F387704

General Info

Members Datasets Scaffolds Average Seq Length
286 197 570 401

Family's Representative Sequence

Representative Sequence 3300053084|Ga0495595_0029311|Ga0495595_0029311_975_2363
Length 462
Sequence LVVGSVALTADETTQNGGCGLVQLLVAPKTAAASKGQAGMHGGQSADKNLSTVAIKTKKKPGYYRDHGDGAARGLYLQVVRLKHGALSKSWTFRYVSPTSGKARWMGLGSVSDLGLADARELAKAARRLKALDLDPIDERNKERMXXXLEAAKAVSFKEAAERYVEAHQTGWKNDKHRAQWAATLKTYAYPVVGALPMAAIDEGHVLKVLEPIWTTKPETASRVRQRMESVIDWATARKYRVGDNPARWRGHLDKLLPKTSKVRRVRNHPALPYAEIQPFMTALRERDGISARTLEFTVLTACRTGEAIGAKWDEFNLADKIWTVPAERMKSGREHRVPLSGAVLEVLRKLPREKNNPHVFIGARSSALSNMAMLELLRGLRPGMTVHGFRSTFRDWAAEKTNYPNHVVEAALAHVIGDRVEAAYRRGDLLDHRKRLMDAWATYCDQKPAKGGTVVSLQAKA

Samples

Sample ID Description Type Environment
1 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
46 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
68 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
78 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
79 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
89 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
96 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
100 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
113 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
137 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
150 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
151 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
158 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
171 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
172 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
173 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
174 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
175 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
177 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
178 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
179 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
180 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
181 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
182 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
183 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
184 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
185 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
186 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
187 2919513703 Luteimonas sp. 3794 Isolate Unclassified
188 2919675420 Luteimonas terrae 4099 Isolate Unclassified
189 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
190 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
191 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
192 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
193 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
194 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
195 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
196 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
197 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.26
Metatranscriptomes 1.4
Isolates 7.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.9
Nodule 4.9
Rhizoplane 4.55
Rhizosphere 81.47
Stem 0
Stem Tuber 0
Unclassified 12.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495595_0029311 3300053084 Bacteria 2462
2 JGI24741J21665_1000649 3300001915 Bacteria 10510
3 JGI24740J21852_10000019 3300001979 Bacteria 54662
4 Ga0065714_10100516 3300005288 Unclassified 1663
5 Ga0070658_10003702 3300005327 Bacteria 12509
6 Ga0070658_10021205 3300005327 Bacteria 5205
7 Ga0070683_100142583 3300005329 Bacteria 2270
8 Ga0070670_100161097 3300005331 Bacteria 1944
9 Ga0070680_100130984 3300005336 Bacteria 2098
10 Ga0070674_100197420 3300005356 Unclassified 1551
11 Ga0070709_10171841 3300005434 Bacteria 1515
12 Ga0070713_100186925 3300005436 Bacteria 1865
13 Ga0070713_100304566 3300005436 Bacteria 1468
14 Ga0070711_100000115 3300005439 Bacteria 41554
15 Ga0070663_100000022 3300005455 Bacteria 111612
16 Ga0070663_100176056 3300005455 Unclassified 1656
17 Ga0070662_100150546 3300005457 Unclassified 1811
18 Ga0070681_10290007 3300005458 Bacteria 1546
19 Ga0070706_100014202 3300005467 Bacteria 7358
20 Ga0070706_100194592 3300005467 Bacteria 1894
21 Ga0070698_100058757 3300005471 Bacteria 3887
22 Ga0070698_100385475 3300005471 Unclassified 1334
23 Ga0070679_100230098 3300005530 Bacteria 1813
24 Ga0070686_100084834 3300005544 Unclassified 2106
25 Ga0070665_100029889 3300005548 Bacteria 5483
26 Ga0068855_100008309 3300005563 Bacteria 12546
27 Ga0070664_100274661 3300005564 Bacteria 1519
28 Ga0068856_100000041 3300005614 Bacteria 112613
29 Ga0068856_100000227 3300005614 Bacteria 61212
30 Ga0068856_100113352 3300005614 Unclassified 2710
31 Ga0068856_100313655 3300005614 Bacteria 1586
32 Ga0068852_100034556 3300005616 Unclassified 4207
33 Ga0070717_10047469 3300006028 Unclassified 3518
34 Ga0070717_10317499 3300006028 Bacteria 1388
35 Ga0075368_10021141 3300006042 Unclassified 2469
36 Ga0075364_10003727 3300006051 Bacteria 8699
37 Ga0075366_10083825 3300006195 Bacteria 1905
38 Ga0075428_100047977 3300006844 Bacteria 4689
39 Ga0075428_100167868 3300006844 Bacteria 2380
40 Ga0075431_100000047 3300006847 Bacteria 64846
41 Ga0075431_100169950 3300006847 Bacteria 2240
42 Ga0075429_100242013 3300006880 Bacteria 1580
43 Ga0099826_10000112 3300006948 Bacteria 37415
44 Ga0105240_10003971 3300009093 Bacteria 22834
45 Ga0105240_10007316 3300009093 Bacteria 16066
46 Ga0105240_10051044 3300009093 Bacteria 5208
47 Ga0105240_10052520 3300009093 Bacteria 5123
48 Ga0105240_10185711 3300009093 Bacteria 2449
49 Ga0111539_10004711 3300009094 Bacteria 17824
50 Ga0111539_10062791 3300009094 Bacteria 4396
51 Ga0114129_10001108 3300009147 Bacteria 35473
52 Ga0114129_10038819 3300009147 Bacteria 6712
53 Ga0114129_10081818 3300009147 Bacteria 4488
54 Ga0114129_10150424 3300009147 Bacteria 3186
55 Ga0114129_10349772 3300009147 Bacteria 1958
56 Ga0105241_10000037 3300009174 Bacteria 115452
57 Ga0105238_10006919 3300009551 Bacteria 11329
58 Ga0105239_10005341 3300010375 Bacteria 15073
59 Ga0105239_10082577 3300010375 Bacteria 3539
60 Ga0157373_10000046 3300013100 Bacteria 112179
61 Ga0157371_10036654 3300013102 Bacteria 3512
62 Ga0157370_10000071 3300013104 Bacteria 111640
63 Ga0157370_10030280 3300013104 Bacteria 5304
64 Ga0157370_10052774 3300013104 Viruses 3880
65 Ga0157370_10138110 3300013104 Bacteria 2271
66 Ga0157369_10007532 3300013105 Bacteria 12526
67 Ga0157375_10478013 3300013308 Bacteria 1411
68 Ga0182008_10004304 3300014497 Bacteria 8335
69 Ga0182007_10027128 3300015262 Bacteria 1978
70 Ga0209676_1000730 3300025292 Bacteria 44985
71 Ga0209758_1013385 3300025297 Bacteria 4476
72 Ga0207705_10003165 3300025909 Bacteria 12523
73 Ga0207705_10102593 3300025909 Bacteria 2106
74 Ga0207654_10000032 3300025911 Bacteria 120553
75 Ga0207707_10003175 3300025912 Bacteria 14586
76 Ga0207707_10246531 3300025912 Bacteria 1552
77 Ga0207695_10003464 3300025913 Bacteria 22205
78 Ga0207695_10005895 3300025913 Bacteria 16070
79 Ga0207695_10021533 3300025913 Bacteria 7352
80 Ga0207695_10025568 3300025913 Bacteria 6606
81 Ga0207663_10000165 3300025916 Bacteria 29860
82 Ga0207660_10103567 3300025917 Bacteria 2129
83 Ga0207652_10310128 3300025921 Bacteria 1424
84 Ga0207694_10010035 3300025924 Bacteria 7137
85 Ga0207694_10083508 3300025924 Unclassified 2512
86 Ga0207706_10141924 3300025933 Unclassified 2113
87 Ga0207667_10025397 3300025949 Bacteria 6484
88 Ga0207678_10006433 3300026067 Bacteria 10421
89 Ga0207702_10000061 3300026078 Bacteria 125368
90 Ga0207702_10000533 3300026078 Bacteria 42539
91 Ga0207702_10335245 3300026078 Bacteria 1444
92 Ga0207674_10129262 3300026116 Bacteria 2490
93 Ga0207683_10136237 3300026121 Bacteria 2210
94 Ga0207698_10024016 3300026142 Unclassified 4270
95 Ga0209282_1000268 3300027666 Bacteria 25932
96 Ga0268266_10256791 3300028379 Bacteria 1618
97 Ga0307515_10001540 3300028794 Bacteria 51551
98 Ga0265338_10000028 3300028800 Bacteria 279132
99 Ga0265338_10011875 3300028800 Bacteria 10003
100 Ga0307512_10075062 3300030522 Bacteria 2476
101 Ga0265325_10000001 3300031241 Bacteria 726814
102 Ga0265339_10000093 3300031249 Bacteria 75604
103 Ga0316579_10000750 3300031691 Bacteria 11126
104 Ga0316579_10035671 3300031691 Bacteria 2293
105 Ga0316576_10053623 3300031727 Unclassified 2938
106 Ga0316578_10003982 3300031728 Bacteria 6886
107 Ga0316578_10081585 3300031728 Bacteria 1924
108 Ga0307516_10102777 3300031730 Bacteria 2672
109 Ga0316577_10021648 3300031733 Bacteria 3567
110 Ga0307412_10000347 3300031911 Bacteria 28990
111 Ga0307414_10000162 3300032004 Bacteria 44661
112 Ga0316585_10000549 3300032137 Bacteria 9105
113 Ga0316580_10000646 3300032139 Bacteria 8230
114 Ga0316580_10016751 3300032139 Bacteria 2250
115 Ga0316593_10002419 3300032168 Bacteria 4418
116 Ga0316593_10031197 3300032168 Unclassified 1735
117 Ga0316592_1018887 3300033524 Bacteria 1455
118 Ga0316596_1023195 3300033541 Bacteria 1589
119 Ga0373943_0000209 3300035170 Bacteria 24029
120 Ga0373943_0091442 3300035170 Unclassified 1576
121 Ga0316574_0000473 3300035398 Bacteria 16222
122 Ga0373931_0137290 3300035691 Bacteria 1413
123 Ga0373935_0025920 3300035692 Bacteria 3614
124 Ga0373927_0000682 3300035695 Bacteria 25864
125 Ga0373927_0013430 3300035695 Bacteria 5442
126 Ga0373947_0000365 3300035725 Bacteria 25566
127 Ga0373947_0043088 3300035725 Unclassified 2695
128 Ga0316582_0000251 3300036647 Bacteria 17982
129 Ga0316584_0016159 3300036712 Bacteria 5347
130 Ga0316584_0153801 3300036712 Bacteria 1711
131 Ga0373925_0169819 3300037068 Unclassified 1721
132 Ga0395900_0006055 3300037418 Bacteria 12615
133 Ga0395898_0001029 3300037466 Bacteria 43484
134 Ga0395898_0020582 3300037466 Bacteria 6701
135 Ga0395901_0000526 3300038443 Bacteria 44086
136 Ga0395901_0010587 3300038443 Bacteria 9343
137 Ga0395901_0180959 3300038443 Bacteria 2211
138 Ga0436363_0650200 3300039450 Bacteria 3467
139 Ga0439436_0006413 3300041404 Bacteria 3612
140 Ga0451851_0312888 3300041507 Bacteria 1479
141 Ga0451853_2154476 3300041512 Plasmid 4433
142 Ga0466965_0007100 3300044683 Bacteria 5129
143 Ga0466964_0006798 3300044706 Bacteria 4265
144 Ga0466968_0006198 3300044735 Bacteria 4497
145 Ga0466957_0005503 3300044842 Bacteria 7109
146 Ga0495638_0000666 3300046460 Bacteria 37403
147 Ga0495641_0049163 3300046461 Unclassified 1932
148 Ga0495641_0094418 3300046461 Bacteria 1336
149 Ga0495653_0034113 3300046463 Bacteria 4028
150 Ga0495650_0000002 3300046471 Bacteria 1057165
151 Ga0495582_0108124 3300046473 Unclassified 1561
152 Ga0495664_0005477 3300046477 Bacteria 6970
153 Ga0495583_0000120 3300046506 Bacteria 133285
154 Ga0495583_0015529 3300046506 Bacteria 4137
155 Ga0495608_0118110 3300046511 Unclassified 1701
156 Ga0495610_0000002 3300046512 Bacteria 1282131
157 Ga0495610_0003391 3300046512 Bacteria 12449
158 Ga0495630_0019668 3300046517 Bacteria 4967
159 Ga0495632_0054261 3300046519 Bacteria 1965
160 Ga0495637_0000010 3300046520 Bacteria 378927
161 Ga0495643_0000060 3300046522 Bacteria 190075
162 Ga0495648_0012780 3300046524 Bacteria 6237
163 Ga0495648_0098916 3300046524 Bacteria 1615
164 Ga0495666_0028038 3300046526 Bacteria 2772
165 Ga0495652_0031462 3300046529 Bacteria 4647
166 Ga0495654_0003712 3300046530 Bacteria 9267
167 Ga0495654_0008952 3300046530 Bacteria 5501
168 Ga0495665_0066249 3300046531 Unclassified 1906
169 Ga0495640_0045644 3300046533 Bacteria 3040
170 Ga0495640_0075635 3300046533 Unclassified 2248
171 Ga0495640_0083803 3300046533 Bacteria 2115
172 Ga0495597_0000001 3300046542 Bacteria 1110529
173 Ga0495597_0000664 3300046542 Bacteria 27946
174 Ga0495667_0048917 3300046559 Unclassified 2791
175 Ga0495634_0023871 3300046642 Bacteria 4295
176 Ga0495635_0063429 3300046663 Bacteria 2537
177 Ga0495635_0114541 3300046663 Unclassified 1841
178 Ga0495588_0074052 3300046674 Bacteria 1774
179 Ga0495657_0101413 3300046675 Unclassified 1834
180 Ga0495599_0150915 3300046678 Bacteria 1439
181 Ga0495671_0002527 3300046692 Bacteria 11500
182 Ga0495600_0125908 3300046809 Unclassified 1666
183 Ga0495581_0080524 3300047315 Bacteria 1885
184 Ga0495604_0133108 3300047317 Unclassified 1785
185 Ga0495674_0023006 3300047319 Bacteria 5741
186 Ga0495672_0004667 3300047320 Bacteria 11103
187 Ga0495676_0067335 3300047321 Unclassified 2771
188 Ga0495676_0147113 3300047321 Unclassified 1681
189 Ga0495680_0003995 3300047322 Bacteria 14249
190 Ga0495677_0003599 3300047445 Bacteria 6010
191 Ga0495677_0081239 3300047445 Unclassified 1215
192 Ga0495673_0000116 3300047469 Bacteria 154310
193 Ga0495684_0005380 3300047471 Bacteria 9968
194 Ga0495684_0073267 3300047471 Unclassified 2602
195 Ga0495684_0076251 3300047471 Bacteria 2546
196 Ga0495686_0002092 3300047472 Bacteria 19598
197 Ga0496104_0051207 3300048907 Bacteria 3897
198 Ga0496104_0157480 3300048907 Bacteria 2179
199 Ga0496105_0146190 3300048908 Bacteria 1944
200 Ga0496108_0122892 3300048911 Unclassified 2228
201 Ga0496109_0168137 3300048912 Bacteria 2056
202 Ga0496110_0001302 3300048913 Bacteria 17928
203 Ga0496110_0021830 3300048913 Bacteria 5427
204 Ga0496112_0009932 3300048915 Bacteria 8610
205 Ga0496113_0086567 3300048916 Bacteria 2408
206 Ga0496113_0117019 3300048916 Bacteria 2080
207 Ga0496114_0095528 3300048917 Bacteria 2530
208 Ga0496115_0240807 3300048918 Bacteria 1491
209 Ga0495678_020172 3300049459 Unclassified 2957
210 Ga0501290_004967 3300049513 Bacteria 1661
211 Ga0501300_003844 3300049523 Bacteria 2235
212 Ga0501032_0066580 3300049569 Unclassified 2407
213 Ga0501033_0004329 3300049570 Bacteria 11389
214 Ga0501034_0000182 3300049571 Bacteria 117605
215 Ga0501034_0000595 3300049571 Bacteria 57174
216 Ga0501034_0001056 3300049571 Bacteria 39120
217 Ga0501034_0002770 3300049571 Bacteria 20554
218 Ga0501034_0002816 3300049571 Bacteria 20328
219 Ga0501034_0002886 3300049571 Bacteria 19984
220 Ga0501034_0004131 3300049571 Bacteria 16261
221 Ga0501034_0017628 3300049571 Bacteria 7321
222 Ga0501034_0022989 3300049571 Bacteria 6353
223 Ga0501034_0053685 3300049571 Bacteria 4058
224 Ga0501034_0118666 3300049571 Bacteria 2632
225 Ga0501034_0201763 3300049571 Unclassified 1946
226 Ga0501034_0213340 3300049571 Bacteria 1885
227 Ga0501034_0288965 3300049571 Bacteria 1578
228 Ga0501038_0022617 3300049574 Bacteria 5630
229 Ga0501043_0007441 3300049579 Bacteria 8695
230 Ga0501223_005941 3300049663 Bacteria 2546
231 Ga0501225_0001604 3300049705 Bacteria 7070
232 Ga0501035_0000494 3300049822 Bacteria 44339
233 Ga0501035_0002527 3300049822 Bacteria 17889
234 Ga0501035_0025432 3300049822 Bacteria 5428
235 Ga0501044_0028954 3300049823 Bacteria 5842
236 Ga0501044_0244957 3300049823 Bacteria 1735
237 Ga0501044_0293106 3300049823 Bacteria 1558
238 nmdc:mga00v17_2069_c1 3300050491 Bacteria 10332
239 nmdc:mga07m45_121580_c1 3300050496 Bacteria 1508
240 nmdc:mga05p37_286631_c1 3300050507 Bacteria 1962
241 nmdc:mga05p37_47071_c1 3300050507 Bacteria 5304
242 nmdc:mga05p37_57_c1 3300050507 Bacteria 96042
243 nmdc:mga09592_248985_c1 3300050508 Bacteria 1540
244 nmdc:mga09592_81608_c2 3300050508 Bacteria 2191
245 nmdc:mga06r32_133005_c1 3300050510 Bacteria 2461
246 nmdc:mga06r32_1829_c1 3300050510 Bacteria 18995
247 nmdc:mga08y16_153771_c1 3300050511 Bacteria 2391
248 nmdc:mga08y16_58801_c1 3300050511 Bacteria 4017
249 Ga0495601_0003461 3300053077 Bacteria 9052
250 Ga0495601_0008249 3300053077 Bacteria 6147
251 Ga0495601_0011171 3300053077 Bacteria 5363
252 Ga0495601_0041633 3300053077 Bacteria 2880
253 Ga0495612_0085967 3300053078 Unclassified 1326
254 Ga0495595_0051984 3300053084 Bacteria 1900
255 Ga0495619_0013174 3300053085 Bacteria 5211
256 Ga0495619_0105941 3300053085 Bacteria 1917
257 Ga0500643_000804 3300053087 Bacteria 20293
258 Ga0500650_0040140 3300053098 Bacteria 2159
259 Ga0500555_000043 3300053103 Bacteria 64581
260 Ga0500655_000079 3300053133 Bacteria 25542
261 Ga0500622_0019147 3300053156 Bacteria 3636
262 Ga0500622_0022367 3300053156 Bacteria 3352
263 Ga0500627_0005534 3300053158 Bacteria 4204
264 Ga0466962_0020246 3300061719 Bacteria 3198
265 2514422945 2513237305 Bacteria 7293571
266 2597815097 2597489875 Bacteria 7010078
267 2599335184 2599185156 Bacteria 5403036
268 2723573606 2721755686 Bacteria 7343952
269 2818239110 2816332527 Bacteria 8933356
270 2819645366 2818991454 Bacteria 5563326
271 2842338030 2842333319 Bacteria 8899485
272 2856323681 2856320880 Bacteria 7263508
273 2869278825 2869278585 Bacteria 7077053
274 2881365506 2881364244 Bacteria 7710352
275 2919516317 2919513703 Bacteria 3844312
276 2919676845 2919675420 Bacteria 3969095
277 2935782615 2935777560 Bacteria 8077691
278 2958034941 2958034702 Bacteria 6989922
279 2958042930 2958041894 Bacteria 13082850
280 2970540106 2970540015 Bacteria 6977556
281 2970593421 2970593180 Bacteria 7073582
282 2990713186 2990710928 Bacteria 5002431
283 3004340385 3004334049 Bacteria 8449246
284 8019544441 8019538911 Bacteria 7872763
285 8054564902 8054563764 Bacteria 5592885
286 Ga0495595_0029311
287 JGI24741J21665_1000649
288 JGI24740J21852_10000019
289 Ga0065714_10100516
290 Ga0070658_10003702
291 Ga0070658_10021205
292 Ga0070683_100142583
293 Ga0070670_100161097
294 Ga0070680_100130984
295 Ga0070674_100197420
296 Ga0070709_10171841
297 Ga0070713_100186925
298 Ga0070713_100304566
299 Ga0070711_100000115
300 Ga0070663_100000022
301 Ga0070663_100176056
302 Ga0070662_100150546
303 Ga0070681_10290007
304 Ga0070706_100014202
305 Ga0070706_100194592
306 Ga0070698_100058757
307 Ga0070698_100385475
308 Ga0070679_100230098
309 Ga0070686_100084834
310 Ga0070665_100029889
311 Ga0068855_100008309
312 Ga0070664_100274661
313 Ga0068856_100000041
314 Ga0068856_100000227
315 Ga0068856_100113352
316 Ga0068856_100313655
317 Ga0068852_100034556
318 Ga0070717_10047469
319 Ga0070717_10317499
320 Ga0075368_10021141
321 Ga0075364_10003727
322 Ga0075366_10083825
323 Ga0075428_100047977
324 Ga0075428_100167868
325 Ga0075431_100000047
326 Ga0075431_100169950
327 Ga0075429_100242013
328 Ga0099826_10000112
329 Ga0105240_10003971
330 Ga0105240_10007316
331 Ga0105240_10051044
332 Ga0105240_10052520
333 Ga0105240_10185711
334 Ga0111539_10004711
335 Ga0111539_10062791
336 Ga0114129_10001108
337 Ga0114129_10038819
338 Ga0114129_10081818
339 Ga0114129_10150424
340 Ga0114129_10349772
341 Ga0105241_10000037
342 Ga0105238_10006919
343 Ga0105239_10005341
344 Ga0105239_10082577
345 Ga0157373_10000046
346 Ga0157371_10036654
347 Ga0157370_10000071
348 Ga0157370_10030280
349 Ga0157370_10052774
350 Ga0157370_10138110
351 Ga0157369_10007532
352 Ga0157375_10478013
353 Ga0182008_10004304
354 Ga0182007_10027128
355 Ga0209676_1000730
356 Ga0209758_1013385
357 Ga0207705_10003165
358 Ga0207705_10102593
359 Ga0207654_10000032
360 Ga0207707_10003175
361 Ga0207707_10246531
362 Ga0207695_10003464
363 Ga0207695_10005895
364 Ga0207695_10021533
365 Ga0207695_10025568
366 Ga0207663_10000165
367 Ga0207660_10103567
368 Ga0207652_10310128
369 Ga0207694_10010035
370 Ga0207694_10083508
371 Ga0207706_10141924
372 Ga0207667_10025397
373 Ga0207678_10006433
374 Ga0207702_10000061
375 Ga0207702_10000533
376 Ga0207702_10335245
377 Ga0207674_10129262
378 Ga0207683_10136237
379 Ga0207698_10024016
380 Ga0209282_1000268
381 Ga0268266_10256791
382 Ga0307515_10001540
383 Ga0265338_10000028
384 Ga0265338_10011875
385 Ga0307512_10075062
386 Ga0265325_10000001
387 Ga0265339_10000093
388 Ga0316579_10000750
389 Ga0316579_10035671
390 Ga0316576_10053623
391 Ga0316578_10003982
392 Ga0316578_10081585
393 Ga0307516_10102777
394 Ga0316577_10021648
395 Ga0307412_10000347
396 Ga0307414_10000162
397 Ga0316585_10000549
398 Ga0316580_10000646
399 Ga0316580_10016751
400 Ga0316593_10002419
401 Ga0316593_10031197
402 Ga0316592_1018887
403 Ga0316596_1023195
404 Ga0373943_0000209
405 Ga0373943_0091442
406 Ga0316574_0000473
407 Ga0373931_0137290
408 Ga0373935_0025920
409 Ga0373927_0000682
410 Ga0373927_0013430
411 Ga0373947_0000365
412 Ga0373947_0043088
413 Ga0316582_0000251
414 Ga0316584_0016159
415 Ga0316584_0153801
416 Ga0373925_0169819
417 Ga0395900_0006055
418 Ga0395898_0001029
419 Ga0395898_0020582
420 Ga0395901_0000526
421 Ga0395901_0010587
422 Ga0395901_0180959
423 Ga0436363_0650200
424 Ga0439436_0006413
425 Ga0451851_0312888
426 Ga0451853_2154476
427 Ga0466965_0007100
428 Ga0466964_0006798
429 Ga0466968_0006198
430 Ga0466957_0005503
431 Ga0495638_0000666
432 Ga0495641_0049163
433 Ga0495641_0094418
434 Ga0495653_0034113
435 Ga0495650_0000002
436 Ga0495582_0108124
437 Ga0495664_0005477
438 Ga0495583_0000120
439 Ga0495583_0015529
440 Ga0495608_0118110
441 Ga0495610_0000002
442 Ga0495610_0003391
443 Ga0495630_0019668
444 Ga0495632_0054261
445 Ga0495637_0000010
446 Ga0495643_0000060
447 Ga0495648_0012780
448 Ga0495648_0098916
449 Ga0495666_0028038
450 Ga0495652_0031462
451 Ga0495654_0003712
452 Ga0495654_0008952
453 Ga0495665_0066249
454 Ga0495640_0045644
455 Ga0495640_0075635
456 Ga0495640_0083803
457 Ga0495597_0000001
458 Ga0495597_0000664
459 Ga0495667_0048917
460 Ga0495634_0023871
461 Ga0495635_0063429
462 Ga0495635_0114541
463 Ga0495588_0074052
464 Ga0495657_0101413
465 Ga0495599_0150915
466 Ga0495671_0002527
467 Ga0495600_0125908
468 Ga0495581_0080524
469 Ga0495604_0133108
470 Ga0495674_0023006
471 Ga0495672_0004667
472 Ga0495676_0067335
473 Ga0495676_0147113
474 Ga0495680_0003995
475 Ga0495677_0003599
476 Ga0495677_0081239
477 Ga0495673_0000116
478 Ga0495684_0005380
479 Ga0495684_0073267
480 Ga0495684_0076251
481 Ga0495686_0002092
482 Ga0496104_0051207
483 Ga0496104_0157480
484 Ga0496105_0146190
485 Ga0496108_0122892
486 Ga0496109_0168137
487 Ga0496110_0001302
488 Ga0496110_0021830
489 Ga0496112_0009932
490 Ga0496113_0086567
491 Ga0496113_0117019
492 Ga0496114_0095528
493 Ga0496115_0240807
494 Ga0495678_020172
495 Ga0501290_004967
496 Ga0501300_003844
497 Ga0501032_0066580
498 Ga0501033_0004329
499 Ga0501034_0000182
500 Ga0501034_0000595
501 Ga0501034_0001056
502 Ga0501034_0002770
503 Ga0501034_0002816
504 Ga0501034_0002886
505 Ga0501034_0004131
506 Ga0501034_0017628
507 Ga0501034_0022989
508 Ga0501034_0053685
509 Ga0501034_0118666
510 Ga0501034_0201763
511 Ga0501034_0213340
512 Ga0501034_0288965
513 Ga0501038_0022617
514 Ga0501043_0007441
515 Ga0501223_005941
516 Ga0501225_0001604
517 Ga0501035_0000494
518 Ga0501035_0002527
519 Ga0501035_0025432
520 Ga0501044_0028954
521 Ga0501044_0244957
522 Ga0501044_0293106
523 nmdc:mga00v17_2069_c1
524 nmdc:mga07m45_121580_c1
525 nmdc:mga05p37_286631_c1
526 nmdc:mga05p37_47071_c1
527 nmdc:mga05p37_57_c1
528 nmdc:mga09592_248985_c1
529 nmdc:mga09592_81608_c2
530 nmdc:mga06r32_133005_c1
531 nmdc:mga06r32_1829_c1
532 nmdc:mga08y16_153771_c1
533 nmdc:mga08y16_58801_c1
534 Ga0495601_0003461
535 Ga0495601_0008249
536 Ga0495601_0011171
537 Ga0495601_0041633
538 Ga0495612_0085967
539 Ga0495595_0051984
540 Ga0495619_0013174
541 Ga0495619_0105941
542 Ga0500643_000804
543 Ga0500650_0040140
544 Ga0500555_000043
545 Ga0500655_000079
546 Ga0500622_0019147
547 Ga0500622_0022367
548 Ga0500627_0005534
549 Ga0466962_0020246
550 2514422945
551 2597815097
552 2599335184
553 2723573606
554 2818239110
555 2819645366
556 2842338030
557 2856323681
558 2869278825
559 2881365506
560 2919516317
561 2919676845
562 2935782615
563 2958034941
564 2958042930
565 2970540106
566 2970593421
567 2990713186
568 3004340385
569 8019544441
570 8054564902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22022

Phage_int_M

Phage integrase central domain

157

252

0.99

PF13356

Arm-DNA-bind_3

Arm DNA-binding domain

50

143

0.87

PF00589

Phage_integrase

Phage integrase family

271

429

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2khv-assembly1.cif.gz_A solution nmr structure of protein nmul_a0922 from nitrosospira multiformis. northeast structural genomics consortium target nmr38b. 0.9309 115 214
3ju0-assembly1.cif.gz_A structure of the arm-type binding domain of hai7 integrase 0.8785 19 96
2khv-assembly1.cif.gz_A solution nmr structure of protein nmul_a0922 from nitrosospira multiformis. northeast structural genomics consortium target nmr38b. 0.873 115 214
2kd1-assembly1.cif.gz_A solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f 0.8687 116 207
2oxo-assembly1.cif.gz_A crystallization and structure determination of the core-binding domain of bacteriophage lambda integrase 0.8585 115 208
ID Description Score Start End Superfamily
2khvA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9465 115 199 1.10.150.130
af_P39347_1_63_3.30.160.390 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Integrase, DNA-binding domain 0.9394 43 102 3.30.160.390
2khvA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.936 115 199 1.10.150.130
af_P37326_196_376_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.9334 228 402 1.10.443.10
af_P76542_209_389_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.932 231 406 1.10.443.10
ID Description Score Start End GO Terms
AF-A0A826J6A7-F1-model_v4 Integrase 0.9874 258 405 GO:0003677
GO:0006310
GO:0015074
AF-A0A4R3XGU4-F1-model_v4 deleted 0.9765 232 407
AF-A0A4R3XGU4-F1-model_v4 deleted 0.9603 232 407
AF-A0A257JH29-F1-model_v4 Tyr recombinase domain-containing protein 0.9516 248 405 GO:0003677
GO:0006310
GO:0015074
AF-A0A1H6RB47-F1-model_v4 Phage integrase family protein 0.9504 232 408 GO:0003677
GO:0006310
GO:0015074

Map