F387964

General Info

Members Datasets Scaffolds Average Seq Length
287 191 574 310

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10045492|Ga0075433_100454923
Length 340
Sequence MTPAPETAARRSVWVLAECAQGHVQKVTFELLGDARKLASLRKAPLETVLPCHPDQTARLLEELRPHQAGRVHVLQHPALASYTTDAFVSALEPFVRAAPPLLLFVAATANGRDLAPRLAARAGLGFFPNCLTLRPAGGEHIEITRVTHGGGVHAQSAWLAGGEGPPLLVTMKPGVADASPANPAAPLPDAVRHDAVIAEDRLRVRVLDHLPADPRIQDIREAERIVSGGRGVGSREGFAAVEDLADALHAAVAASRVAVDLGWAPYERQVGQTGKTVAPQLYVAAGISGASHHLMGMRGSEKIVAINSDRKAPIFSVAHLGVVGNLHELLPALARRIRG

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
25 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
33 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
37 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
38 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
53 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
57 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
58 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
63 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
68 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
69 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
70 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
71 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
72 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
73 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
74 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
75 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
80 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
108 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
109 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
117 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
124 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
168 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
169 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
170 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
171 2643221714 Streptomyces sp. Root264 Isolate Unclassified
172 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
173 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
174 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
175 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
176 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
177 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
178 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
179 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
180 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
181 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
182 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
183 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
184 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
185 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
186 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
187 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
188 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
189 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
190 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
191 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.71
Metatranscriptomes 4.18
Isolates 10.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.39
Nodule 0.7
Rhizoplane 3.14
Rhizosphere 88.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10045492 3300006852 Bacteria 3816
2 JGI24739J22299_10036331 3300001989 Bacteria 1665
3 JGI24735J21928_10056646 3300002067 Bacteria 1128
4 Ga0006562J51391_1020956 3300003578 Bacteria 1869
5 Ga0006562J51391_1051463 3300003578 Bacteria 2670
6 Ga0070658_10005699 3300005327 Bacteria 10101
7 Ga0070658_10010976 3300005327 Bacteria 7260
8 Ga0070668_100033864 3300005347 Bacteria 3892
9 Ga0070709_10210922 3300005434 Bacteria 1381
10 Ga0070714_100017731 3300005435 Bacteria 5773
11 Ga0070714_100067366 3300005435 Bacteria 3086
12 Ga0070714_100152480 3300005435 Bacteria 2084
13 Ga0070665_100000922 3300005548 Bacteria 37641
14 Ga0068855_100457689 3300005563 Bacteria 1392
15 Ga0068856_100246478 3300005614 Bacteria 1802
16 Ga0068852_100152457 3300005616 Bacteria 2151
17 Ga0081455_10000134 3300005937 Bacteria 87309
18 Ga0081455_10000355 3300005937 Bacteria 60432
19 Ga0081455_10003440 3300005937 Bacteria 18194
20 Ga0081538_10000249 3300005981 Bacteria 61087
21 Ga0081539_10016538 3300005985 Bacteria 5256
22 Ga0081539_10143703 3300005985 Bacteria 1156
23 Ga0075363_100005587 3300006048 Bacteria 5613
24 Ga0075432_10025570 3300006058 Bacteria 2025
25 Ga0075428_100042125 3300006844 Bacteria 5022
26 Ga0075428_100171448 3300006844 Bacteria 2352
27 Ga0075431_100012127 3300006847 Bacteria 8695
28 Ga0075433_10000069 3300006852 Bacteria 45633
29 Ga0075434_100003026 3300006871 Bacteria 14948
30 Ga0075429_100021526 3300006880 Bacteria 5589
31 Ga0075436_100009065 3300006914 Bacteria 6808
32 Ga0075435_100001588 3300007076 Bacteria 14650
33 Ga0105251_10070697 3300009011 Bacteria 1625
34 Ga0105250_10021263 3300009092 Bacteria 2620
35 Ga0111539_10007918 3300009094 Bacteria 13551
36 Ga0111539_10028113 3300009094 Bacteria 6866
37 Ga0111539_10668976 3300009094 Bacteria 1209
38 Ga0105245_10012913 3300009098 Bacteria 7279
39 Ga0105245_10054380 3300009098 Bacteria 3595
40 Ga0114129_10089907 3300009147 Bacteria 4256
41 Ga0114129_10326813 3300009147 Bacteria 2037
42 Ga0105249_10436291 3300009553 Bacteria 1346
43 Ga0163162_10156738 3300013306 Bacteria 2397
44 Ga0157372_10392222 3300013307 Bacteria 1618
45 Ga0183367_1003 3300015688 Bacteria 814276
46 Ga0197907_10934051 3300020069 Bacteria 1934
47 Ga0197907_11383118 3300020069 Bacteria 1262
48 Ga0206353_11216267 3300020082 Bacteria 3207
49 Ga0206353_11748879 3300020082 Bacteria 5052
50 Ga0206353_12071001 3300020082 Bacteria 8580
51 Ga0224712_10026769 3300022467 Bacteria 2043
52 Ga0224712_10067492 3300022467 Bacteria 1443
53 Ga0209758_1001840 3300025297 Bacteria 23288
54 Ga0207426_1002119 3300025302 Bacteria 13611
55 Ga0207647_10016513 3300025904 Bacteria 5037
56 Ga0207699_10129285 3300025906 Bacteria 1645
57 Ga0207705_10007667 3300025909 Bacteria 7933
58 Ga0207707_10219254 3300025912 Bacteria 1656
59 Ga0207687_10064177 3300025927 Bacteria 2603
60 Ga0207664_10014037 3300025929 Bacteria 5775
61 Ga0207664_10071810 3300025929 Bacteria 2789
62 Ga0207709_10354470 3300025935 Bacteria 1108
63 Ga0207709_10389379 3300025935 Bacteria 1063
64 Ga0207667_10256152 3300025949 Bacteria 1790
65 Ga0207712_10217970 3300025961 Bacteria 1524
66 Ga0207702_10218079 3300026078 Bacteria 1777
67 Ga0207675_100295365 3300026118 Bacteria 1577
68 Ga0207683_10031095 3300026121 Bacteria 4632
69 Ga0207428_10005614 3300027907 Bacteria 11662
70 Ga0207428_10017701 3300027907 Bacteria 6112
71 Ga0268266_10010223 3300028379 Bacteria 8220
72 Ga0307513_10058774 3300031456 Bacteria 4084
73 Ga0307509_10074735 3300031507 Bacteria 3523
74 Ga0307408_100002929 3300031548 Bacteria 11829
75 Ga0307508_10089184 3300031616 Bacteria 2669
76 Ga0307514_10082556 3300031649 Bacteria 2371
77 Ga0316576_10267361 3300031727 Bacteria 1282
78 Ga0307518_10083750 3300031838 Bacteria 2299
79 Ga0307410_10034958 3300031852 Bacteria 3259
80 Ga0307407_10212267 3300031903 Bacteria 1304
81 Ga0307409_100009092 3300031995 Bacteria 6082
82 Ga0307409_100244958 3300031995 Bacteria 1635
83 Ga0307409_100422509 3300031995 Bacteria 1279
84 Ga0307414_10146235 3300032004 Bacteria 1857
85 Ga0307507_10000682 3300033179 Bacteria 74144
86 Ga0395900_0098883 3300037418 Bacteria 2998
87 Ga0395898_0011953 3300037466 Bacteria 8987
88 Ga0395898_0047509 3300037466 Bacteria 4212
89 Ga0395898_0054545 3300037466 Bacteria 3900
90 Ga0395901_0001511 3300038443 Bacteria 24165
91 Ga0439436_0008261 3300041404 Bacteria 3198
92 Ga0439450_025572 3300042008 Bacteria 1295
93 Ga0439457_002016 3300042014 Bacteria 5961
94 Ga0439463_001409 3300042016 Bacteria 6383
95 Ga0450894_000490 3300042131 Bacteria 6746
96 Ga0450898_002785 3300042134 Bacteria 2454
97 Ga0450899_001641 3300042135 Bacteria 2476
98 Ga0450906_001171 3300042145 Bacteria 5802
99 Ga0439460_0006956 3300042461 Bacteria 2819
100 Ga0451577_0092154 3300042876 Bacteria 2705
101 Ga0451577_0270272 3300042876 Bacteria 1540
102 Ga0439440_0000556 3300042993 Bacteria 6312
103 Ga0466969_0014346 3300044656 Bacteria 4164
104 Ga0466969_0014526 3300044656 Bacteria 4139
105 Ga0466969_0018911 3300044656 Bacteria 3587
106 Ga0466969_0029662 3300044656 Bacteria 2792
107 Ga0466972_0020211 3300044658 Bacteria 3327
108 Ga0466972_0052894 3300044658 Bacteria 1956
109 Ga0466965_0005796 3300044683 Bacteria 5574
110 Ga0466965_0006675 3300044683 Bacteria 5259
111 Ga0466966_0001512 3300044684 Bacteria 14923
112 Ga0466966_0023760 3300044684 Bacteria 4011
113 Ga0466966_0031725 3300044684 Bacteria 3426
114 Ga0466961_0001156 3300044693 Bacteria 16225
115 Ga0466961_0012383 3300044693 Bacteria 5453
116 Ga0466961_0046677 3300044693 Bacteria 2769
117 Ga0466961_0093695 3300044693 Bacteria 1895
118 Ga0466963_0035569 3300044694 Bacteria 3245
119 Ga0466971_0003312 3300044719 Bacteria 6880
120 Ga0466971_0007650 3300044719 Bacteria 4712
121 Ga0466970_0000459 3300044765 Bacteria 20111
122 Ga0466970_0012999 3300044765 Bacteria 4264
123 Ga0466970_0016342 3300044765 Bacteria 3824
124 Ga0466957_0000223 3300044842 Bacteria 26712
125 Ga0466957_0243906 3300044842 Bacteria 1193
126 Ga0466960_0104943 3300044901 Bacteria 1460
127 Ga0466959_0000835 3300045049 Bacteria 18184
128 Ga0466959_0020422 3300045049 Bacteria 4880
129 Ga0466959_0033266 3300045049 Bacteria 3814
130 Ga0466958_0000629 3300045836 Bacteria 15130
131 Ga0466958_0063903 3300045836 Bacteria 2245
132 Ga0466967_0018742 3300045976 Bacteria 5542
133 Ga0466967_0106487 3300045976 Bacteria 2570
134 Ga0466967_0912786 3300045976 Bacteria 874
135 Ga0495592_0023901 3300046454 Bacteria 4649
136 Ga0495603_0020364 3300046455 Bacteria 4020
137 Ga0495603_0039795 3300046455 Bacteria 2815
138 Ga0495603_0098963 3300046455 Bacteria 1703
139 Ga0495629_0140886 3300046459 Bacteria 1678
140 Ga0495638_0110935 3300046460 Bacteria 1630
141 Ga0495651_0000339 3300046462 Bacteria 36218
142 Ga0495651_0000451 3300046462 Bacteria 31576
143 Ga0495582_0036090 3300046473 Bacteria 2719
144 Ga0495594_0007179 3300046499 Bacteria 5730
145 Ga0495594_0185274 3300046499 Bacteria 1185
146 Ga0495618_0150183 3300046514 Bacteria 1488
147 Ga0495628_0061881 3300046516 Bacteria 2935
148 Ga0495628_0088685 3300046516 Bacteria 2396
149 Ga0495652_0001332 3300046529 Bacteria 27476
150 Ga0495652_0003042 3300046529 Bacteria 16809
151 Ga0495665_0153680 3300046531 Bacteria 1201
152 Ga0495640_0006049 3300046533 Bacteria 9596
153 Ga0495645_0008114 3300046543 Bacteria 7319
154 Ga0495635_0016448 3300046663 Bacteria 5166
155 Ga0495588_0000456 3300046674 Bacteria 20551
156 Ga0495657_0001161 3300046675 Bacteria 23054
157 Ga0495623_0042335 3300046679 Bacteria 2901
158 Ga0495646_0052634 3300046680 Bacteria 2458
159 Ga0495669_0041274 3300046684 Bacteria 2048
160 Ga0495613_0000432 3300046689 Bacteria 35803
161 Ga0495589_0054892 3300046794 Bacteria 1964
162 Ga0495600_0002314 3300046809 Bacteria 10866
163 Ga0495600_0029126 3300046809 Bacteria 3574
164 Ga0495604_0001319 3300047317 Bacteria 20249
165 Ga0495604_0096116 3300047317 Bacteria 2187
166 Ga0495674_0316943 3300047319 Bacteria 1271
167 Ga0495674_0332474 3300047319 Bacteria 1236
168 Ga0495687_002167 3300047443 Bacteria 16359
169 Ga0495685_008177 3300047447 Bacteria 3467
170 Ga0495593_0003023 3300047673 Bacteria 10130
171 Ga0496101_0296554 3300048904 Bacteria 1266
172 Ga0496105_0185027 3300048908 Bacteria 1705
173 Ga0496108_0119659 3300048911 Bacteria 2258
174 Ga0496108_0319652 3300048911 Bacteria 1353
175 Ga0496109_0013970 3300048912 Bacteria 6983
176 Ga0496109_0109332 3300048912 Bacteria 2570
177 Ga0496110_0100229 3300048913 Bacteria 2596
178 Ga0496126_0303220 3300048929 Bacteria 1317
179 Ga0501308_001469 3300049128 Bacteria 1892
180 Ga0501311_004331 3300049527 Bacteria 1506
181 Ga0501031_0000088 3300049568 Bacteria 49317
182 Ga0501032_0000473 3300049569 Bacteria 32455
183 Ga0501032_0030583 3300049569 Bacteria 3695
184 Ga0501033_0000804 3300049570 Bacteria 28723
185 Ga0501033_0001814 3300049570 Bacteria 18660
186 Ga0501034_0003170 3300049571 Bacteria 18909
187 Ga0501034_0013032 3300049571 Bacteria 8568
188 Ga0501034_0031209 3300049571 Bacteria 5414
189 Ga0501034_0135689 3300049571 Bacteria 2441
190 Ga0501036_0003838 3300049572 Bacteria 12054
191 Ga0501036_0011412 3300049572 Bacteria 7354
192 Ga0501036_0019446 3300049572 Bacteria 5702
193 Ga0501037_0001051 3300049573 Bacteria 20410
194 Ga0501038_0000311 3300049574 Bacteria 41564
195 Ga0501038_0417739 3300049574 Bacteria 1035
196 Ga0501039_0000286 3300049575 Bacteria 36137
197 Ga0501039_0208952 3300049575 Bacteria 1535
198 Ga0501039_0219524 3300049575 Bacteria 1495
199 Ga0501043_0001106 3300049579 Bacteria 23688
200 Ga0501043_0001527 3300049579 Bacteria 20201
201 Ga0501046_0000052 3300049580 Bacteria 132914
202 Ga0501047_0007698 3300049581 Bacteria 10147
203 Ga0501047_0028327 3300049581 Bacteria 5400
204 Ga0501047_0261771 3300049581 Bacteria 1577
205 Ga0501048_0000012 3300049582 Bacteria 79691
206 Ga0501067_0001547 3300049583 Bacteria 12552
207 Ga0501067_0004141 3300049583 Bacteria 8003
208 Ga0501067_0005424 3300049583 Bacteria 7080
209 Ga0501068_0003018 3300049584 Bacteria 8981
210 Ga0501068_0027676 3300049584 Bacteria 3349
211 Ga0501068_0126240 3300049584 Bacteria 1598
212 Ga0501069_0001554 3300049585 Bacteria 11346
213 Ga0501069_0060056 3300049585 Bacteria 2122
214 Ga0501070_0002295 3300049586 Bacteria 16798
215 Ga0501070_0003285 3300049586 Bacteria 14034
216 Ga0501070_0006753 3300049586 Bacteria 9769
217 Ga0501070_0040504 3300049586 Bacteria 3884
218 Ga0501071_0047640 3300049587 Bacteria 3080
219 Ga0501072_0011346 3300049588 Bacteria 6809
220 Ga0501073_0002904 3300049589 Bacteria 12862
221 Ga0501073_0144692 3300049589 Bacteria 1647
222 Ga0501074_0000071 3300049590 Bacteria 48728
223 Ga0501074_0004853 3300049590 Bacteria 9644
224 Ga0501074_0005061 3300049590 Bacteria 9460
225 Ga0501074_0044716 3300049590 Bacteria 3204
226 Ga0501077_0013922 3300049593 Bacteria 5043
227 Ga0501077_0015359 3300049593 Bacteria 4821
228 Ga0501079_0028566 3300049741 Bacteria 4281
229 Ga0501080_0000415 3300049742 Bacteria 32692
230 Ga0501080_0058276 3300049742 Bacteria 3595
231 Ga0501083_0006459 3300049744 Bacteria 8318
232 Ga0501083_0137646 3300049744 Bacteria 1599
233 Ga0501035_0001182 3300049822 Bacteria 27177
234 Ga0501035_0023266 3300049822 Bacteria 5682
235 Ga0501044_0001157 3300049823 Bacteria 31240
236 Ga0501044_0003842 3300049823 Bacteria 16854
237 Ga0501044_0082703 3300049823 Bacteria 3248
238 nmdc:mga03n38_4796_c1 3300050490 Bacteria 4527
239 nmdc:mga05p37_332391_c1 3300050507 Bacteria 1794
240 nmdc:mga05p37_36413_c1 3300050507 Bacteria 6037
241 nmdc:mga09592_1034_c1 3300050508 Bacteria 22111
242 nmdc:mga06r32_902_c1 3300050510 Bacteria 26465
243 nmdc:mga08y16_77601_c1 3300050511 Bacteria 3464
244 nmdc:mga08y16_8882_c1 3300050511 Bacteria 10548
245 nmdc:mga0rr50_28451_c1 3300050513 Bacteria 3929
246 nmdc:mga08x19_24444_c1 3300050514 Bacteria 3755
247 nmdc:mga0a205_118_c1 3300050515 Bacteria 47419
248 Ga0495601_0041886 3300053077 Bacteria 2871
249 Ga0495612_0058518 3300053078 Bacteria 1592
250 Ga0495619_0058329 3300053085 Bacteria 2562
251 Ga0495619_0128827 3300053085 Bacteria 1738
252 Ga0501084_0001016 3300054114 Bacteria 21740
253 Ga0587090_013120 3300059510 Bacteria 1193
254 Ga0501082_0038005 3300060353 Bacteria 4152
255 Ga0501082_0116540 3300060353 Bacteria 2313
256 Ga0466962_0000182 3300061719 Bacteria 26106
257 Ga0466962_0011105 3300061719 Bacteria 4334
258 Ga0466962_0013359 3300061719 Bacteria 3952
259 2554259912 2554235005 Bacteria 6457341
260 2616693307 2616644814 Bacteria 11555299
261 2644176956 2643221631 Bacteria 8168043
262 2644442059 2643221678 Bacteria 9540101
263 2644631656 2643221714 Bacteria 9015452
264 2808847127 2808606359 Bacteria 9866990
265 2811846669 2808606982 Bacteria 7791042
266 2852642609 2852635781 Bacteria 8251373
267 2862181226 2862178590 Bacteria 8583590
268 2862391918 2862382967 Bacteria 10317375
269 2863408063 2863404153 Bacteria 9672205
270 2868095398 2868088558 Bacteria 7609351
271 2873157952 2873151551 Bacteria 8625867
272 2875392293 2875391855 Bacteria 7600475
273 2875397652 2875391855 Bacteria 7600475
274 2919470005 2919468124 Bacteria 9133025
275 2946073470 2946072368 Bacteria 8999607
276 2997605856 2997600082 Bacteria 9896405
277 3006394394 3006393351 Bacteria 6615579
278 3006496949 3006493962 Bacteria 8825450
279 8008560618 8008558824 Bacteria 10610750
280 8047901068 8047893842 Bacteria 11723082
281 8047902445 8047893842 Bacteria 11723082
282 8048357833 8048356638 Bacteria 11044339
283 8048370241 8048369669 Bacteria 11666822
284 8048378007 8048369669 Bacteria 11666822
285 8048387105 8048379754 Bacteria 11877923
286 8048389180 8048379754 Bacteria 11877923
287 8048407268 8048406513 Bacteria 8936924
288 Ga0075433_10045492
289 JGI24739J22299_10036331
290 JGI24735J21928_10056646
291 Ga0006562J51391_1020956
292 Ga0006562J51391_1051463
293 Ga0070658_10005699
294 Ga0070658_10010976
295 Ga0070668_100033864
296 Ga0070709_10210922
297 Ga0070714_100017731
298 Ga0070714_100067366
299 Ga0070714_100152480
300 Ga0070665_100000922
301 Ga0068855_100457689
302 Ga0068856_100246478
303 Ga0068852_100152457
304 Ga0081455_10000134
305 Ga0081455_10000355
306 Ga0081455_10003440
307 Ga0081538_10000249
308 Ga0081539_10016538
309 Ga0081539_10143703
310 Ga0075363_100005587
311 Ga0075432_10025570
312 Ga0075428_100042125
313 Ga0075428_100171448
314 Ga0075431_100012127
315 Ga0075433_10000069
316 Ga0075434_100003026
317 Ga0075429_100021526
318 Ga0075436_100009065
319 Ga0075435_100001588
320 Ga0105251_10070697
321 Ga0105250_10021263
322 Ga0111539_10007918
323 Ga0111539_10028113
324 Ga0111539_10668976
325 Ga0105245_10012913
326 Ga0105245_10054380
327 Ga0114129_10089907
328 Ga0114129_10326813
329 Ga0105249_10436291
330 Ga0163162_10156738
331 Ga0157372_10392222
332 Ga0183367_1003
333 Ga0197907_10934051
334 Ga0197907_11383118
335 Ga0206353_11216267
336 Ga0206353_11748879
337 Ga0206353_12071001
338 Ga0224712_10026769
339 Ga0224712_10067492
340 Ga0209758_1001840
341 Ga0207426_1002119
342 Ga0207647_10016513
343 Ga0207699_10129285
344 Ga0207705_10007667
345 Ga0207707_10219254
346 Ga0207687_10064177
347 Ga0207664_10014037
348 Ga0207664_10071810
349 Ga0207709_10354470
350 Ga0207709_10389379
351 Ga0207667_10256152
352 Ga0207712_10217970
353 Ga0207702_10218079
354 Ga0207675_100295365
355 Ga0207683_10031095
356 Ga0207428_10005614
357 Ga0207428_10017701
358 Ga0268266_10010223
359 Ga0307513_10058774
360 Ga0307509_10074735
361 Ga0307408_100002929
362 Ga0307508_10089184
363 Ga0307514_10082556
364 Ga0316576_10267361
365 Ga0307518_10083750
366 Ga0307410_10034958
367 Ga0307407_10212267
368 Ga0307409_100009092
369 Ga0307409_100244958
370 Ga0307409_100422509
371 Ga0307414_10146235
372 Ga0307507_10000682
373 Ga0395900_0098883
374 Ga0395898_0011953
375 Ga0395898_0047509
376 Ga0395898_0054545
377 Ga0395901_0001511
378 Ga0439436_0008261
379 Ga0439450_025572
380 Ga0439457_002016
381 Ga0439463_001409
382 Ga0450894_000490
383 Ga0450898_002785
384 Ga0450899_001641
385 Ga0450906_001171
386 Ga0439460_0006956
387 Ga0451577_0092154
388 Ga0451577_0270272
389 Ga0439440_0000556
390 Ga0466969_0014346
391 Ga0466969_0014526
392 Ga0466969_0018911
393 Ga0466969_0029662
394 Ga0466972_0020211
395 Ga0466972_0052894
396 Ga0466965_0005796
397 Ga0466965_0006675
398 Ga0466966_0001512
399 Ga0466966_0023760
400 Ga0466966_0031725
401 Ga0466961_0001156
402 Ga0466961_0012383
403 Ga0466961_0046677
404 Ga0466961_0093695
405 Ga0466963_0035569
406 Ga0466971_0003312
407 Ga0466971_0007650
408 Ga0466970_0000459
409 Ga0466970_0012999
410 Ga0466970_0016342
411 Ga0466957_0000223
412 Ga0466957_0243906
413 Ga0466960_0104943
414 Ga0466959_0000835
415 Ga0466959_0020422
416 Ga0466959_0033266
417 Ga0466958_0000629
418 Ga0466958_0063903
419 Ga0466967_0018742
420 Ga0466967_0106487
421 Ga0466967_0912786
422 Ga0495592_0023901
423 Ga0495603_0020364
424 Ga0495603_0039795
425 Ga0495603_0098963
426 Ga0495629_0140886
427 Ga0495638_0110935
428 Ga0495651_0000339
429 Ga0495651_0000451
430 Ga0495582_0036090
431 Ga0495594_0007179
432 Ga0495594_0185274
433 Ga0495618_0150183
434 Ga0495628_0061881
435 Ga0495628_0088685
436 Ga0495652_0001332
437 Ga0495652_0003042
438 Ga0495665_0153680
439 Ga0495640_0006049
440 Ga0495645_0008114
441 Ga0495635_0016448
442 Ga0495588_0000456
443 Ga0495657_0001161
444 Ga0495623_0042335
445 Ga0495646_0052634
446 Ga0495669_0041274
447 Ga0495613_0000432
448 Ga0495589_0054892
449 Ga0495600_0002314
450 Ga0495600_0029126
451 Ga0495604_0001319
452 Ga0495604_0096116
453 Ga0495674_0316943
454 Ga0495674_0332474
455 Ga0495687_002167
456 Ga0495685_008177
457 Ga0495593_0003023
458 Ga0496101_0296554
459 Ga0496105_0185027
460 Ga0496108_0119659
461 Ga0496108_0319652
462 Ga0496109_0013970
463 Ga0496109_0109332
464 Ga0496110_0100229
465 Ga0496126_0303220
466 Ga0501308_001469
467 Ga0501311_004331
468 Ga0501031_0000088
469 Ga0501032_0000473
470 Ga0501032_0030583
471 Ga0501033_0000804
472 Ga0501033_0001814
473 Ga0501034_0003170
474 Ga0501034_0013032
475 Ga0501034_0031209
476 Ga0501034_0135689
477 Ga0501036_0003838
478 Ga0501036_0011412
479 Ga0501036_0019446
480 Ga0501037_0001051
481 Ga0501038_0000311
482 Ga0501038_0417739
483 Ga0501039_0000286
484 Ga0501039_0208952
485 Ga0501039_0219524
486 Ga0501043_0001106
487 Ga0501043_0001527
488 Ga0501046_0000052
489 Ga0501047_0007698
490 Ga0501047_0028327
491 Ga0501047_0261771
492 Ga0501048_0000012
493 Ga0501067_0001547
494 Ga0501067_0004141
495 Ga0501067_0005424
496 Ga0501068_0003018
497 Ga0501068_0027676
498 Ga0501068_0126240
499 Ga0501069_0001554
500 Ga0501069_0060056
501 Ga0501070_0002295
502 Ga0501070_0003285
503 Ga0501070_0006753
504 Ga0501070_0040504
505 Ga0501071_0047640
506 Ga0501072_0011346
507 Ga0501073_0002904
508 Ga0501073_0144692
509 Ga0501074_0000071
510 Ga0501074_0004853
511 Ga0501074_0005061
512 Ga0501074_0044716
513 Ga0501077_0013922
514 Ga0501077_0015359
515 Ga0501079_0028566
516 Ga0501080_0000415
517 Ga0501080_0058276
518 Ga0501083_0006459
519 Ga0501083_0137646
520 Ga0501035_0001182
521 Ga0501035_0023266
522 Ga0501044_0001157
523 Ga0501044_0003842
524 Ga0501044_0082703
525 nmdc:mga03n38_4796_c1
526 nmdc:mga05p37_332391_c1
527 nmdc:mga05p37_36413_c1
528 nmdc:mga09592_1034_c1
529 nmdc:mga06r32_902_c1
530 nmdc:mga08y16_77601_c1
531 nmdc:mga08y16_8882_c1
532 nmdc:mga0rr50_28451_c1
533 nmdc:mga08x19_24444_c1
534 nmdc:mga0a205_118_c1
535 Ga0495601_0041886
536 Ga0495612_0058518
537 Ga0495619_0058329
538 Ga0495619_0128827
539 Ga0501084_0001016
540 Ga0587090_013120
541 Ga0501082_0038005
542 Ga0501082_0116540
543 Ga0466962_0000182
544 Ga0466962_0011105
545 Ga0466962_0013359
546 2554259912
547 2616693307
548 2644176956
549 2644442059
550 2644631656
551 2808847127
552 2811846669
553 2852642609
554 2862181226
555 2862391918
556 2863408063
557 2868095398
558 2873157952
559 2875392293
560 2875397652
561 2919470005
562 2946073470
563 2997605856
564 3006394394
565 3006496949
566 8008560618
567 8047901068
568 8047902445
569 8048357833
570 8048370241
571 8048378007
572 8048387105
573 8048389180
574 8048407268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00766

ETF_alpha

Electron transfer flavoprotein FAD-binding domain

219

299

0.99

PF01012

ETF

Electron transfer flavoprotein domain

13

197

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t9g-assembly1.cif.gz_R structure of the human mcad:etf complex 0.9046 3 153
1o95-assembly1.cif.gz_F ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.8765 2 154
3ih5-assembly1.cif.gz_B crystal structure of electron transfer flavoprotein alpha-subunit from bacteroides thetaiotaomicron 0.8717 1 154
1o95-assembly1.cif.gz_E ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.8022 3 151
1o96-assembly3.cif.gz_E structure of electron transferring flavoprotein for methylophilus methylotrophus. 0.8014 3 151
ID Description Score Start End Superfamily
af_P9WNG9_187_318_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9827 167 293 3.40.50.1220
af_P77378_184_312_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9405 168 288 3.40.50.1220
af_P9WNG9_187_318_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9389 167 293 3.40.50.1220
af_P9WNG9_2_185_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9384 2 154 3.40.50.620
af_Q46907_159_286_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9179 167 293 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A1C5DSN9-F1-model_v4 Electron transfer flavoprotein alpha subunit apoprotein 0.9863 169 293 GO:0009055
GO:0033539
GO:0050660
AF-A0A2H2IBS4-F1-model_v4 deleted 0.9861 167 288
AF-A0A0F5VLG4-F1-model_v4 Electron transfer flavoprotein subunit alpha 0.9828 1 135 GO:0009055
GO:0033539
GO:0050660
AF-A0A6F8ZR16-F1-model_v4 Electron transfer flavoprotein alpha subunit C-terminal domain-containing protein 0.9822 167 289 GO:0005739
GO:0009055
GO:0033539
GO:0050660
AF-A0A364NV41-F1-model_v4 Electron transfer flavoprotein subunit alpha 0.9821 167 288 GO:0009055
GO:0033539
GO:0050660

Map