga0068855_100004622 Ga0068855_1000046226 372
11 3300025909 Ga0207705_10000629 Ga0207705_1000062924 372
12 3300025912 Ga0207707_10010988 Ga0207707_100109886 372
13 3300025917 Ga0207660_10000769 Ga0207660_1000076917 372
14 3300025919 Ga0207657_10000704 Ga0207657_100007046 372
15 3300025919 Ga0207657_10005106 Ga0207657_100051069 372
16 3300025921 Ga0207652_10011406 Ga0207652_100114065 372
17 3300025924 Ga0207694_10123568 Ga0207694_101235681 372
18 3300025949 Ga0207667_10001457 Ga0207667_100014576 372
19 3300026041 Ga0207639_10008657 Ga0207639_100086573 372
20 3300028379 Ga0268266_10000005 Ga0268266_10000005522 372
21 3300049579 Ga0501043_0089673 Ga0501043_0089673_20_1138 372
22 3300035113 Ga0373936_0008453 Ga0373936_0008453_1566_2756 373
23 3300037471 Ga0395905_0202242 Ga0395905_0202242_291_1496 374
24 3300044693 Ga0466961_0114254 Ga0466961_0114254_328_1524 375
25 3300048918 Ga0496115_0026055 Ga0496115_0026055_820_2013 375
26 3300009551 Ga0105238_10021455 Ga0105238_100214555 376
27 3300005985 Ga0081539_10023478 Ga0081539_100234781 377
28 3300028800 Ga0265338_10013367 Ga0265338_100133678 377
29 3300037312 Ga0395899_0000880 Ga0395899_0000880_26832_28034 377
30 3300037418 Ga0395900_0000016 Ga0395900_0000016_141341_142543 377
31 3300038443 Ga0395901_0000022 Ga0395901_0000022_179423_180625 377
32 3300048914 Ga0496111_0187224 Ga0496111_0187224_51_1259 377
33 3300003791 Ga0055530_10000148 Ga0055530_1000014831 378
34 3300003794 Ga0055531_10010689 Ga0055531_100106892 378
35 3300005563 Ga0068855_100103308 Ga0068855_1001033084 378
36 3300005841 Ga0068863_100053295 Ga0068863_1000532952 378
37 3300025297 Ga0209758_1000733 Ga0209758_100073316 378
38 3300025298 Ga0209050_1000029 Ga0209050_1000029359 378
39 3300025304 Ga0209257_1000714 Ga0209257_100071411 378
40 3300030521 Ga0307511_10080949 Ga0307511_100809492 378
41 3300048918 Ga0496115_0000237 Ga0496115_0000237_32260_33453 378
42 3300053119 Ga0500595_022974 Ga0500595_022974_150_1340 378
43 3300006237 Ga0097621_100053739 Ga0097621_1000537393 379
44 3300009093 Ga0105240_10119792 Ga0105240_101197924 379
45 3300009177 Ga0105248_10102489 Ga0105248_101024891 379
46 3300025931 Ga0207644_10190446 Ga0207644_101904462 379
47 3300025941 Ga0207711_10169957 Ga0207711_101699572 379
48 3300026121 Ga0207683_10071933 Ga0207683_100719331 379
49 3300028379 Ga0268266_10019125 Ga0268266_100191251 379
50 3300028786 Ga0307517_10046161 Ga0307517_100461613 379
51 3300031456 Ga0307513_10003498 Ga0307513_1000349823 379
52 3300046506 Ga0495583_0028327 Ga0495583_0028327_196_1386 379
53 3300046528 Ga0495642_0001388 Ga0495642_0001388_9516_10706 379
54 3300046648 Ga0495611_0027174 Ga0495611_0027174_464_1654 379
55 3300047445 Ga0495677_0042896 Ga0495677_0042896_248_1438 379
56 3300048910 Ga0496107_0109236 Ga0496107_0109236_614_1852 379
57 3300005336 Ga0070680_100002769 Ga0070680_1000027693 380
58 3300005563 Ga0068855_100021493 Ga0068855_1000214933 380
59 3300005563 Ga0068855_100094000 Ga0068855_1000940002 380
60 3300005616 Ga0068852_100074539 Ga0068852_1000745392 380
61 3300007076 Ga0075435_100135973 Ga0075435_1001359731 380
62 3300009093 Ga0105240_10319462 Ga0105240_103194622 380
63 3300009177 Ga0105248_10068074 Ga0105248_100680741 380
64 3300009551 Ga0105238_10040588 Ga0105238_100405884 380
65 3300013104 Ga0157370_10044410 Ga0157370_100444103 380
66 3300013307 Ga0157372_10055166 Ga0157372_100551664 380
67 3300025250 Ga0209026_1003775 Ga0209026_10037753 380
68 3300025912 Ga0207707_10007787 Ga0207707_100077873 380
69 3300025913 Ga0207695_10010733 Ga0207695_100107335 380
70 3300025917 Ga0207660_10040659 Ga0207660_100406594 380
71 3300025941 Ga0207711_10109412 Ga0207711_101094121 380
72 3300025949 Ga0207667_10045932 Ga0207667_100459322 380
73 3300035172 Ga0373955_0052798 Ga0373955_0052798_975_2174 380
74 3300046616 Ga0495668_0009070 Ga0495668_0009070_3978_5168 380
75 3300047472 Ga0495686_0122621 Ga0495686_0122621_61_1251 380
76 3300049581 Ga0501047_0248861 Ga0501047_0248861_107_1300 380
77 3300053730 Ga0500645_003763 Ga0500645_003763_1857_3047 380
78 3300006881 Ga0068865_100006097 Ga0068865_1000060974 381
79 3300009177 Ga0105248_10000115 Ga0105248_1000011544 381
80 3300014325 Ga0163163_10044187 Ga0163163_100441872 381
81 3300025913 Ga0207695_10003482 Ga0207695_1000348221 381
82 3300025938 Ga0207704_10016185 Ga0207704_100161852 381
83 3300025941 Ga0207711_10001863 Ga0207711_100018634 381
84 3300049581 Ga0501047_0007464 Ga0501047_0007464_3531_4724 381
85 3300005336 Ga0070680_100097040 Ga0070680_1000970403 382
86 3300005435 Ga0070714_100100793 Ga0070714_1001007932 382
87 3300005458 Ga0070681_10011519 Ga0070681_100115192 382
88 3300005563 Ga0068855_100231968 Ga0068855_1002319682 382
89 3300025913 Ga0207695_10229324 Ga0207695_102293242 382
90 3300025917 Ga0207660_10185483 Ga0207660_101854831 382
91 3300025928 Ga0207700_10034938 Ga0207700_100349382 382
92 3300025929 Ga0207664_10134757 Ga0207664_101347572 382
93 3300049823 Ga0501044_0004505 Ga0501044_0004505_6763_7959 382
94 3300044693 Ga0466961_0046324 Ga0466961_0046324_1535_2734 385
95 3300005341 Ga0070691_10008776 Ga0070691_100087761 386
96 3300005344 Ga0070661_100000176 Ga0070661_10000017632 386
97 3300005344 Ga0070661_100088065 Ga0070661_1000880651 386
98 3300005539 Ga0068853_100049364 Ga0068853_1000493641 386
99 3300005545 Ga0070695_100009701 Ga0070695_1000097015 386
100 3300005564 Ga0070664_100064245 Ga0070664_1000642452 386
101 3300005577 Ga0068857_100004085 Ga0068857_10000408511 386
102 3300005616 Ga0068852_100036115 Ga0068852_1000361152 386
103 3300009093 Ga0105240_10005438 Ga0105240_1000543811 386
104 3300009545 Ga0105237_10247598 Ga0105237_102475981 386
105 3300009551 Ga0105238_10030394 Ga0105238_100303945 386
106 3300010375 Ga0105239_10062541 Ga0105239_100625413 386
107 3300013100 Ga0157373_10013658 Ga0157373_100136583 386
108 3300013104 Ga0157370_10001490 Ga0157370_1000149024 386
109 3300013105 Ga0157369_10039464 Ga0157369_100394641 386
110 3300013306 Ga0163162_10132086 Ga0163162_101320862 386
111 3300013307 Ga0157372_10017682 Ga0157372_100176825 386
112 3300014968 Ga0157379_10012689 Ga0157379_100126893 386
113 3300025913 Ga0207695_10057936 Ga0207695_100579364 386
114 3300025914 Ga0207671_10013993 Ga0207671_100139934 386
115 3300025920 Ga0207649_10000031 Ga0207649_1000003111 386
116 3300025924 Ga0207694_10015719 Ga0207694_100157193 386
117 3300025945 Ga0207679_10049973 Ga0207679_100499732 386
118 3300025949 Ga0207667_10008517 Ga0207667_100085177 386
119 3300026078 Ga0207702_10001030 Ga0207702_1000103018 386
120 3300026116 Ga0207674_10000374 Ga0207674_100003747 386
121 3300049580 Ga0501046_0153304 Ga0501046_0153304_479_1693 386
122 3300005435 Ga0070714_100105537 Ga0070714_1001055372 387
123 3300005436 Ga0070713_100000221 Ga0070713_1000002218 387
124 3300005445 Ga0070708_100194592 Ga0070708_1001945922 387
125 3300005614 Ga0068856_100004310 Ga0068856_1000043105 387
126 3300006173 Ga0070716_100010955 Ga0070716_1000109553 387
127 3300006175 Ga0070712_100000091 Ga0070712_1000000912 387
128 3300006871 Ga0075434_100102829 Ga0075434_1001028293 387
129 3300006914 Ga0075436_100000054 Ga0075436_10000005443 387
130 3300025906 Ga0207699_10000853 Ga0207699_100008536 387
131 3300025915 Ga0207693_10000314 Ga0207693_1000031440 387
132 3300025928 Ga0207700_10001559 Ga0207700_100015593 387
133 3300025929 Ga0207664_10038987 Ga0207664_100389872 387
134 3300026078 Ga0207702_10000030 Ga0207702_1000003051 387
135 3300031250 Ga0265331_10000037 Ga0265331_10000037110 387
136 3300031711 Ga0265314_10016100 Ga0265314_100161004 387
137 3300050512 nmdc:mga0n895_117069_c1 nmdc:mga0n895_117069_c1_120_1328 387
138 3300050514 nmdc:mga08x19_167_c1 nmdc:mga08x19_167_c1_46084_47292 387
139 3300009093 Ga0105240_10043887 Ga0105240_100438872 388
140 3300013307 Ga0157372_10268373 Ga0157372_102683731 388
141 3300028800 Ga0265338_10037140 Ga0265338_100371403 388
142 3300031238 Ga0265332_10013224 Ga0265332_100132241 388
143 3300031241 Ga0265325_10000027 Ga0265325_1000002778 388
144 3300031249 Ga0265339_10000630 Ga0265339_1000063012 388
145 3300009177 Ga0105248_10000001 Ga0105248_10000001313 389
146 3300025941 Ga0207711_10000002 Ga0207711_100000021014 389
147 3300025304 Ga0209257_1002598 Ga0209257_10025985 390
148 3300031251 Ga0265327_10000505 Ga0265327_100005052 390
149 3300046663 Ga0495635_0060084 Ga0495635_0060084_916_2136 390
150 3300047322 Ga0495680_0063608 Ga0495680_0063608_580_1800 390
151 3300049570 Ga0501033_0070433 Ga0501033_0070433_1307_2515 390
152 3300049586 Ga0501070_0095498 Ga0501070_0095498_446_1654 390
153 3300049823 Ga0501044_0052311 Ga0501044_0052311_723_1931 390
154 3300054114 Ga0501084_0000236 Ga0501084_0000236_37502_38692 390
155 3300060353 Ga0501082_0160753 Ga0501082_0160753_96_1286 390
156 3300049581 Ga0501047_0003511 Ga0501047_0003511_2448_3650 392
157 3300049588 Ga0501072_0018295 Ga0501072_0018295_2771_3973 392
158 3300049589 Ga0501073_0005981 Ga0501073_0005981_2533_3735 392
159 iso_pu_bacteria 2870782633 2870788205 392
160 3300009174 Ga0105241_10185101 Ga0105241_101851012 393
161 3300014968 Ga0157379_10001216 Ga0157379_100012168 393
162 3300021384 Ga0213876_10000777 Ga0213876_100007776 393
163 3300031250 Ga0265331_10070987 Ga0265331_100709872 393
164 3300031344 Ga0265316_10078804 Ga0265316_100788042 393
165 3300039437 Ga0436365_0167933 Ga0436365_0167933_66848_68059 393
166 3300049571 Ga0501034_0008547 Ga0501034_0008547_5859_7082 393
167 3300049579 Ga0501043_0229203 Ga0501043_0229203_155_1378 393
168 3300049581 Ga0501047_0001450 Ga0501047_0001450_2967_4190 393
169 3300049586 Ga0501070_0042421 Ga0501070_0042421_1222_2445 393
170 3300049742 Ga0501080_0152821 Ga0501080_0152821_96_1319 393
171 3300049823 Ga0501044_0253938 Ga0501044_0253938_77_1300 393
172 3300005539 Ga0068853_100003037 Ga0068853_1000030372 394
173 3300026041 Ga0207639_10001289 Ga0207639_100012895 394
174 3300031240 Ga0265320_10026248 Ga0265320_100262481 394
175 3300031241 Ga0265325_10036377 Ga0265325_100363772 394
176 3300048929 Ga0496126_0000432 Ga0496126_0000432_58479_59684 394
177 3300049586 Ga0501070_0012940 Ga0501070_0012940_2793_4052 394
178 3300028577 Ga0265318_10000052 Ga0265318_1000005260 395
179 3300037418 Ga0395900_0013015 Ga0395900_0013015_4389_5579 395
180 3300037466 Ga0395898_0035462 Ga0395898_0035462_2039_3229 395
181 3300037471 Ga0395905_0001348 Ga0395905_0001348_22487_23677 395
182 3300037471 Ga0395905_0048498 Ga0395905_0048498_2670_3860 395
183 3300037471 Ga0395905_0081350 Ga0395905_0081350_567_1757 395
184 3300037471 Ga0395905_0082291 Ga0395905_0082291_296_1486 395
185 3300037471 Ga0395905_0234214 Ga0395905_0234214_162_1352 395
186 3300009176 Ga0105242_10029252 Ga0105242_100292523 396
187 3300025934 Ga0207686_10025265 Ga0207686_100252652 396
188 3300039447 Ga0436361_0177120 Ga0436361_0177120_3318_4520 397
189 3300005344 Ga0070661_100012159 Ga0070661_1000121595 398
190 3300005539 Ga0068853_100140729 Ga0068853_1001407292 398
191 3300005563 Ga0068855_100000010 Ga0068855_10000001017 398
192 3300005616 Ga0068852_100020459 Ga0068852_1000204593 398
193 3300005616 Ga0068852_100116990 Ga0068852_1001169902 398
194 3300009093 Ga0105240_10000675 Ga0105240_1000067541 398
195 3300009101 Ga0105247_10076895 Ga0105247_100768952 398
196 3300009551 Ga0105238_10014297 Ga0105238_100142973 398
197 3300010375 Ga0105239_10001127 Ga0105239_1000112728 398
198 3300013105 Ga0157369_10009924 Ga0157369_100099246 398
199 3300013105 Ga0157369_10016283 Ga0157369_100162839 398
200 3300013297 Ga0157378_10064491 Ga0157378_100644912 398
201 3300025900 Ga0207710_10046664 Ga0207710_100466642 398
202 3300025913 Ga0207695_10000003 Ga0207695_10000003389 398
203 3300025924 Ga0207694_10000011 Ga0207694_10000011372 398
204 3300025949 Ga0207667_10000093 Ga0207667_100000935 398
205 3300026041 Ga0207639_10037669 Ga0207639_100376693 398
206 3300026142 Ga0207698_10143665 Ga0207698_101436652 398
207 3300031456 Ga0307513_10215790 Ga0307513_102157901 398
208 3300031730 Ga0307516_10009947 Ga0307516_1000994710 398
209 3300049460 Ga0495682_0001385 Ga0495682_0001385_6687_7886 398
210 3300049571 Ga0501034_0023229 Ga0501034_0023229_3607_4809 398
211 3300049572 Ga0501036_0013931 Ga0501036_0013931_210_1412 398
212 3300049581 Ga0501047_0019998 Ga0501047_0019998_2256_3458 398
213 3300049582 Ga0501048_0124607 Ga0501048_0124607_549_1802 398
214 3300049585 Ga0501069_0008148 Ga0501069_0008148_1071_2273 398
215 3300049586 Ga0501070_0010089 Ga0501070_0010089_2834_4036 398
216 3300049589 Ga0501073_0075833 Ga0501073_0075833_1035_2237 398
217 3300049590 Ga0501074_0022761 Ga0501074_0022761_2056_3258 398
218 3300049741 Ga0501079_0020049 Ga0501079_0020049_962_2164 398
219 3300049742 Ga0501080_0034380 Ga0501080_0034380_1909_3111 398
220 3300049744 Ga0501083_0070858 Ga0501083_0070858_951_2153 398
221 3300049823 Ga0501044_0025544 Ga0501044_0025544_4397_5599 398
222 iso_pu_bacteria 2870782633 2870786488 398
223 3300005336 Ga0070680_100001903 Ga0070680_1000019039 399
224 3300005439 Ga0070711_100058720 Ga0070711_1000587202 399
225 3300005458 Ga0070681_10000005 Ga0070681_10000005160 399
226 3300005530 Ga0070679_100000988 Ga0070679_10000098811 399
227 3300006175 Ga0070712_100000063 Ga0070712_10000006317 399
228 3300006914 Ga0075436_100107936 Ga0075436_1001079361 399
229 3300010375 Ga0105239_10009679 Ga0105239_100096793 399
230 3300014968 Ga0157379_10040017 Ga0157379_100400172 399
231 3300025912 Ga0207707_10000005 Ga0207707_10000005317 399
232 3300025915 Ga0207693_10000277 Ga0207693_100002777 399
233 3300025916 Ga0207663_10001862 Ga0207663_100018629 399
234 3300025917 Ga0207660_10000520 Ga0207660_100005202 399
235 3300025921 Ga0207652_10000623 Ga0207652_1000062313 399
236 3300028800 Ga0265338_10000153 Ga0265338_1000015327 399
237 3300031241 Ga0265325_10000001 Ga0265325_10000001153 399
238 3300031249 Ga0265339_10000745 Ga0265339_100007459 399
239 3300031250 Ga0265331_10082213 Ga0265331_100822131 399
240 3300031595 Ga0265313_10003454 Ga0265313_100034542 399
241 3300031711 Ga0265314_10017140 Ga0265314_100171402 399
242 3300031711 Ga0265314_10026560 Ga0265314_100265602 399
243 3300036401 Ga0373937_0003263 Ga0373937_0003263_3127_4329 399
244 3300037068 Ga0373925_0056729 Ga0373925_0056729_1029_2231 399
245 3300046516 Ga0495628_0061877 Ga0495628_0061877_621_1826 399
246 3300049742 Ga0501080_0007775 Ga0501080_0007775_7153_8355 399
247 3300003320 rootH2_10075661 rootH2_100756614 400
248 3300005339 Ga0070660_100025061 Ga0070660_1000250613 400
249 3300005341 Ga0070691_10022070 Ga0070691_100220702 400
250 3300005563 Ga0068855_100031988 Ga0068855_1000319882 400
251 3300005617 Ga0068859_100030404 Ga0068859_1000304045 400
252 3300005841 Ga0068863_100099596 Ga0068863_1000995962 400
253 3300005844 Ga0068862_100069949 Ga0068862_1000699491 400
254 3300005844 Ga0068862_100197020 Ga0068862_1001970202 400
255 3300006931 Ga0097620_100030404 Ga0097620_1000304045 400
256 3300009551 Ga0105238_10007731 Ga0105238_100077316 400
257 3300009553 Ga0105249_10014253 Ga0105249_100142532 400
258 3300013100 Ga0157373_10022480 Ga0157373_100224802 400
259 3300013104 Ga0157370_10024393 Ga0157370_100243934 400
260 3300013307 Ga0157372_10070975 Ga0157372_100709753 400
261 3300025909 Ga0207705_10000647 Ga0207705_1000064722 400
262 3300025912 Ga0207707_10038929 Ga0207707_100389292 400
263 3300025917 Ga0207660_10000720 Ga0207660_1000072010 400
264 3300025919 Ga0207657_10002443 Ga0207657_1000244316 400
265 3300025921 Ga0207652_10001317 Ga0207652_1000131714 400
266 3300025921 Ga0207652_10002779 Ga0207652_100027798 400
267 3300025924 Ga0207694_10033976 Ga0207694_100339762 400
268 3300025949 Ga0207667_10071037 Ga0207667_100710373 400
269 3300025961 Ga0207712_10065460 Ga0207712_100654602 400
270 3300025961 Ga0207712_10103670 Ga0207712_101036702 400
271 3300026041 Ga0207639_10017743 Ga0207639_100177433 400
272 3300026088 Ga0207641_10157096 Ga0207641_101570962 400
273 3300028380 Ga0268265_10173624 Ga0268265_101736242 400
274 3300028380 Ga0268265_10255089 Ga0268265_102550892 400
275 3300028800 Ga0265338_10006667 Ga0265338_1000666713 400
276 3300031711 Ga0265314_10008687 Ga0265314_100086874 400
277 3300031712 Ga0265342_10025936 Ga0265342_100259364 400
278 3300046461 Ga0495641_0062237 Ga0495641_0062237_340_1545 400
279 3300046499 Ga0495594_0120186 Ga0495594_0120186_161_1366 400
280 3300046642 Ga0495634_0110619 Ga0495634_0110619_484_1689 400
281 3300049573 Ga0501037_0199289 Ga0501037_0199289_159_1361 400
282 3300049574 Ga0501038_0015781 Ga0501038_0015781_5070_6272 400
283 3300049586 Ga0501070_0000020 Ga0501070_0000020_63675_64877 400
284 3300049822 Ga0501035_0006911 Ga0501035_0006911_4318_5520 400
285 3300049823 Ga0501044_0001220 Ga0501044_0001220_2770_3972 400
286 3300049823 Ga0501044_0015914 Ga0501044_0015914_6276_7478 400
287 3300049823 Ga0501044_0092152 Ga0501044_0092152_87_1289 400

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00067

p450

Cytochrome P450

206

401

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6t0l-assembly1.cif.gz_A crystal structure of cyp124 in complex with inhibitor compound 5' 0.9419 2 390
6t0g-assembly1.cif.gz_A crystal structure of cyp124 in complex with vitamin d3 0.9388 2 390
6bld-assembly1.cif.gz_A mycobacterium marinum cytochrome p450 cyp268a2 in complex with pseudoionone 0.9256 1 389
6t0l-assembly1.cif.gz_A crystal structure of cyp124 in complex with inhibitor compound 5' 0.9235 2 390
6t0g-assembly1.cif.gz_A crystal structure of cyp124 in complex with vitamin d3 0.9205 2 390
ID Description Score Start End Superfamily
3ejbD01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2; 0.9456 281 312 3.30.43.20
2x5wA00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9398 3 388 1.10.630.10
6bldA00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9256 1 389 1.10.630.10
2x5wA00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9144 3 388 1.10.630.10
6cvcA00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9082 2 390 1.10.630.10
ID Description Score Start End GO Terms
AF-A0A538AG46-F1-model_v4 Cytochrome P450 0.9781 264 388 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A499UEL5-F1-model_v4 Cytochrome P450 0.9748 273 393 GO:0005506
GO:0006707
GO:0008395
GO:0020037
GO:0036199
AF-A0A4Y8LQH6-F1-model_v4 deleted 0.9662 184 389
AF-A0A7C3QNC8-F1-model_v4 Cytochrome P450 0.966 238 389 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A7K0LW52-F1-model_v4 Cytochrome P450 0.9583 270 390 GO:0004497
GO:0005506
GO:0016705
GO:0020037

Feature Viewer

pLDDT pTM Quality
92.15 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map