F387690
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 286 | 204 | 269 | 318 |
Family's Representative Sequence
| Representative Sequence | 3300050507|nmdc:mga05p37_103424_c1|nmdc:mga05p37_103424_c1_1860_2927 |
| Length | 355 |
| Sequence | VRRRERLARLSGEKGTGMAGAPRPVATTHTGEDMPSNSSTSQKPIRRIAIVGTGVIGASWAAYYLSRGFDVVATDPAPNAEPNLRKYVDEAWSALAKAGLVVAGASRDRLSFTPNMGRALAEADFVQENAPERPEFKIKLFADMDEAAPPNAILASSSSGIPMDVIQTGAKRPERCVIGHPFNPPHIVPLVEVVGGAKTSEAVIERAMSFYASIGKKPIRLHKSLPGHAANRLQAALYKEMLSLIQRGVLSVSDADIAVSYGPGLRWGVMGQSLQWHLGGGAGGIHHFMEHLMPPLEGMMKDLQMPDVTPALKQTIIEGVAKEASGHSVDQLAQDENEIILGALALRQSAGRTIP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 2 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 3 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 4 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 5 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 6 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 7 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 8 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 9 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 10 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 11 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 12 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 15 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 19 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 20 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 48 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 58 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 66 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 75 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 76 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 105 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 106 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 107 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 108 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 109 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 110 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 111 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 112 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 113 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 114 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 115 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 116 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 117 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 118 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 169 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 170 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 171 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 172 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 174 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 175 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 176 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 177 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 178 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 179 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 180 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 183 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 184 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 193 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 194 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 195 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 196 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 197 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 198 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 199 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 200 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 201 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 202 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 203 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 204 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.06 |
| Metatranscriptomes | 0 |
| Isolates | 5.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.44 |
| Nodule | 2.1 |
| Rhizoplane | 3.85 |
| Rhizosphere | 76.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1002756 | 3300002070 | Bacteria | 2108 |
| 2 | JGI25159J45721_1000266 | 3300002987 | Bacteria | 24375 |
| 3 | JGI25406J46586_10000172 | 3300003203 | Bacteria | 28962 |
| 4 | JGI25406J46586_10000692 | 3300003203 | Bacteria | 15692 |
| 5 | JGI25406J46586_10056825 | 3300003203 | Bacteria | 1282 |
| 6 | rootH1_10076708 | 3300003323 | Bacteria | 3288 |
| 7 | JGI25160J50197_1000271 | 3300003354 | Bacteria | 38299 |
| 8 | JGI25161J50226_1000208 | 3300003374 | Bacteria | 38299 |
| 9 | JGI25404J52841_10000704 | 3300003659 | Bacteria | 5165 |
| 10 | Ga0055543_1000274 | 3300004625 | Bacteria | 38337 |
| 11 | Ga0065165_1001956 | 3300005262 | Bacteria | 19511 |
| 12 | Ga0065712_10121426 | 3300005290 | Bacteria | 1665 |
| 13 | Ga0065707_10110066 | 3300005295 | Bacteria | 2445 |
| 14 | Ga0068869_100016816 | 3300005334 | Bacteria | 4942 |
| 15 | Ga0068869_100319450 | 3300005334 | Bacteria | 1259 |
| 16 | Ga0070668_100074866 | 3300005347 | Bacteria | 2642 |
| 17 | Ga0070669_100162701 | 3300005353 | Bacteria | 1735 |
| 18 | Ga0070671_100147698 | 3300005355 | Bacteria | 1985 |
| 19 | Ga0070714_100315742 | 3300005435 | Bacteria | 1460 |
| 20 | Ga0070714_100465162 | 3300005435 | Unclassified | 1203 |
| 21 | Ga0070710_10107919 | 3300005437 | Bacteria | 1668 |
| 22 | Ga0070700_100166149 | 3300005441 | Bacteria | 1524 |
| 23 | Ga0070708_100000445 | 3300005445 | Bacteria | 30891 |
| 24 | Ga0070708_100011218 | 3300005445 | Bacteria | 7286 |
| 25 | Ga0070662_100008591 | 3300005457 | Bacteria | 6662 |
| 26 | Ga0070706_100153996 | 3300005467 | Bacteria | 2146 |
| 27 | Ga0070698_100198940 | 3300005471 | Bacteria | 1940 |
| 28 | Ga0070699_100167498 | 3300005518 | Bacteria | 1946 |
| 29 | Ga0070695_100110165 | 3300005545 | Bacteria | 1867 |
| 30 | Ga0070665_100218669 | 3300005548 | Bacteria | 1905 |
| 31 | Ga0070704_100152454 | 3300005549 | Bacteria | 1819 |
| 32 | Ga0068856_100013405 | 3300005614 | Bacteria | 7937 |
| 33 | Ga0068863_100441593 | 3300005841 | Bacteria | 1276 |
| 34 | Ga0068860_100000173 | 3300005843 | Bacteria | 106145 |
| 35 | Ga0068860_100017077 | 3300005843 | Bacteria | 7075 |
| 36 | Ga0068862_100071373 | 3300005844 | Bacteria | 2998 |
| 37 | Ga0081540_1000136 | 3300005983 | Bacteria | 78663 |
| 38 | Ga0081540_1000288 | 3300005983 | Bacteria | 52745 |
| 39 | Ga0081540_1000791 | 3300005983 | Bacteria | 29049 |
| 40 | Ga0081540_1001429 | 3300005983 | Bacteria | 20644 |
| 41 | Ga0081540_1007009 | 3300005983 | Bacteria | 8108 |
| 42 | Ga0081540_1008879 | 3300005983 | Bacteria | 6976 |
| 43 | Ga0081540_1011587 | 3300005983 | Bacteria | 5885 |
| 44 | Ga0081539_10000003 | 3300005985 | Bacteria | 594833 |
| 45 | Ga0081539_10013201 | 3300005985 | Bacteria | 6250 |
| 46 | Ga0070716_100006790 | 3300006173 | Bacteria | 5608 |
| 47 | Ga0070712_100010194 | 3300006175 | Bacteria | 5923 |
| 48 | Ga0075367_10049638 | 3300006178 | Bacteria | 2474 |
| 49 | Ga0075369_10018163 | 3300006186 | Bacteria | 2861 |
| 50 | Ga0075366_10080263 | 3300006195 | Bacteria | 1948 |
| 51 | Ga0075428_100090743 | 3300006844 | Bacteria | 3333 |
| 52 | Ga0075430_100013449 | 3300006846 | Bacteria | 6977 |
| 53 | Ga0075431_100024750 | 3300006847 | Bacteria | 6154 |
| 54 | Ga0075433_10082424 | 3300006852 | Bacteria | 2837 |
| 55 | Ga0075434_100097446 | 3300006871 | Bacteria | 2946 |
| 56 | Ga0075434_100352543 | 3300006871 | Bacteria | 1493 |
| 57 | Ga0068865_100211069 | 3300006881 | Bacteria | 1513 |
| 58 | Ga0075435_100118422 | 3300007076 | Bacteria | 2208 |
| 59 | Ga0099794_10000728 | 3300007265 | Bacteria | 11054 |
| 60 | Ga0099794_10058051 | 3300007265 | Bacteria | 1875 |
| 61 | Ga0099795_10029370 | 3300007788 | Bacteria | 1879 |
| 62 | Ga0099795_10046619 | 3300007788 | Bacteria | 1562 |
| 63 | Ga0099795_10092283 | 3300007788 | Bacteria | 1175 |
| 64 | Ga0099795_10113333 | 3300007788 | Bacteria | 1077 |
| 65 | Ga0105240_10000162 | 3300009093 | Bacteria | 136882 |
| 66 | Ga0105245_10186714 | 3300009098 | Bacteria | 1983 |
| 67 | Ga0114129_10607595 | 3300009147 | Bacteria | 1416 |
| 68 | Ga0105243_10043301 | 3300009148 | Bacteria | 3528 |
| 69 | Ga0105242_10033672 | 3300009176 | Bacteria | 4104 |
| 70 | Ga0105249_10031393 | 3300009553 | Bacteria | 4805 |
| 71 | Ga0105249_10383433 | 3300009553 | Bacteria | 1432 |
| 72 | Ga0123342_1000436 | 3300009766 | Bacteria | 65465 |
| 73 | Ga0099796_10039521 | 3300010159 | Bacteria | 1589 |
| 74 | Ga0099796_10075826 | 3300010159 | Viruses | 1223 |
| 75 | Ga0105239_10000050 | 3300010375 | Bacteria | 173908 |
| 76 | Ga0105239_10029647 | 3300010375 | Bacteria | 6016 |
| 77 | Ga0105239_10121548 | 3300010375 | Bacteria | 2900 |
| 78 | Ga0105246_10055508 | 3300011119 | Bacteria | 2734 |
| 79 | Ga0157378_10040436 | 3300013297 | Bacteria | 4134 |
| 80 | Ga0163162_10045641 | 3300013306 | Bacteria | 4389 |
| 81 | Ga0157379_10053622 | 3300014968 | Bacteria | 3602 |
| 82 | Ga0157379_10155844 | 3300014968 | Bacteria | 2061 |
| 83 | Ga0157376_10166419 | 3300014969 | Bacteria | 2004 |
| 84 | Ga0163161_10364805 | 3300017792 | Bacteria | 1151 |
| 85 | Ga0213872_10025320 | 3300021361 | Bacteria | 2728 |
| 86 | Ga0213875_10000779 | 3300021388 | Bacteria | 23793 |
| 87 | Ga0209566_100542 | 3300025225 | Bacteria | 25524 |
| 88 | Ga0209674_101176 | 3300025226 | Bacteria | 7551 |
| 89 | Ga0209674_101649 | 3300025226 | Bacteria | 5579 |
| 90 | Ga0209130_1000292 | 3300025284 | Bacteria | 60927 |
| 91 | Ga0207426_1000269 | 3300025302 | Bacteria | 109050 |
| 92 | Ga0207695_10000198 | 3300025913 | Bacteria | 167880 |
| 93 | Ga0207693_10001554 | 3300025915 | Bacteria | 20275 |
| 94 | Ga0207693_10045838 | 3300025915 | Bacteria | 3435 |
| 95 | Ga0207693_10125674 | 3300025915 | Bacteria | 2016 |
| 96 | Ga0207663_10257370 | 3300025916 | Bacteria | 1287 |
| 97 | Ga0207646_10386559 | 3300025922 | Bacteria | 1264 |
| 98 | Ga0207681_10048619 | 3300025923 | Bacteria | 2863 |
| 99 | Ga0207664_10459825 | 3300025929 | Bacteria | 1137 |
| 100 | Ga0207644_10178288 | 3300025931 | Bacteria | 1664 |
| 101 | Ga0207690_10178645 | 3300025932 | Bacteria | 1596 |
| 102 | Ga0207706_10009049 | 3300025933 | Bacteria | 9162 |
| 103 | Ga0207686_10026876 | 3300025934 | Bacteria | 3364 |
| 104 | Ga0207704_10285475 | 3300025938 | Bacteria | 1257 |
| 105 | Ga0207665_10030965 | 3300025939 | Bacteria | 3539 |
| 106 | Ga0207665_10269997 | 3300025939 | Bacteria | 1263 |
| 107 | Ga0207689_10014912 | 3300025942 | Bacteria | 6595 |
| 108 | Ga0207712_10014523 | 3300025961 | Bacteria | 5069 |
| 109 | Ga0207668_10018841 | 3300025972 | Bacteria | 4351 |
| 110 | Ga0207658_10024995 | 3300025986 | Bacteria | 4180 |
| 111 | Ga0207708_10190157 | 3300026075 | Bacteria | 1633 |
| 112 | Ga0207702_10054881 | 3300026078 | Bacteria | 3378 |
| 113 | Ga0207641_10413863 | 3300026088 | Bacteria | 1297 |
| 114 | Ga0207676_10241546 | 3300026095 | Bacteria | 1621 |
| 115 | Ga0207675_100024918 | 3300026118 | Bacteria | 5566 |
| 116 | Ga0209588_1000258 | 3300027671 | Bacteria | 14028 |
| 117 | Ga0209588_1011187 | 3300027671 | Bacteria | 2708 |
| 118 | Ga0268265_10006558 | 3300028380 | Bacteria | 7876 |
| 119 | Ga0268264_10000045 | 3300028381 | Bacteria | 364764 |
| 120 | Ga0268264_10029137 | 3300028381 | Bacteria | 4520 |
| 121 | Ga0307517_10003177 | 3300028786 | Bacteria | 25825 |
| 122 | Ga0307517_10057775 | 3300028786 | Bacteria | 3751 |
| 123 | Ga0307517_10118321 | 3300028786 | Bacteria | 1972 |
| 124 | Ga0307515_10002868 | 3300028794 | Bacteria | 36682 |
| 125 | Ga0307515_10003069 | 3300028794 | Bacteria | 35363 |
| 126 | Ga0265316_10179536 | 3300031344 | Bacteria | 1577 |
| 127 | Ga0307513_10055511 | 3300031456 | Bacteria | 4238 |
| 128 | Ga0307513_10242902 | 3300031456 | Bacteria | 1604 |
| 129 | Ga0307508_10000306 | 3300031616 | Bacteria | 59403 |
| 130 | Ga0307508_10073350 | 3300031616 | Bacteria | 2999 |
| 131 | Ga0307409_100368893 | 3300031995 | Bacteria | 1361 |
| 132 | Ga0307510_10000049 | 3300033180 | Bacteria | 91546 |
| 133 | Ga0307510_10070691 | 3300033180 | Bacteria | 3483 |
| 134 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 135 | Ga0373931_0035946 | 3300035691 | Bacteria | 2579 |
| 136 | Ga0436364_0683837 | 3300037853 | Bacteria | 3152 |
| 137 | Ga0436365_1860749 | 3300039437 | Bacteria | 3953 |
| 138 | Ga0436360_0489856 | 3300039438 | Bacteria | 1471 |
| 139 | Ga0436360_0657187 | 3300039438 | Bacteria | 1198 |
| 140 | Ga0436361_0276900 | 3300039447 | Unclassified | 1258 |
| 141 | Ga0436361_0617061 | 3300039447 | Bacteria | 27988 |
| 142 | Ga0436361_0983397 | 3300039447 | Bacteria | 1178 |
| 143 | Ga0436363_0374856 | 3300039450 | Bacteria | 1253 |
| 144 | Ga0495617_042748 | 3300046452 | Bacteria | 1514 |
| 145 | Ga0495590_0022509 | 3300046457 | Bacteria | 2229 |
| 146 | Ga0495629_0120699 | 3300046459 | Bacteria | 1826 |
| 147 | Ga0495638_0000095 | 3300046460 | Bacteria | 141825 |
| 148 | Ga0495638_0000946 | 3300046460 | Bacteria | 29439 |
| 149 | Ga0495651_0002683 | 3300046462 | Bacteria | 13807 |
| 150 | Ga0495650_0026109 | 3300046471 | Unclassified | 2723 |
| 151 | Ga0495650_0089491 | 3300046471 | Bacteria | 1173 |
| 152 | Ga0495580_0081045 | 3300046472 | Bacteria | 2262 |
| 153 | Ga0495580_0145571 | 3300046472 | Bacteria | 1642 |
| 154 | Ga0495605_0000707 | 3300046474 | Bacteria | 24719 |
| 155 | Ga0495605_0003220 | 3300046474 | Bacteria | 9792 |
| 156 | Ga0495584_0000153 | 3300046491 | Bacteria | 47948 |
| 157 | Ga0495584_0184931 | 3300046491 | Bacteria | 1059 |
| 158 | Ga0495585_0002087 | 3300046492 | Bacteria | 14622 |
| 159 | Ga0495585_0010680 | 3300046492 | Bacteria | 5454 |
| 160 | Ga0495585_0017642 | 3300046492 | Bacteria | 4122 |
| 161 | Ga0495607_0029878 | 3300046501 | Bacteria | 3352 |
| 162 | Ga0495607_0137090 | 3300046501 | Unclassified | 1266 |
| 163 | Ga0495583_0000057 | 3300046506 | Bacteria | 200688 |
| 164 | Ga0495583_0000991 | 3300046506 | Bacteria | 32505 |
| 165 | Ga0495583_0001800 | 3300046506 | Bacteria | 20280 |
| 166 | Ga0495583_0029840 | 3300046506 | Bacteria | 2664 |
| 167 | Ga0495606_0000154 | 3300046507 | Bacteria | 119458 |
| 168 | Ga0495606_0008833 | 3300046507 | Bacteria | 8639 |
| 169 | Ga0495606_0054524 | 3300046507 | Bacteria | 2589 |
| 170 | Ga0495616_0009742 | 3300046513 | Bacteria | 5598 |
| 171 | Ga0495616_0105239 | 3300046513 | Bacteria | 1318 |
| 172 | Ga0495620_0003141 | 3300046515 | Bacteria | 9480 |
| 173 | Ga0495620_0031786 | 3300046515 | Bacteria | 2413 |
| 174 | Ga0495631_0003533 | 3300046518 | Bacteria | 8543 |
| 175 | Ga0495631_0088894 | 3300046518 | Bacteria | 1330 |
| 176 | Ga0495632_0028176 | 3300046519 | Bacteria | 2933 |
| 177 | Ga0495632_0081348 | 3300046519 | Bacteria | 1544 |
| 178 | Ga0495637_0032908 | 3300046520 | Unclassified | 2281 |
| 179 | Ga0495643_0002453 | 3300046522 | Bacteria | 14677 |
| 180 | Ga0495643_0134226 | 3300046522 | Bacteria | 1240 |
| 181 | Ga0495644_0000266 | 3300046523 | Bacteria | 23929 |
| 182 | Ga0495644_0001300 | 3300046523 | Bacteria | 10244 |
| 183 | Ga0495648_0000104 | 3300046524 | Bacteria | 105792 |
| 184 | Ga0495648_0045847 | 3300046524 | Bacteria | 2716 |
| 185 | Ga0495666_0081859 | 3300046526 | Bacteria | 1527 |
| 186 | Ga0495654_0000097 | 3300046530 | Bacteria | 99414 |
| 187 | Ga0495665_0032125 | 3300046531 | Bacteria | 2807 |
| 188 | Ga0495640_0271083 | 3300046533 | Bacteria | 1058 |
| 189 | Ga0495609_0003027 | 3300046538 | Bacteria | 9906 |
| 190 | Ga0495609_0029722 | 3300046538 | Bacteria | 2487 |
| 191 | Ga0495597_0001460 | 3300046542 | Bacteria | 16933 |
| 192 | Ga0495622_0121573 | 3300046557 | Unclassified | 1192 |
| 193 | Ga0495656_0043247 | 3300046615 | Bacteria | 1890 |
| 194 | Ga0495668_0006305 | 3300046616 | Bacteria | 7809 |
| 195 | Ga0495611_0002793 | 3300046648 | Bacteria | 7811 |
| 196 | Ga0495625_0001932 | 3300046660 | Bacteria | 23427 |
| 197 | Ga0495625_0007154 | 3300046660 | Bacteria | 9796 |
| 198 | Ga0495625_0042379 | 3300046660 | Bacteria | 3308 |
| 199 | Ga0495625_0046092 | 3300046660 | Bacteria | 3147 |
| 200 | Ga0495625_0049683 | 3300046660 | Bacteria | 3014 |
| 201 | Ga0495625_0136494 | 3300046660 | Bacteria | 1658 |
| 202 | Ga0495659_0077799 | 3300046664 | Unclassified | 1253 |
| 203 | Ga0495661_0012165 | 3300046665 | Bacteria | 5812 |
| 204 | Ga0495646_0133739 | 3300046680 | Bacteria | 1394 |
| 205 | Ga0495624_0001325 | 3300046690 | Bacteria | 19384 |
| 206 | Ga0495670_0000961 | 3300046691 | Bacteria | 13949 |
| 207 | Ga0495670_0018109 | 3300046691 | Bacteria | 3469 |
| 208 | Ga0495670_0194491 | 3300046691 | Bacteria | 1073 |
| 209 | Ga0495671_0026515 | 3300046692 | Bacteria | 3004 |
| 210 | Ga0495649_0000027 | 3300046694 | Bacteria | 164157 |
| 211 | Ga0495649_0029582 | 3300046694 | Bacteria | 3029 |
| 212 | Ga0495660_0000089 | 3300046810 | Bacteria | 98880 |
| 213 | Ga0495660_0001928 | 3300046810 | Bacteria | 13530 |
| 214 | Ga0495660_0024666 | 3300046810 | Bacteria | 3425 |
| 215 | Ga0495581_0133910 | 3300047315 | Bacteria | 1444 |
| 216 | Ga0495636_0000166 | 3300047318 | Bacteria | 26515 |
| 217 | Ga0495674_0011440 | 3300047319 | Bacteria | 8374 |
| 218 | Ga0495672_0011239 | 3300047320 | Bacteria | 6328 |
| 219 | Ga0495676_0004476 | 3300047321 | Bacteria | 12775 |
| 220 | Ga0495676_0181936 | 3300047321 | Bacteria | 1472 |
| 221 | Ga0495683_0002609 | 3300047323 | Bacteria | 10815 |
| 222 | Ga0495683_0009786 | 3300047323 | Bacteria | 5097 |
| 223 | Ga0495687_000183 | 3300047443 | Bacteria | 91212 |
| 224 | Ga0495687_000362 | 3300047443 | Bacteria | 56701 |
| 225 | Ga0495687_001507 | 3300047443 | Bacteria | 21224 |
| 226 | Ga0495687_003845 | 3300047443 | Bacteria | 10569 |
| 227 | Ga0495677_0001461 | 3300047445 | Bacteria | 9470 |
| 228 | Ga0495684_0082134 | 3300047471 | Bacteria | 2445 |
| 229 | Ga0496101_0227266 | 3300048904 | Bacteria | 1450 |
| 230 | Ga0496103_0263755 | 3300048906 | Bacteria | 1108 |
| 231 | Ga0496104_0012601 | 3300048907 | Bacteria | 7609 |
| 232 | Ga0496106_0146742 | 3300048909 | Bacteria | 1859 |
| 233 | Ga0496107_0122887 | 3300048910 | Bacteria | 1913 |
| 234 | Ga0496109_0146470 | 3300048912 | Bacteria | 2210 |
| 235 | Ga0496111_0152425 | 3300048914 | Bacteria | 1715 |
| 236 | Ga0496112_0464972 | 3300048915 | Bacteria | 1202 |
| 237 | Ga0496115_0000137 | 3300048918 | Bacteria | 67049 |
| 238 | Ga0496119_0107220 | 3300048922 | Bacteria | 1558 |
| 239 | Ga0496122_0011610 | 3300048925 | Bacteria | 8892 |
| 240 | Ga0496123_0013990 | 3300048926 | Bacteria | 6682 |
| 241 | Ga0496126_0003185 | 3300048929 | Bacteria | 21093 |
| 242 | Ga0496126_0004460 | 3300048929 | Bacteria | 16727 |
| 243 | Ga0495678_002358 | 3300049459 | Bacteria | 12968 |
| 244 | Ga0495678_026097 | 3300049459 | Bacteria | 2500 |
| 245 | Ga0495682_0035101 | 3300049460 | Bacteria | 1847 |
| 246 | nmdc:mga0k408_106023_c1 | 3300050493 | Bacteria | 1660 |
| 247 | nmdc:mga06z11_92312_c1 | 3300050494 | Bacteria | 1646 |
| 248 | nmdc:mga05p37_103424_c1 | 3300050507 | Bacteria | 3506 |
| 249 | nmdc:mga05p37_663640_c1 | 3300050507 | Bacteria | 1165 |
| 250 | nmdc:mga0qj67_103114_c1 | 3300050509 | Bacteria | 2301 |
| 251 | nmdc:mga06r32_180944_c1 | 3300050510 | Bacteria | 2094 |
| 252 | nmdc:mga08y16_60900_c1 | 3300050511 | Bacteria | 3941 |
| 253 | nmdc:mga0n895_359883_c1 | 3300050512 | Bacteria | 1473 |
| 254 | nmdc:mga0rr50_104214_c1 | 3300050513 | Bacteria | 2234 |
| 255 | nmdc:mga0rr50_190276_c1 | 3300050513 | Bacteria | 1681 |
| 256 | nmdc:mga08x19_242008_c1 | 3300050514 | Bacteria | 1244 |
| 257 | nmdc:mga0a205_105750_c1 | 3300050515 | Bacteria | 2713 |
| 258 | Ga0500583_0003498 | 3300053092 | Bacteria | 4946 |
| 259 | Ga0500651_0017378 | 3300053093 | Bacteria | 4436 |
| 260 | Ga0500594_0003331 | 3300053118 | Bacteria | 3519 |
| 261 | Ga0500618_000373 | 3300053125 | Bacteria | 30954 |
| 262 | Ga0500642_0028198 | 3300053130 | Bacteria | 2313 |
| 263 | Ga0500658_0016063 | 3300053134 | Bacteria | 2787 |
| 264 | Ga0500588_0053010 | 3300053146 | Bacteria | 1272 |
| 265 | Ga0500616_0034738 | 3300053153 | Bacteria | 2745 |
| 266 | Ga0500622_0000186 | 3300053156 | Bacteria | 66006 |
| 267 | Ga0500622_0058408 | 3300053156 | Bacteria | 1971 |
| 268 | Ga0500609_006231 | 3300053731 | Bacteria | 1626 |
| 269 | Ga0500599_003172 | 3300053736 | Bacteria | 1998 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048915 | Ga0496112_0464972 | Ga0496112_0464972_14_871 | 263 |
| 2 | 3300039438 | Ga0436360_0657187 | Ga0436360_0657187_28_825 | 265 |
| 3 | 3300046531 | Ga0495665_0032125 | Ga0495665_0032125_1990_2790 | 266 |
| 4 | 3300046533 | Ga0495640_0271083 | Ga0495640_0271083_236_1036 | 266 |
| 5 | 3300046491 | Ga0495584_0000153 | Ga0495584_0000153_31315_32247 | 267 |
| 6 | 3300046665 | Ga0495661_0012165 | Ga0495661_0012165_4102_5034 | 267 |
| 7 | 3300005437 | Ga0070710_10107919 | Ga0070710_101079192 | 274 |
| 8 | 3300046471 | Ga0495650_0089491 | Ga0495650_0089491_253_1095 | 280 |
| 9 | 3300046491 | Ga0495584_0184931 | Ga0495584_0184931_36_881 | 281 |
| 10 | 3300039438 | Ga0436360_0489856 | Ga0436360_0489856_298_1239 | 285 |
| 11 | 3300027671 | Ga0209588_1011187 | Ga0209588_10111872 | 286 |
| 12 | 3300031616 | Ga0307508_10073350 | Ga0307508_100733502 | 291 |
| 13 | 3300025226 | Ga0209674_101176 | Ga0209674_1011761 | 293 |
| 14 | 3300046471 | Ga0495650_0026109 | Ga0495650_0026109_1459_2400 | 297 |
| 15 | 3300046660 | Ga0495625_0136494 | Ga0495625_0136494_457_1398 | 299 |
| 16 | 3300046522 | Ga0495643_0134226 | Ga0495643_0134226_58_993 | 301 |
| 17 | 3300046507 | Ga0495606_0054524 | Ga0495606_0054524_947_1858 | 303 |
| 18 | 3300010159 | Ga0099796_10075826 | Ga0099796_100758261 | 305 |
| 19 | 3300021388 | Ga0213875_10000779 | Ga0213875_1000077918 | 307 |
| 20 | 3300046513 | Ga0495616_0105239 | Ga0495616_0105239_11_952 | 307 |
| 21 | 3300046518 | Ga0495631_0088894 | Ga0495631_0088894_126_1097 | 307 |
| 22 | 3300046520 | Ga0495637_0032908 | Ga0495637_0032908_774_1715 | 307 |
| 23 | 3300046530 | Ga0495654_0000097 | Ga0495654_0000097_28499_29440 | 307 |
| 24 | 3300046692 | Ga0495671_0026515 | Ga0495671_0026515_1665_2606 | 307 |
| 25 | 3300046694 | Ga0495649_0000027 | Ga0495649_0000027_9661_10602 | 307 |
| 26 | 3300046810 | Ga0495660_0000089 | Ga0495660_0000089_69327_70268 | 307 |
| 27 | 3300047321 | Ga0495676_0004476 | Ga0495676_0004476_428_1369 | 307 |
| 28 | 3300047321 | Ga0495676_0181936 | Ga0495676_0181936_104_1045 | 307 |
| 29 | 3300048907 | Ga0496104_0012601 | Ga0496104_0012601_5974_6954 | 307 |
| 30 | 3300053125 | Ga0500618_000373 | Ga0500618_000373_11018_11959 | 307 |
| 31 | iso_pu_bacteria | 2599185239 | 2599740395 | 307 |
| 32 | iso_pu_bacteria | 2599185239 | 2599741019 | 307 |
| 33 | iso_pu_bacteria | 8021120328 | 8021123173 | 307 |
| 34 | iso_pu_bacteria | 8021120328 | 8021123182 | 307 |
| 35 | 3300031616 | Ga0307508_10000306 | Ga0307508_1000030646 | 308 |
| 36 | iso_pu_bacteria | 2510917028 | 2511183288 | 309 |
| 37 | 3300005841 | Ga0068863_100441593 | Ga0068863_1004415932 | 310 |
| 38 | 3300026088 | Ga0207641_10413863 | Ga0207641_104138631 | 310 |
| 39 | 3300028786 | Ga0307517_10057775 | Ga0307517_100577752 | 310 |
| 40 | 3300028786 | Ga0307517_10118321 | Ga0307517_101183212 | 310 |
| 41 | 3300046462 | Ga0495651_0002683 | Ga0495651_0002683_5402_6334 | 310 |
| 42 | 3300046474 | Ga0495605_0000707 | Ga0495605_0000707_23494_24426 | 310 |
| 43 | 3300046492 | Ga0495585_0002087 | Ga0495585_0002087_3097_4029 | 310 |
| 44 | 3300046492 | Ga0495585_0010680 | Ga0495585_0010680_241_1173 | 310 |
| 45 | 3300046501 | Ga0495607_0029878 | Ga0495607_0029878_1849_2781 | 310 |
| 46 | 3300046501 | Ga0495607_0137090 | Ga0495607_0137090_312_1244 | 310 |
| 47 | 3300046506 | Ga0495583_0000057 | Ga0495583_0000057_65493_66425 | 310 |
| 48 | 3300046507 | Ga0495606_0008833 | Ga0495606_0008833_4698_5630 | 310 |
| 49 | 3300046513 | Ga0495616_0009742 | Ga0495616_0009742_306_1238 | 310 |
| 50 | 3300046523 | Ga0495644_0000266 | Ga0495644_0000266_6815_7747 | 310 |
| 51 | 3300046523 | Ga0495644_0001300 | Ga0495644_0001300_1906_2838 | 310 |
| 52 | 3300046524 | Ga0495648_0000104 | Ga0495648_0000104_37616_38548 | 310 |
| 53 | 3300046538 | Ga0495609_0003027 | Ga0495609_0003027_6833_7765 | 310 |
| 54 | 3300046557 | Ga0495622_0121573 | Ga0495622_0121573_137_1069 | 310 |
| 55 | 3300046615 | Ga0495656_0043247 | Ga0495656_0043247_637_1569 | 310 |
| 56 | 3300046648 | Ga0495611_0002793 | Ga0495611_0002793_1818_2750 | 310 |
| 57 | 3300046664 | Ga0495659_0077799 | Ga0495659_0077799_105_1037 | 310 |
| 58 | 3300046691 | Ga0495670_0000961 | Ga0495670_0000961_7255_8187 | 310 |
| 59 | 3300047318 | Ga0495636_0000166 | Ga0495636_0000166_25027_25959 | 310 |
| 60 | 3300047320 | Ga0495672_0011239 | Ga0495672_0011239_3901_4833 | 310 |
| 61 | 3300047323 | Ga0495683_0002609 | Ga0495683_0002609_2292_3224 | 310 |
| 62 | 3300047443 | Ga0495687_000362 | Ga0495687_000362_32119_33051 | 310 |
| 63 | 3300047445 | Ga0495677_0001461 | Ga0495677_0001461_947_1879 | 310 |
| 64 | 3300049459 | Ga0495678_002358 | Ga0495678_002358_4885_5817 | 310 |
| 65 | 3300049460 | Ga0495682_0035101 | Ga0495682_0035101_582_1514 | 310 |
| 66 | 3300005355 | Ga0070671_100147698 | Ga0070671_1001476982 | 311 |
| 67 | 3300005548 | Ga0070665_100218669 | Ga0070665_1002186692 | 311 |
| 68 | 3300009093 | Ga0105240_10000162 | Ga0105240_1000016236 | 311 |
| 69 | 3300009553 | Ga0105249_10383433 | Ga0105249_103834332 | 311 |
| 70 | 3300010375 | Ga0105239_10000050 | Ga0105239_1000005065 | 311 |
| 71 | 3300010375 | Ga0105239_10121548 | Ga0105239_101215483 | 311 |
| 72 | 3300011119 | Ga0105246_10055508 | Ga0105246_100555081 | 311 |
| 73 | 3300013297 | Ga0157378_10040436 | Ga0157378_100404363 | 311 |
| 74 | 3300014968 | Ga0157379_10053622 | Ga0157379_100536224 | 311 |
| 75 | 3300014969 | Ga0157376_10166419 | Ga0157376_101664192 | 311 |
| 76 | 3300025225 | Ga0209566_100542 | Ga0209566_10054225 | 311 |
| 77 | 3300025226 | Ga0209674_101649 | Ga0209674_1016494 | 311 |
| 78 | 3300025913 | Ga0207695_10000198 | Ga0207695_1000019857 | 311 |
| 79 | 3300025916 | Ga0207663_10257370 | Ga0207663_102573702 | 311 |
| 80 | 3300025931 | Ga0207644_10178288 | Ga0207644_101782882 | 311 |
| 81 | 3300026095 | Ga0207676_10241546 | Ga0207676_102415462 | 311 |
| 82 | 3300031456 | Ga0307513_10242902 | Ga0307513_102429021 | 311 |
| 83 | 3300035691 | Ga0373931_0035946 | Ga0373931_0035946_864_1865 | 311 |
| 84 | 3300046542 | Ga0495597_0001460 | Ga0495597_0001460_2576_3523 | 311 |
| 85 | 3300046810 | Ga0495660_0001928 | Ga0495660_0001928_8741_9688 | 311 |
| 86 | 3300047443 | Ga0495687_003845 | Ga0495687_003845_1587_2522 | 311 |
| 87 | 3300048906 | Ga0496103_0263755 | Ga0496103_0263755_14_1015 | 311 |
| 88 | 3300048912 | Ga0496109_0146470 | Ga0496109_0146470_792_1793 | 311 |
| 89 | 3300048914 | Ga0496111_0152425 | Ga0496111_0152425_34_1035 | 311 |
| 90 | 3300048925 | Ga0496122_0011610 | Ga0496122_0011610_4849_5784 | 311 |
| 91 | 3300048926 | Ga0496123_0013990 | Ga0496123_0013990_3110_4045 | 311 |
| 92 | 3300050513 | nmdc:mga0rr50_190276_c1 | nmdc:mga0rr50_190276_c1_245_1246 | 311 |
| 93 | 3300025939 | Ga0207665_10269997 | Ga0207665_102699972 | 312 |
| 94 | 3300028794 | Ga0307515_10002868 | Ga0307515_100028684 | 312 |
| 95 | 3300046691 | Ga0495670_0018109 | Ga0495670_0018109_2205_3143 | 312 |
| 96 | iso_pu_bacteria | 2582581867 | 2585399335 | 312 |
| 97 | iso_pu_bacteria | 8046767195 | 8046767892 | 312 |
| 98 | 3300006186 | Ga0075369_10018163 | Ga0075369_100181632 | 313 |
| 99 | 3300009766 | Ga0123342_1000436 | Ga0123342_100043644 | 313 |
| 100 | 3300033180 | Ga0307510_10000049 | Ga0307510_1000004951 | 313 |
| 101 | 3300046460 | Ga0495638_0000095 | Ga0495638_0000095_37545_38486 | 313 |
| 102 | 3300046507 | Ga0495606_0000154 | Ga0495606_0000154_46341_47282 | 313 |
| 103 | 3300046660 | Ga0495625_0049683 | Ga0495625_0049683_391_1332 | 313 |
| 104 | 3300048918 | Ga0496115_0000137 | Ga0496115_0000137_24100_25041 | 313 |
| 105 | 3300048929 | Ga0496126_0003185 | Ga0496126_0003185_1336_2277 | 313 |
| 106 | iso_pu_bacteria | 2582581315 | 2585324490 | 313 |
| 107 | 3300046452 | Ga0495617_042748 | Ga0495617_042748_77_1021 | 314 |
| 108 | 3300046460 | Ga0495638_0000946 | Ga0495638_0000946_2792_3736 | 314 |
| 109 | 3300046474 | Ga0495605_0003220 | Ga0495605_0003220_4700_5644 | 314 |
| 110 | 3300046492 | Ga0495585_0017642 | Ga0495585_0017642_1266_2210 | 314 |
| 111 | 3300046506 | Ga0495583_0029840 | Ga0495583_0029840_635_1579 | 314 |
| 112 | 3300046518 | Ga0495631_0003533 | Ga0495631_0003533_3593_4537 | 314 |
| 113 | 3300046519 | Ga0495632_0028176 | Ga0495632_0028176_1317_2261 | 314 |
| 114 | 3300046524 | Ga0495648_0045847 | Ga0495648_0045847_121_1065 | 314 |
| 115 | 3300046538 | Ga0495609_0029722 | Ga0495609_0029722_212_1156 | 314 |
| 116 | 3300046616 | Ga0495668_0006305 | Ga0495668_0006305_2898_3842 | 314 |
| 117 | 3300046660 | Ga0495625_0007154 | Ga0495625_0007154_3673_4617 | 314 |
| 118 | 3300049459 | Ga0495678_026097 | Ga0495678_026097_968_1912 | 314 |
| 119 | 3300053118 | Ga0500594_0003331 | Ga0500594_0003331_2009_2953 | 314 |
| 120 | 3300053146 | Ga0500588_0053010 | Ga0500588_0053010_177_1121 | 314 |
| 121 | 3300053736 | Ga0500599_003172 | Ga0500599_003172_365_1309 | 314 |
| 122 | iso_pu_bacteria | 2824661429 | 2824663968 | 314 |
| 123 | 3300002987 | JGI25159J45721_1000266 | JGI25159J45721_100026614 | 316 |
| 124 | 3300003354 | JGI25160J50197_1000271 | JGI25160J50197_100027121 | 316 |
| 125 | 3300003374 | JGI25161J50226_1000208 | JGI25161J50226_100020813 | 316 |
| 126 | 3300004625 | Ga0055543_1000274 | Ga0055543_100027421 | 316 |
| 127 | 3300005262 | Ga0065165_1001956 | Ga0065165_100195614 | 316 |
| 128 | 3300005435 | Ga0070714_100465162 | Ga0070714_1004651621 | 316 |
| 129 | 3300005445 | Ga0070708_100000445 | Ga0070708_10000044522 | 316 |
| 130 | 3300005445 | Ga0070708_100011218 | Ga0070708_1000112186 | 316 |
| 131 | 3300005518 | Ga0070699_100167498 | Ga0070699_1001674981 | 316 |
| 132 | 3300005614 | Ga0068856_100013405 | Ga0068856_1000134058 | 316 |
| 133 | 3300006871 | Ga0075434_100097446 | Ga0075434_1000974462 | 316 |
| 134 | 3300007788 | Ga0099795_10029370 | Ga0099795_100293702 | 316 |
| 135 | 3300009098 | Ga0105245_10186714 | Ga0105245_101867142 | 316 |
| 136 | 3300025284 | Ga0209130_1000292 | Ga0209130_100029213 | 316 |
| 137 | 3300025302 | Ga0207426_1000269 | Ga0207426_100026955 | 316 |
| 138 | 3300026078 | Ga0207702_10054881 | Ga0207702_100548815 | 316 |
| 139 | 3300028794 | Ga0307515_10003069 | Ga0307515_1000306917 | 316 |
| 140 | 3300037853 | Ga0436364_0683837 | Ga0436364_0683837_2047_2997 | 316 |
| 141 | 3300039447 | Ga0436361_0276900 | Ga0436361_0276900_182_1132 | 316 |
| 142 | 3300039450 | Ga0436363_0374856 | Ga0436363_0374856_46_996 | 316 |
| 143 | 3300046506 | Ga0495583_0000991 | Ga0495583_0000991_9915_10865 | 316 |
| 144 | 3300046515 | Ga0495620_0031786 | Ga0495620_0031786_932_1882 | 316 |
| 145 | 3300046526 | Ga0495666_0081859 | Ga0495666_0081859_111_1064 | 316 |
| 146 | 3300046660 | Ga0495625_0001932 | Ga0495625_0001932_8766_9716 | 316 |
| 147 | 3300046680 | Ga0495646_0133739 | Ga0495646_0133739_21_974 | 316 |
| 148 | 3300046690 | Ga0495624_0001325 | Ga0495624_0001325_16784_17737 | 316 |
| 149 | 3300047315 | Ga0495581_0133910 | Ga0495581_0133910_119_1072 | 316 |
| 150 | 3300047319 | Ga0495674_0011440 | Ga0495674_0011440_2952_3905 | 316 |
| 151 | 3300047443 | Ga0495687_000183 | Ga0495687_000183_4006_4956 | 316 |
| 152 | 3300047471 | Ga0495684_0082134 | Ga0495684_0082134_369_1322 | 316 |
| 153 | 3300048922 | Ga0496119_0107220 | Ga0496119_0107220_568_1524 | 316 |
| 154 | 3300050507 | nmdc:mga05p37_103424_c1 | nmdc:mga05p37_103424_c1_1860_2927 | 316 |
| 155 | 3300053156 | Ga0500622_0000186 | Ga0500622_0000186_5571_6521 | 316 |
| 156 | iso_pu_bacteria | 2582581867 | 2585404144 | 316 |
| 157 | iso_pu_bacteria | 2585427590 | 2585820691 | 316 |
| 158 | 3300028381 | Ga0268264_10029137 | Ga0268264_100291374 | 317 |
| 159 | 3300046660 | Ga0495625_0046092 | Ga0495625_0046092_1435_2388 | 317 |
| 160 | 3300046691 | Ga0495670_0194491 | Ga0495670_0194491_85_1038 | 317 |
| 161 | 3300007265 | Ga0099794_10000728 | Ga0099794_100007286 | 318 |
| 162 | 3300027671 | Ga0209588_1000258 | Ga0209588_100025810 | 318 |
| 163 | 3300033442 | Ga0315911_1000006 | Ga0315911_1000006149 | 318 |
| 164 | 3300005983 | Ga0081540_1008879 | Ga0081540_10088797 | 319 |
| 165 | 3300021361 | Ga0213872_10025320 | Ga0213872_100253202 | 319 |
| 166 | 3300039447 | Ga0436361_0617061 | Ga0436361_0617061_20169_21128 | 319 |
| 167 | 3300028786 | Ga0307517_10003177 | Ga0307517_1000317714 | 320 |
| 168 | 3300031995 | Ga0307409_100368893 | Ga0307409_1003688932 | 320 |
| 169 | 3300046457 | Ga0495590_0022509 | Ga0495590_0022509_1118_2080 | 320 |
| 170 | 3300046506 | Ga0495583_0001800 | Ga0495583_0001800_7166_8128 | 320 |
| 171 | 3300046515 | Ga0495620_0003141 | Ga0495620_0003141_4022_4984 | 320 |
| 172 | 3300046519 | Ga0495632_0081348 | Ga0495632_0081348_473_1435 | 320 |
| 173 | 3300046522 | Ga0495643_0002453 | Ga0495643_0002453_235_1197 | 320 |
| 174 | 3300046660 | Ga0495625_0042379 | Ga0495625_0042379_1954_2916 | 320 |
| 175 | 3300046694 | Ga0495649_0029582 | Ga0495649_0029582_277_1239 | 320 |
| 176 | 3300046810 | Ga0495660_0024666 | Ga0495660_0024666_812_1774 | 320 |
| 177 | 3300047323 | Ga0495683_0009786 | Ga0495683_0009786_3471_4433 | 320 |
| 178 | 3300047443 | Ga0495687_001507 | Ga0495687_001507_20191_21153 | 320 |
| 179 | iso_pu_bacteria | 2517093001 | 2517104970 | 320 |
| 180 | 3300003203 | JGI25406J46586_10000692 | JGI25406J46586_1000069210 | 321 |
| 181 | 3300005983 | Ga0081540_1011587 | Ga0081540_10115873 | 321 |
| 182 | iso_pu_bacteria | 2894652903 | 2894653587 | 321 |
| 183 | iso_pu_bacteria | 2903748898 | 2903755464 | 321 |
| 184 | 3300006852 | Ga0075433_10082424 | Ga0075433_100824243 | 322 |
| 185 | 3300006871 | Ga0075434_100352543 | Ga0075434_1003525432 | 322 |
| 186 | 3300007076 | Ga0075435_100118422 | Ga0075435_1001184222 | 322 |
| 187 | 3300039447 | Ga0436361_0983397 | Ga0436361_0983397_143_1111 | 322 |
| 188 | 3300050511 | nmdc:mga08y16_60900_c1 | nmdc:mga08y16_60900_c1_2189_3157 | 322 |
| 189 | 3300050513 | nmdc:mga0rr50_104214_c1 | nmdc:mga0rr50_104214_c1_800_1768 | 322 |
| 190 | 3300050515 | nmdc:mga0a205_105750_c1 | nmdc:mga0a205_105750_c1_434_1402 | 322 |
| 191 | iso_pu_bacteria | 2874168670 | 2874174283 | 322 |
| 192 | 3300003659 | JGI25404J52841_10000704 | JGI25404J52841_100007043 | 323 |
| 193 | 3300005983 | Ga0081540_1001429 | Ga0081540_100142919 | 323 |
| 194 | 3300046459 | Ga0495629_0120699 | Ga0495629_0120699_378_1349 | 323 |
| 195 | iso_pu_bacteria | 2847930680 | 2847938945 | 323 |
| 196 | 3300003323 | rootH1_10076708 | rootH1_100767084 | 324 |
| 197 | 3300005467 | Ga0070706_100153996 | Ga0070706_1001539962 | 324 |
| 198 | 3300005471 | Ga0070698_100198940 | Ga0070698_1001989402 | 324 |
| 199 | 3300006178 | Ga0075367_10049638 | Ga0075367_100496382 | 324 |
| 200 | 3300006195 | Ga0075366_10080263 | Ga0075366_100802632 | 324 |
| 201 | 3300007265 | Ga0099794_10058051 | Ga0099794_100580512 | 324 |
| 202 | 3300025922 | Ga0207646_10386559 | Ga0207646_103865591 | 324 |
| 203 | 3300046472 | Ga0495580_0081045 | Ga0495580_0081045_47_1021 | 324 |
| 204 | 3300050493 | nmdc:mga0k408_106023_c1 | nmdc:mga0k408_106023_c1_530_1504 | 324 |
| 205 | 3300050494 | nmdc:mga06z11_92312_c1 | nmdc:mga06z11_92312_c1_523_1497 | 324 |
| 206 | 3300007788 | Ga0099795_10046619 | Ga0099795_100466192 | 325 |
| 207 | 3300010159 | Ga0099796_10039521 | Ga0099796_100395212 | 325 |
| 208 | 3300031456 | Ga0307513_10055511 | Ga0307513_100555114 | 325 |
| 209 | 3300046472 | Ga0495580_0145571 | Ga0495580_0145571_622_1614 | 325 |
| 210 | 3300053134 | Ga0500658_0016063 | Ga0500658_0016063_1788_2765 | 325 |
| 211 | 3300003203 | JGI25406J46586_10056825 | JGI25406J46586_100568251 | 326 |
| 212 | 3300005435 | Ga0070714_100315742 | Ga0070714_1003157421 | 326 |
| 213 | 3300005983 | Ga0081540_1000288 | Ga0081540_100028826 | 326 |
| 214 | 3300005985 | Ga0081539_10013201 | Ga0081539_100132012 | 326 |
| 215 | 3300006173 | Ga0070716_100006790 | Ga0070716_1000067902 | 326 |
| 216 | 3300006175 | Ga0070712_100010194 | Ga0070712_1000101943 | 326 |
| 217 | 3300006844 | Ga0075428_100090743 | Ga0075428_1000907432 | 326 |
| 218 | 3300006846 | Ga0075430_100013449 | Ga0075430_1000134495 | 326 |
| 219 | 3300006847 | Ga0075431_100024750 | Ga0075431_1000247505 | 326 |
| 220 | 3300007788 | Ga0099795_10113333 | Ga0099795_101133331 | 326 |
| 221 | 3300017792 | Ga0163161_10364805 | Ga0163161_103648052 | 326 |
| 222 | 3300025915 | Ga0207693_10001554 | Ga0207693_1000155418 | 326 |
| 223 | 3300025915 | Ga0207693_10045838 | Ga0207693_100458384 | 326 |
| 224 | 3300025929 | Ga0207664_10459825 | Ga0207664_104598252 | 326 |
| 225 | 3300025939 | Ga0207665_10030965 | Ga0207665_100309653 | 326 |
| 226 | 3300031344 | Ga0265316_10179536 | Ga0265316_101795362 | 326 |
| 227 | 3300033180 | Ga0307510_10070691 | Ga0307510_100706912 | 326 |
| 228 | 3300048904 | Ga0496101_0227266 | Ga0496101_0227266_57_1037 | 326 |
| 229 | 3300048910 | Ga0496107_0122887 | Ga0496107_0122887_31_1011 | 326 |
| 230 | 3300050509 | nmdc:mga0qj67_103114_c1 | nmdc:mga0qj67_103114_c1_1153_2133 | 326 |
| 231 | 3300050510 | nmdc:mga06r32_180944_c1 | nmdc:mga06r32_180944_c1_980_1960 | 326 |
| 232 | 3300050512 | nmdc:mga0n895_359883_c1 | nmdc:mga0n895_359883_c1_270_1250 | 326 |
| 233 | 3300050514 | nmdc:mga08x19_242008_c1 | nmdc:mga08x19_242008_c1_196_1176 | 326 |
| 234 | 3300053092 | Ga0500583_0003498 | Ga0500583_0003498_2577_3557 | 326 |
| 235 | 3300053153 | Ga0500616_0034738 | Ga0500616_0034738_237_1217 | 326 |
| 236 | 3300053156 | Ga0500622_0058408 | Ga0500622_0058408_295_1275 | 326 |
| 237 | iso_pu_bacteria | 2617270735 | 2617351598 | 326 |
| 238 | 3300005983 | Ga0081540_1000136 | Ga0081540_10001364 | 328 |
| 239 | 3300053093 | Ga0500651_0017378 | Ga0500651_0017378_3406_4392 | 328 |
| 240 | 3300053130 | Ga0500642_0028198 | Ga0500642_0028198_915_1901 | 328 |
| 241 | 3300053731 | Ga0500609_006231 | Ga0500609_006231_183_1169 | 328 |
| 242 | 3300005983 | Ga0081540_1000791 | Ga0081540_10007915 | 329 |
| 243 | 3300007788 | Ga0099795_10092283 | Ga0099795_100922832 | 329 |
| 244 | 3300009147 | Ga0114129_10607595 | Ga0114129_106075952 | 329 |
| 245 | 3300025915 | Ga0207693_10125674 | Ga0207693_101256742 | 329 |
| 246 | 3300050507 | nmdc:mga05p37_663640_c1 | nmdc:mga05p37_663640_c1_116_1105 | 329 |
| 247 | 3300005843 | Ga0068860_100000173 | Ga0068860_10000017361 | 330 |
| 248 | 3300028381 | Ga0268264_10000045 | Ga0268264_1000004554 | 330 |
| 249 | 3300048909 | Ga0496106_0146742 | Ga0496106_0146742_119_1165 | 330 |
| 250 | 3300005290 | Ga0065712_10121426 | Ga0065712_101214262 | 336 |
| 251 | 3300025932 | Ga0207690_10178645 | Ga0207690_101786451 | 336 |
| 252 | 3300003203 | JGI25406J46586_10000172 | JGI25406J46586_100001728 | 339 |
| 253 | 3300005985 | Ga0081539_10000003 | Ga0081539_10000003451 | 339 |
| 254 | 3300002070 | JGI24750J21931_1002756 | JGI24750J21931_10027562 | 340 |
| 255 | 3300005295 | Ga0065707_10110066 | Ga0065707_101100662 | 340 |
| 256 | 3300005334 | Ga0068869_100016816 | Ga0068869_1000168162 | 340 |
| 257 | 3300005334 | Ga0068869_100319450 | Ga0068869_1003194502 | 340 |
| 258 | 3300005347 | Ga0070668_100074866 | Ga0070668_1000748661 | 340 |
| 259 | 3300005353 | Ga0070669_100162701 | Ga0070669_1001627012 | 340 |
| 260 | 3300005441 | Ga0070700_100166149 | Ga0070700_1001661492 | 340 |
| 261 | 3300005457 | Ga0070662_100008591 | Ga0070662_1000085914 | 340 |
| 262 | 3300005545 | Ga0070695_100110165 | Ga0070695_1001101651 | 340 |
| 263 | 3300005549 | Ga0070704_100152454 | Ga0070704_1001524542 | 340 |
| 264 | 3300005843 | Ga0068860_100017077 | Ga0068860_1000170776 | 340 |
| 265 | 3300005844 | Ga0068862_100071373 | Ga0068862_1000713733 | 340 |
| 266 | 3300005983 | Ga0081540_1007009 | Ga0081540_10070093 | 340 |
| 267 | 3300006881 | Ga0068865_100211069 | Ga0068865_1002110692 | 340 |
| 268 | 3300009148 | Ga0105243_10043301 | Ga0105243_100433013 | 340 |
| 269 | 3300009176 | Ga0105242_10033672 | Ga0105242_100336725 | 340 |
| 270 | 3300009553 | Ga0105249_10031393 | Ga0105249_100313935 | 340 |
| 271 | 3300010375 | Ga0105239_10029647 | Ga0105239_100296472 | 340 |
| 272 | 3300013306 | Ga0163162_10045641 | Ga0163162_100456414 | 340 |
| 273 | 3300014968 | Ga0157379_10155844 | Ga0157379_101558442 | 340 |
| 274 | 3300025923 | Ga0207681_10048619 | Ga0207681_100486192 | 340 |
| 275 | 3300025933 | Ga0207706_10009049 | Ga0207706_100090494 | 340 |
| 276 | 3300025934 | Ga0207686_10026876 | Ga0207686_100268763 | 340 |
| 277 | 3300025938 | Ga0207704_10285475 | Ga0207704_102854752 | 340 |
| 278 | 3300025942 | Ga0207689_10014912 | Ga0207689_100149126 | 340 |
| 279 | 3300025961 | Ga0207712_10014523 | Ga0207712_100145233 | 340 |
| 280 | 3300025972 | Ga0207668_10018841 | Ga0207668_100188412 | 340 |
| 281 | 3300025986 | Ga0207658_10024995 | Ga0207658_100249952 | 340 |
| 282 | 3300026075 | Ga0207708_10190157 | Ga0207708_101901572 | 340 |
| 283 | 3300026118 | Ga0207675_100024918 | Ga0207675_1000249182 | 340 |
| 284 | 3300028380 | Ga0268265_10006558 | Ga0268265_100065586 | 340 |
| 285 | 3300039437 | Ga0436365_1860749 | Ga0436365_1860749_1493_2524 | 340 |
| 286 | 3300048929 | Ga0496126_0004460 | Ga0496126_0004460_5649_6671 | 340 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4j31-assembly1.cif.gz_A | crystal structure of kynurenine 3-monooxygenase (kmo-396prot) | 0.9856 | 8 | 38 |
| 4j36-assembly1.cif.gz_A | cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) | 0.9842 | 9 | 41 |
| 4j36-assembly2.cif.gz_B | cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) | 0.9836 | 8 | 41 |
| 4j34-assembly1.cif.gz_A | crystal structure of kynurenine 3-monooxygenase - truncated at position 394 plus his tag cleaved. | 0.982 | 8 | 41 |
| 4x4j-assembly1.cif.gz_B-2 | structural and functional studies of bexe: insights into oxidation during be-7585a biosynthesis | 0.9813 | 10 | 40 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4j36B00 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9836 | 8 | 41 | 3.50.50.60 |
| af_Q5VQP1_29_415_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9783 | 10 | 40 | 3.50.50.60 |
| af_Q46904_1_359_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9696 | 9 | 39 | 3.50.50.60 |
| af_Q9C1W3_1_361_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9621 | 10 | 39 | 3.50.50.60 |
| af_Q8WSW2_5_214_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9606 | 9 | 40 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P8IU87-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase | 0.9916 | 1 | 311 |
GO:0006631
GO:0009056 GO:0016616 GO:0070403 |
| AF-I3CLF8-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase | 0.9913 | 11 | 311 |
GO:0006631
GO:0009056 GO:0016616 GO:0070403 |
| AF-A0A1Q7VQ31-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase | 0.9896 | 5 | 257 |
GO:0006631
GO:0009056 GO:0016616 GO:0070403 |
| AF-A0A537PMH4-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase | 0.9864 | 1 | 229 |
GO:0006631
GO:0009056 GO:0016616 GO:0070403 |
| AF-A0A4P8IU87-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase | 0.9853 | 1 | 311 |
GO:0006631
GO:0009056 GO:0016616 GO:0070403 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar