F387690

General Info

Members Datasets Scaffolds Average Seq Length
286 204 269 318

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_103424_c1|nmdc:mga05p37_103424_c1_1860_2927
Length 355
Sequence VRRRERLARLSGEKGTGMAGAPRPVATTHTGEDMPSNSSTSQKPIRRIAIVGTGVIGASWAAYYLSRGFDVVATDPAPNAEPNLRKYVDEAWSALAKAGLVVAGASRDRLSFTPNMGRALAEADFVQENAPERPEFKIKLFADMDEAAPPNAILASSSSGIPMDVIQTGAKRPERCVIGHPFNPPHIVPLVEVVGGAKTSEAVIERAMSFYASIGKKPIRLHKSLPGHAANRLQAALYKEMLSLIQRGVLSVSDADIAVSYGPGLRWGVMGQSLQWHLGGGAGGIHHFMEHLMPPLEGMMKDLQMPDVTPALKQTIIEGVAKEASGHSVDQLAQDENEIILGALALRQSAGRTIP

Samples

Sample ID Description Type Environment
1 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
2 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
3 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
4 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
5 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
6 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
7 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
8 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
9 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
10 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
11 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
12 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
119 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
129 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
135 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
181 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
193 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
194 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
195 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
196 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
197 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
198 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
200 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
201 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
202 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
203 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
204 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.06
Metatranscriptomes 0
Isolates 5.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.44
Nodule 2.1
Rhizoplane 3.85
Rhizosphere 76.22
Stem 0
Stem Tuber 0
Unclassified 8.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1002756 3300002070 Bacteria 2108
2 JGI25159J45721_1000266 3300002987 Bacteria 24375
3 JGI25406J46586_10000172 3300003203 Bacteria 28962
4 JGI25406J46586_10000692 3300003203 Bacteria 15692
5 JGI25406J46586_10056825 3300003203 Bacteria 1282
6 rootH1_10076708 3300003323 Bacteria 3288
7 JGI25160J50197_1000271 3300003354 Bacteria 38299
8 JGI25161J50226_1000208 3300003374 Bacteria 38299
9 JGI25404J52841_10000704 3300003659 Bacteria 5165
10 Ga0055543_1000274 3300004625 Bacteria 38337
11 Ga0065165_1001956 3300005262 Bacteria 19511
12 Ga0065712_10121426 3300005290 Bacteria 1665
13 Ga0065707_10110066 3300005295 Bacteria 2445
14 Ga0068869_100016816 3300005334 Bacteria 4942
15 Ga0068869_100319450 3300005334 Bacteria 1259
16 Ga0070668_100074866 3300005347 Bacteria 2642
17 Ga0070669_100162701 3300005353 Bacteria 1735
18 Ga0070671_100147698 3300005355 Bacteria 1985
19 Ga0070714_100315742 3300005435 Bacteria 1460
20 Ga0070714_100465162 3300005435 Unclassified 1203
21 Ga0070710_10107919 3300005437 Bacteria 1668
22 Ga0070700_100166149 3300005441 Bacteria 1524
23 Ga0070708_100000445 3300005445 Bacteria 30891
24 Ga0070708_100011218 3300005445 Bacteria 7286
25 Ga0070662_100008591 3300005457 Bacteria 6662
26 Ga0070706_100153996 3300005467 Bacteria 2146
27 Ga0070698_100198940 3300005471 Bacteria 1940
28 Ga0070699_100167498 3300005518 Bacteria 1946
29 Ga0070695_100110165 3300005545 Bacteria 1867
30 Ga0070665_100218669 3300005548 Bacteria 1905
31 Ga0070704_100152454 3300005549 Bacteria 1819
32 Ga0068856_100013405 3300005614 Bacteria 7937
33 Ga0068863_100441593 3300005841 Bacteria 1276
34 Ga0068860_100000173 3300005843 Bacteria 106145
35 Ga0068860_100017077 3300005843 Bacteria 7075
36 Ga0068862_100071373 3300005844 Bacteria 2998
37 Ga0081540_1000136 3300005983 Bacteria 78663
38 Ga0081540_1000288 3300005983 Bacteria 52745
39 Ga0081540_1000791 3300005983 Bacteria 29049
40 Ga0081540_1001429 3300005983 Bacteria 20644
41 Ga0081540_1007009 3300005983 Bacteria 8108
42 Ga0081540_1008879 3300005983 Bacteria 6976
43 Ga0081540_1011587 3300005983 Bacteria 5885
44 Ga0081539_10000003 3300005985 Bacteria 594833
45 Ga0081539_10013201 3300005985 Bacteria 6250
46 Ga0070716_100006790 3300006173 Bacteria 5608
47 Ga0070712_100010194 3300006175 Bacteria 5923
48 Ga0075367_10049638 3300006178 Bacteria 2474
49 Ga0075369_10018163 3300006186 Bacteria 2861
50 Ga0075366_10080263 3300006195 Bacteria 1948
51 Ga0075428_100090743 3300006844 Bacteria 3333
52 Ga0075430_100013449 3300006846 Bacteria 6977
53 Ga0075431_100024750 3300006847 Bacteria 6154
54 Ga0075433_10082424 3300006852 Bacteria 2837
55 Ga0075434_100097446 3300006871 Bacteria 2946
56 Ga0075434_100352543 3300006871 Bacteria 1493
57 Ga0068865_100211069 3300006881 Bacteria 1513
58 Ga0075435_100118422 3300007076 Bacteria 2208
59 Ga0099794_10000728 3300007265 Bacteria 11054
60 Ga0099794_10058051 3300007265 Bacteria 1875
61 Ga0099795_10029370 3300007788 Bacteria 1879
62 Ga0099795_10046619 3300007788 Bacteria 1562
63 Ga0099795_10092283 3300007788 Bacteria 1175
64 Ga0099795_10113333 3300007788 Bacteria 1077
65 Ga0105240_10000162 3300009093 Bacteria 136882
66 Ga0105245_10186714 3300009098 Bacteria 1983
67 Ga0114129_10607595 3300009147 Bacteria 1416
68 Ga0105243_10043301 3300009148 Bacteria 3528
69 Ga0105242_10033672 3300009176 Bacteria 4104
70 Ga0105249_10031393 3300009553 Bacteria 4805
71 Ga0105249_10383433 3300009553 Bacteria 1432
72 Ga0123342_1000436 3300009766 Bacteria 65465
73 Ga0099796_10039521 3300010159 Bacteria 1589
74 Ga0099796_10075826 3300010159 Viruses 1223
75 Ga0105239_10000050 3300010375 Bacteria 173908
76 Ga0105239_10029647 3300010375 Bacteria 6016
77 Ga0105239_10121548 3300010375 Bacteria 2900
78 Ga0105246_10055508 3300011119 Bacteria 2734
79 Ga0157378_10040436 3300013297 Bacteria 4134
80 Ga0163162_10045641 3300013306 Bacteria 4389
81 Ga0157379_10053622 3300014968 Bacteria 3602
82 Ga0157379_10155844 3300014968 Bacteria 2061
83 Ga0157376_10166419 3300014969 Bacteria 2004
84 Ga0163161_10364805 3300017792 Bacteria 1151
85 Ga0213872_10025320 3300021361 Bacteria 2728
86 Ga0213875_10000779 3300021388 Bacteria 23793
87 Ga0209566_100542 3300025225 Bacteria 25524
88 Ga0209674_101176 3300025226 Bacteria 7551
89 Ga0209674_101649 3300025226 Bacteria 5579
90 Ga0209130_1000292 3300025284 Bacteria 60927
91 Ga0207426_1000269 3300025302 Bacteria 109050
92 Ga0207695_10000198 3300025913 Bacteria 167880
93 Ga0207693_10001554 3300025915 Bacteria 20275
94 Ga0207693_10045838 3300025915 Bacteria 3435
95 Ga0207693_10125674 3300025915 Bacteria 2016
96 Ga0207663_10257370 3300025916 Bacteria 1287
97 Ga0207646_10386559 3300025922 Bacteria 1264
98 Ga0207681_10048619 3300025923 Bacteria 2863
99 Ga0207664_10459825 3300025929 Bacteria 1137
100 Ga0207644_10178288 3300025931 Bacteria 1664
101 Ga0207690_10178645 3300025932 Bacteria 1596
102 Ga0207706_10009049 3300025933 Bacteria 9162
103 Ga0207686_10026876 3300025934 Bacteria 3364
104 Ga0207704_10285475 3300025938 Bacteria 1257
105 Ga0207665_10030965 3300025939 Bacteria 3539
106 Ga0207665_10269997 3300025939 Bacteria 1263
107 Ga0207689_10014912 3300025942 Bacteria 6595
108 Ga0207712_10014523 3300025961 Bacteria 5069
109 Ga0207668_10018841 3300025972 Bacteria 4351
110 Ga0207658_10024995 3300025986 Bacteria 4180
111 Ga0207708_10190157 3300026075 Bacteria 1633
112 Ga0207702_10054881 3300026078 Bacteria 3378
113 Ga0207641_10413863 3300026088 Bacteria 1297
114 Ga0207676_10241546 3300026095 Bacteria 1621
115 Ga0207675_100024918 3300026118 Bacteria 5566
116 Ga0209588_1000258 3300027671 Bacteria 14028
117 Ga0209588_1011187 3300027671 Bacteria 2708
118 Ga0268265_10006558 3300028380 Bacteria 7876
119 Ga0268264_10000045 3300028381 Bacteria 364764
120 Ga0268264_10029137 3300028381 Bacteria 4520
121 Ga0307517_10003177 3300028786 Bacteria 25825
122 Ga0307517_10057775 3300028786 Bacteria 3751
123 Ga0307517_10118321 3300028786 Bacteria 1972
124 Ga0307515_10002868 3300028794 Bacteria 36682
125 Ga0307515_10003069 3300028794 Bacteria 35363
126 Ga0265316_10179536 3300031344 Bacteria 1577
127 Ga0307513_10055511 3300031456 Bacteria 4238
128 Ga0307513_10242902 3300031456 Bacteria 1604
129 Ga0307508_10000306 3300031616 Bacteria 59403
130 Ga0307508_10073350 3300031616 Bacteria 2999
131 Ga0307409_100368893 3300031995 Bacteria 1361
132 Ga0307510_10000049 3300033180 Bacteria 91546
133 Ga0307510_10070691 3300033180 Bacteria 3483
134 Ga0315911_1000006 3300033442 Bacteria 414563
135 Ga0373931_0035946 3300035691 Bacteria 2579
136 Ga0436364_0683837 3300037853 Bacteria 3152
137 Ga0436365_1860749 3300039437 Bacteria 3953
138 Ga0436360_0489856 3300039438 Bacteria 1471
139 Ga0436360_0657187 3300039438 Bacteria 1198
140 Ga0436361_0276900 3300039447 Unclassified 1258
141 Ga0436361_0617061 3300039447 Bacteria 27988
142 Ga0436361_0983397 3300039447 Bacteria 1178
143 Ga0436363_0374856 3300039450 Bacteria 1253
144 Ga0495617_042748 3300046452 Bacteria 1514
145 Ga0495590_0022509 3300046457 Bacteria 2229
146 Ga0495629_0120699 3300046459 Bacteria 1826
147 Ga0495638_0000095 3300046460 Bacteria 141825
148 Ga0495638_0000946 3300046460 Bacteria 29439
149 Ga0495651_0002683 3300046462 Bacteria 13807
150 Ga0495650_0026109 3300046471 Unclassified 2723
151 Ga0495650_0089491 3300046471 Bacteria 1173
152 Ga0495580_0081045 3300046472 Bacteria 2262
153 Ga0495580_0145571 3300046472 Bacteria 1642
154 Ga0495605_0000707 3300046474 Bacteria 24719
155 Ga0495605_0003220 3300046474 Bacteria 9792
156 Ga0495584_0000153 3300046491 Bacteria 47948
157 Ga0495584_0184931 3300046491 Bacteria 1059
158 Ga0495585_0002087 3300046492 Bacteria 14622
159 Ga0495585_0010680 3300046492 Bacteria 5454
160 Ga0495585_0017642 3300046492 Bacteria 4122
161 Ga0495607_0029878 3300046501 Bacteria 3352
162 Ga0495607_0137090 3300046501 Unclassified 1266
163 Ga0495583_0000057 3300046506 Bacteria 200688
164 Ga0495583_0000991 3300046506 Bacteria 32505
165 Ga0495583_0001800 3300046506 Bacteria 20280
166 Ga0495583_0029840 3300046506 Bacteria 2664
167 Ga0495606_0000154 3300046507 Bacteria 119458
168 Ga0495606_0008833 3300046507 Bacteria 8639
169 Ga0495606_0054524 3300046507 Bacteria 2589
170 Ga0495616_0009742 3300046513 Bacteria 5598
171 Ga0495616_0105239 3300046513 Bacteria 1318
172 Ga0495620_0003141 3300046515 Bacteria 9480
173 Ga0495620_0031786 3300046515 Bacteria 2413
174 Ga0495631_0003533 3300046518 Bacteria 8543
175 Ga0495631_0088894 3300046518 Bacteria 1330
176 Ga0495632_0028176 3300046519 Bacteria 2933
177 Ga0495632_0081348 3300046519 Bacteria 1544
178 Ga0495637_0032908 3300046520 Unclassified 2281
179 Ga0495643_0002453 3300046522 Bacteria 14677
180 Ga0495643_0134226 3300046522 Bacteria 1240
181 Ga0495644_0000266 3300046523 Bacteria 23929
182 Ga0495644_0001300 3300046523 Bacteria 10244
183 Ga0495648_0000104 3300046524 Bacteria 105792
184 Ga0495648_0045847 3300046524 Bacteria 2716
185 Ga0495666_0081859 3300046526 Bacteria 1527
186 Ga0495654_0000097 3300046530 Bacteria 99414
187 Ga0495665_0032125 3300046531 Bacteria 2807
188 Ga0495640_0271083 3300046533 Bacteria 1058
189 Ga0495609_0003027 3300046538 Bacteria 9906
190 Ga0495609_0029722 3300046538 Bacteria 2487
191 Ga0495597_0001460 3300046542 Bacteria 16933
192 Ga0495622_0121573 3300046557 Unclassified 1192
193 Ga0495656_0043247 3300046615 Bacteria 1890
194 Ga0495668_0006305 3300046616 Bacteria 7809
195 Ga0495611_0002793 3300046648 Bacteria 7811
196 Ga0495625_0001932 3300046660 Bacteria 23427
197 Ga0495625_0007154 3300046660 Bacteria 9796
198 Ga0495625_0042379 3300046660 Bacteria 3308
199 Ga0495625_0046092 3300046660 Bacteria 3147
200 Ga0495625_0049683 3300046660 Bacteria 3014
201 Ga0495625_0136494 3300046660 Bacteria 1658
202 Ga0495659_0077799 3300046664 Unclassified 1253
203 Ga0495661_0012165 3300046665 Bacteria 5812
204 Ga0495646_0133739 3300046680 Bacteria 1394
205 Ga0495624_0001325 3300046690 Bacteria 19384
206 Ga0495670_0000961 3300046691 Bacteria 13949
207 Ga0495670_0018109 3300046691 Bacteria 3469
208 Ga0495670_0194491 3300046691 Bacteria 1073
209 Ga0495671_0026515 3300046692 Bacteria 3004
210 Ga0495649_0000027 3300046694 Bacteria 164157
211 Ga0495649_0029582 3300046694 Bacteria 3029
212 Ga0495660_0000089 3300046810 Bacteria 98880
213 Ga0495660_0001928 3300046810 Bacteria 13530
214 Ga0495660_0024666 3300046810 Bacteria 3425
215 Ga0495581_0133910 3300047315 Bacteria 1444
216 Ga0495636_0000166 3300047318 Bacteria 26515
217 Ga0495674_0011440 3300047319 Bacteria 8374
218 Ga0495672_0011239 3300047320 Bacteria 6328
219 Ga0495676_0004476 3300047321 Bacteria 12775
220 Ga0495676_0181936 3300047321 Bacteria 1472
221 Ga0495683_0002609 3300047323 Bacteria 10815
222 Ga0495683_0009786 3300047323 Bacteria 5097
223 Ga0495687_000183 3300047443 Bacteria 91212
224 Ga0495687_000362 3300047443 Bacteria 56701
225 Ga0495687_001507 3300047443 Bacteria 21224
226 Ga0495687_003845 3300047443 Bacteria 10569
227 Ga0495677_0001461 3300047445 Bacteria 9470
228 Ga0495684_0082134 3300047471 Bacteria 2445
229 Ga0496101_0227266 3300048904 Bacteria 1450
230 Ga0496103_0263755 3300048906 Bacteria 1108
231 Ga0496104_0012601 3300048907 Bacteria 7609
232 Ga0496106_0146742 3300048909 Bacteria 1859
233 Ga0496107_0122887 3300048910 Bacteria 1913
234 Ga0496109_0146470 3300048912 Bacteria 2210
235 Ga0496111_0152425 3300048914 Bacteria 1715
236 Ga0496112_0464972 3300048915 Bacteria 1202
237 Ga0496115_0000137 3300048918 Bacteria 67049
238 Ga0496119_0107220 3300048922 Bacteria 1558
239 Ga0496122_0011610 3300048925 Bacteria 8892
240 Ga0496123_0013990 3300048926 Bacteria 6682
241 Ga0496126_0003185 3300048929 Bacteria 21093
242 Ga0496126_0004460 3300048929 Bacteria 16727
243 Ga0495678_002358 3300049459 Bacteria 12968
244 Ga0495678_026097 3300049459 Bacteria 2500
245 Ga0495682_0035101 3300049460 Bacteria 1847
246 nmdc:mga0k408_106023_c1 3300050493 Bacteria 1660
247 nmdc:mga06z11_92312_c1 3300050494 Bacteria 1646
248 nmdc:mga05p37_103424_c1 3300050507 Bacteria 3506
249 nmdc:mga05p37_663640_c1 3300050507 Bacteria 1165
250 nmdc:mga0qj67_103114_c1 3300050509 Bacteria 2301
251 nmdc:mga06r32_180944_c1 3300050510 Bacteria 2094
252 nmdc:mga08y16_60900_c1 3300050511 Bacteria 3941
253 nmdc:mga0n895_359883_c1 3300050512 Bacteria 1473
254 nmdc:mga0rr50_104214_c1 3300050513 Bacteria 2234
255 nmdc:mga0rr50_190276_c1 3300050513 Bacteria 1681
256 nmdc:mga08x19_242008_c1 3300050514 Bacteria 1244
257 nmdc:mga0a205_105750_c1 3300050515 Bacteria 2713
258 Ga0500583_0003498 3300053092 Bacteria 4946
259 Ga0500651_0017378 3300053093 Bacteria 4436
260 Ga0500594_0003331 3300053118 Bacteria 3519
261 Ga0500618_000373 3300053125 Bacteria 30954
262 Ga0500642_0028198 3300053130 Bacteria 2313
263 Ga0500658_0016063 3300053134 Bacteria 2787
264 Ga0500588_0053010 3300053146 Bacteria 1272
265 Ga0500616_0034738 3300053153 Bacteria 2745
266 Ga0500622_0000186 3300053156 Bacteria 66006
267 Ga0500622_0058408 3300053156 Bacteria 1971
268 Ga0500609_006231 3300053731 Bacteria 1626
269 Ga0500599_003172 3300053736 Bacteria 1998

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_0464972 Ga0496112_0464972_14_871 263
2 3300039438 Ga0436360_0657187 Ga0436360_0657187_28_825 265
3 3300046531 Ga0495665_0032125 Ga0495665_0032125_1990_2790 266
4 3300046533 Ga0495640_0271083 Ga0495640_0271083_236_1036 266
5 3300046491 Ga0495584_0000153 Ga0495584_0000153_31315_32247 267
6 3300046665 Ga0495661_0012165 Ga0495661_0012165_4102_5034 267
7 3300005437 Ga0070710_10107919 Ga0070710_101079192 274
8 3300046471 Ga0495650_0089491 Ga0495650_0089491_253_1095 280
9 3300046491 Ga0495584_0184931 Ga0495584_0184931_36_881 281
10 3300039438 Ga0436360_0489856 Ga0436360_0489856_298_1239 285
11 3300027671 Ga0209588_1011187 Ga0209588_10111872 286
12 3300031616 Ga0307508_10073350 Ga0307508_100733502 291
13 3300025226 Ga0209674_101176 Ga0209674_1011761 293
14 3300046471 Ga0495650_0026109 Ga0495650_0026109_1459_2400 297
15 3300046660 Ga0495625_0136494 Ga0495625_0136494_457_1398 299
16 3300046522 Ga0495643_0134226 Ga0495643_0134226_58_993 301
17 3300046507 Ga0495606_0054524 Ga0495606_0054524_947_1858 303
18 3300010159 Ga0099796_10075826 Ga0099796_100758261 305
19 3300021388 Ga0213875_10000779 Ga0213875_1000077918 307
20 3300046513 Ga0495616_0105239 Ga0495616_0105239_11_952 307
21 3300046518 Ga0495631_0088894 Ga0495631_0088894_126_1097 307
22 3300046520 Ga0495637_0032908 Ga0495637_0032908_774_1715 307
23 3300046530 Ga0495654_0000097 Ga0495654_0000097_28499_29440 307
24 3300046692 Ga0495671_0026515 Ga0495671_0026515_1665_2606 307
25 3300046694 Ga0495649_0000027 Ga0495649_0000027_9661_10602 307
26 3300046810 Ga0495660_0000089 Ga0495660_0000089_69327_70268 307
27 3300047321 Ga0495676_0004476 Ga0495676_0004476_428_1369 307
28 3300047321 Ga0495676_0181936 Ga0495676_0181936_104_1045 307
29 3300048907 Ga0496104_0012601 Ga0496104_0012601_5974_6954 307
30 3300053125 Ga0500618_000373 Ga0500618_000373_11018_11959 307
31 iso_pu_bacteria 2599185239 2599740395 307
32 iso_pu_bacteria 2599185239 2599741019 307
33 iso_pu_bacteria 8021120328 8021123173 307
34 iso_pu_bacteria 8021120328 8021123182 307
35 3300031616 Ga0307508_10000306 Ga0307508_1000030646 308
36 iso_pu_bacteria 2510917028 2511183288 309
37 3300005841 Ga0068863_100441593 Ga0068863_1004415932 310
38 3300026088 Ga0207641_10413863 Ga0207641_104138631 310
39 3300028786 Ga0307517_10057775 Ga0307517_100577752 310
40 3300028786 Ga0307517_10118321 Ga0307517_101183212 310
41 3300046462 Ga0495651_0002683 Ga0495651_0002683_5402_6334 310
42 3300046474 Ga0495605_0000707 Ga0495605_0000707_23494_24426 310
43 3300046492 Ga0495585_0002087 Ga0495585_0002087_3097_4029 310
44 3300046492 Ga0495585_0010680 Ga0495585_0010680_241_1173 310
45 3300046501 Ga0495607_0029878 Ga0495607_0029878_1849_2781 310
46 3300046501 Ga0495607_0137090 Ga0495607_0137090_312_1244 310
47 3300046506 Ga0495583_0000057 Ga0495583_0000057_65493_66425 310
48 3300046507 Ga0495606_0008833 Ga0495606_0008833_4698_5630 310
49 3300046513 Ga0495616_0009742 Ga0495616_0009742_306_1238 310
50 3300046523 Ga0495644_0000266 Ga0495644_0000266_6815_7747 310
51 3300046523 Ga0495644_0001300 Ga0495644_0001300_1906_2838 310
52 3300046524 Ga0495648_0000104 Ga0495648_0000104_37616_38548 310
53 3300046538 Ga0495609_0003027 Ga0495609_0003027_6833_7765 310
54 3300046557 Ga0495622_0121573 Ga0495622_0121573_137_1069 310
55 3300046615 Ga0495656_0043247 Ga0495656_0043247_637_1569 310
56 3300046648 Ga0495611_0002793 Ga0495611_0002793_1818_2750 310
57 3300046664 Ga0495659_0077799 Ga0495659_0077799_105_1037 310
58 3300046691 Ga0495670_0000961 Ga0495670_0000961_7255_8187 310
59 3300047318 Ga0495636_0000166 Ga0495636_0000166_25027_25959 310
60 3300047320 Ga0495672_0011239 Ga0495672_0011239_3901_4833 310
61 3300047323 Ga0495683_0002609 Ga0495683_0002609_2292_3224 310
62 3300047443 Ga0495687_000362 Ga0495687_000362_32119_33051 310
63 3300047445 Ga0495677_0001461 Ga0495677_0001461_947_1879 310
64 3300049459 Ga0495678_002358 Ga0495678_002358_4885_5817 310
65 3300049460 Ga0495682_0035101 Ga0495682_0035101_582_1514 310
66 3300005355 Ga0070671_100147698 Ga0070671_1001476982 311
67 3300005548 Ga0070665_100218669 Ga0070665_1002186692 311
68 3300009093 Ga0105240_10000162 Ga0105240_1000016236 311
69 3300009553 Ga0105249_10383433 Ga0105249_103834332 311
70 3300010375 Ga0105239_10000050 Ga0105239_1000005065 311
71 3300010375 Ga0105239_10121548 Ga0105239_101215483 311
72 3300011119 Ga0105246_10055508 Ga0105246_100555081 311
73 3300013297 Ga0157378_10040436 Ga0157378_100404363 311
74 3300014968 Ga0157379_10053622 Ga0157379_100536224 311
75 3300014969 Ga0157376_10166419 Ga0157376_101664192 311
76 3300025225 Ga0209566_100542 Ga0209566_10054225 311
77 3300025226 Ga0209674_101649 Ga0209674_1016494 311
78 3300025913 Ga0207695_10000198 Ga0207695_1000019857 311
79 3300025916 Ga0207663_10257370 Ga0207663_102573702 311
80 3300025931 Ga0207644_10178288 Ga0207644_101782882 311
81 3300026095 Ga0207676_10241546 Ga0207676_102415462 311
82 3300031456 Ga0307513_10242902 Ga0307513_102429021 311
83 3300035691 Ga0373931_0035946 Ga0373931_0035946_864_1865 311
84 3300046542 Ga0495597_0001460 Ga0495597_0001460_2576_3523 311
85 3300046810 Ga0495660_0001928 Ga0495660_0001928_8741_9688 311
86 3300047443 Ga0495687_003845 Ga0495687_003845_1587_2522 311
87 3300048906 Ga0496103_0263755 Ga0496103_0263755_14_1015 311
88 3300048912 Ga0496109_0146470 Ga0496109_0146470_792_1793 311
89 3300048914 Ga0496111_0152425 Ga0496111_0152425_34_1035 311
90 3300048925 Ga0496122_0011610 Ga0496122_0011610_4849_5784 311
91 3300048926 Ga0496123_0013990 Ga0496123_0013990_3110_4045 311
92 3300050513 nmdc:mga0rr50_190276_c1 nmdc:mga0rr50_190276_c1_245_1246 311
93 3300025939 Ga0207665_10269997 Ga0207665_102699972 312
94 3300028794 Ga0307515_10002868 Ga0307515_100028684 312
95 3300046691 Ga0495670_0018109 Ga0495670_0018109_2205_3143 312
96 iso_pu_bacteria 2582581867 2585399335 312
97 iso_pu_bacteria 8046767195 8046767892 312
98 3300006186 Ga0075369_10018163 Ga0075369_100181632 313
99 3300009766 Ga0123342_1000436 Ga0123342_100043644 313
100 3300033180 Ga0307510_10000049 Ga0307510_1000004951 313
101 3300046460 Ga0495638_0000095 Ga0495638_0000095_37545_38486 313
102 3300046507 Ga0495606_0000154 Ga0495606_0000154_46341_47282 313
103 3300046660 Ga0495625_0049683 Ga0495625_0049683_391_1332 313
104 3300048918 Ga0496115_0000137 Ga0496115_0000137_24100_25041 313
105 3300048929 Ga0496126_0003185 Ga0496126_0003185_1336_2277 313
106 iso_pu_bacteria 2582581315 2585324490 313
107 3300046452 Ga0495617_042748 Ga0495617_042748_77_1021 314
108 3300046460 Ga0495638_0000946 Ga0495638_0000946_2792_3736 314
109 3300046474 Ga0495605_0003220 Ga0495605_0003220_4700_5644 314
110 3300046492 Ga0495585_0017642 Ga0495585_0017642_1266_2210 314
111 3300046506 Ga0495583_0029840 Ga0495583_0029840_635_1579 314
112 3300046518 Ga0495631_0003533 Ga0495631_0003533_3593_4537 314
113 3300046519 Ga0495632_0028176 Ga0495632_0028176_1317_2261 314
114 3300046524 Ga0495648_0045847 Ga0495648_0045847_121_1065 314
115 3300046538 Ga0495609_0029722 Ga0495609_0029722_212_1156 314
116 3300046616 Ga0495668_0006305 Ga0495668_0006305_2898_3842 314
117 3300046660 Ga0495625_0007154 Ga0495625_0007154_3673_4617 314
118 3300049459 Ga0495678_026097 Ga0495678_026097_968_1912 314
119 3300053118 Ga0500594_0003331 Ga0500594_0003331_2009_2953 314
120 3300053146 Ga0500588_0053010 Ga0500588_0053010_177_1121 314
121 3300053736 Ga0500599_003172 Ga0500599_003172_365_1309 314
122 iso_pu_bacteria 2824661429 2824663968 314
123 3300002987 JGI25159J45721_1000266 JGI25159J45721_100026614 316
124 3300003354 JGI25160J50197_1000271 JGI25160J50197_100027121 316
125 3300003374 JGI25161J50226_1000208 JGI25161J50226_100020813 316
126 3300004625 Ga0055543_1000274 Ga0055543_100027421 316
127 3300005262 Ga0065165_1001956 Ga0065165_100195614 316
128 3300005435 Ga0070714_100465162 Ga0070714_1004651621 316
129 3300005445 Ga0070708_100000445 Ga0070708_10000044522 316
130 3300005445 Ga0070708_100011218 Ga0070708_1000112186 316
131 3300005518 Ga0070699_100167498 Ga0070699_1001674981 316
132 3300005614 Ga0068856_100013405 Ga0068856_1000134058 316
133 3300006871 Ga0075434_100097446 Ga0075434_1000974462 316
134 3300007788 Ga0099795_10029370 Ga0099795_100293702 316
135 3300009098 Ga0105245_10186714 Ga0105245_101867142 316
136 3300025284 Ga0209130_1000292 Ga0209130_100029213 316
137 3300025302 Ga0207426_1000269 Ga0207426_100026955 316
138 3300026078 Ga0207702_10054881 Ga0207702_100548815 316
139 3300028794 Ga0307515_10003069 Ga0307515_1000306917 316
140 3300037853 Ga0436364_0683837 Ga0436364_0683837_2047_2997 316
141 3300039447 Ga0436361_0276900 Ga0436361_0276900_182_1132 316
142 3300039450 Ga0436363_0374856 Ga0436363_0374856_46_996 316
143 3300046506 Ga0495583_0000991 Ga0495583_0000991_9915_10865 316
144 3300046515 Ga0495620_0031786 Ga0495620_0031786_932_1882 316
145 3300046526 Ga0495666_0081859 Ga0495666_0081859_111_1064 316
146 3300046660 Ga0495625_0001932 Ga0495625_0001932_8766_9716 316
147 3300046680 Ga0495646_0133739 Ga0495646_0133739_21_974 316
148 3300046690 Ga0495624_0001325 Ga0495624_0001325_16784_17737 316
149 3300047315 Ga0495581_0133910 Ga0495581_0133910_119_1072 316
150 3300047319 Ga0495674_0011440 Ga0495674_0011440_2952_3905 316
151 3300047443 Ga0495687_000183 Ga0495687_000183_4006_4956 316
152 3300047471 Ga0495684_0082134 Ga0495684_0082134_369_1322 316
153 3300048922 Ga0496119_0107220 Ga0496119_0107220_568_1524 316
154 3300050507 nmdc:mga05p37_103424_c1 nmdc:mga05p37_103424_c1_1860_2927 316
155 3300053156 Ga0500622_0000186 Ga0500622_0000186_5571_6521 316
156 iso_pu_bacteria 2582581867 2585404144 316
157 iso_pu_bacteria 2585427590 2585820691 316
158 3300028381 Ga0268264_10029137 Ga0268264_100291374 317
159 3300046660 Ga0495625_0046092 Ga0495625_0046092_1435_2388 317
160 3300046691 Ga0495670_0194491 Ga0495670_0194491_85_1038 317
161 3300007265 Ga0099794_10000728 Ga0099794_100007286 318
162 3300027671 Ga0209588_1000258 Ga0209588_100025810 318
163 3300033442 Ga0315911_1000006 Ga0315911_1000006149 318
164 3300005983 Ga0081540_1008879 Ga0081540_10088797 319
165 3300021361 Ga0213872_10025320 Ga0213872_100253202 319
166 3300039447 Ga0436361_0617061 Ga0436361_0617061_20169_21128 319
167 3300028786 Ga0307517_10003177 Ga0307517_1000317714 320
168 3300031995 Ga0307409_100368893 Ga0307409_1003688932 320
169 3300046457 Ga0495590_0022509 Ga0495590_0022509_1118_2080 320
170 3300046506 Ga0495583_0001800 Ga0495583_0001800_7166_8128 320
171 3300046515 Ga0495620_0003141 Ga0495620_0003141_4022_4984 320
172 3300046519 Ga0495632_0081348 Ga0495632_0081348_473_1435 320
173 3300046522 Ga0495643_0002453 Ga0495643_0002453_235_1197 320
174 3300046660 Ga0495625_0042379 Ga0495625_0042379_1954_2916 320
175 3300046694 Ga0495649_0029582 Ga0495649_0029582_277_1239 320
176 3300046810 Ga0495660_0024666 Ga0495660_0024666_812_1774 320
177 3300047323 Ga0495683_0009786 Ga0495683_0009786_3471_4433 320
178 3300047443 Ga0495687_001507 Ga0495687_001507_20191_21153 320
179 iso_pu_bacteria 2517093001 2517104970 320
180 3300003203 JGI25406J46586_10000692 JGI25406J46586_1000069210 321
181 3300005983 Ga0081540_1011587 Ga0081540_10115873 321
182 iso_pu_bacteria 2894652903 2894653587 321
183 iso_pu_bacteria 2903748898 2903755464 321
184 3300006852 Ga0075433_10082424 Ga0075433_100824243 322
185 3300006871 Ga0075434_100352543 Ga0075434_1003525432 322
186 3300007076 Ga0075435_100118422 Ga0075435_1001184222 322
187 3300039447 Ga0436361_0983397 Ga0436361_0983397_143_1111 322
188 3300050511 nmdc:mga08y16_60900_c1 nmdc:mga08y16_60900_c1_2189_3157 322
189 3300050513 nmdc:mga0rr50_104214_c1 nmdc:mga0rr50_104214_c1_800_1768 322
190 3300050515 nmdc:mga0a205_105750_c1 nmdc:mga0a205_105750_c1_434_1402 322
191 iso_pu_bacteria 2874168670 2874174283 322
192 3300003659 JGI25404J52841_10000704 JGI25404J52841_100007043 323
193 3300005983 Ga0081540_1001429 Ga0081540_100142919 323
194 3300046459 Ga0495629_0120699 Ga0495629_0120699_378_1349 323
195 iso_pu_bacteria 2847930680 2847938945 323
196 3300003323 rootH1_10076708 rootH1_100767084 324
197 3300005467 Ga0070706_100153996 Ga0070706_1001539962 324
198 3300005471 Ga0070698_100198940 Ga0070698_1001989402 324
199 3300006178 Ga0075367_10049638 Ga0075367_100496382 324
200 3300006195 Ga0075366_10080263 Ga0075366_100802632 324
201 3300007265 Ga0099794_10058051 Ga0099794_100580512 324
202 3300025922 Ga0207646_10386559 Ga0207646_103865591 324
203 3300046472 Ga0495580_0081045 Ga0495580_0081045_47_1021 324
204 3300050493 nmdc:mga0k408_106023_c1 nmdc:mga0k408_106023_c1_530_1504 324
205 3300050494 nmdc:mga06z11_92312_c1 nmdc:mga06z11_92312_c1_523_1497 324
206 3300007788 Ga0099795_10046619 Ga0099795_100466192 325
207 3300010159 Ga0099796_10039521 Ga0099796_100395212 325
208 3300031456 Ga0307513_10055511 Ga0307513_100555114 325
209 3300046472 Ga0495580_0145571 Ga0495580_0145571_622_1614 325
210 3300053134 Ga0500658_0016063 Ga0500658_0016063_1788_2765 325
211 3300003203 JGI25406J46586_10056825 JGI25406J46586_100568251 326
212 3300005435 Ga0070714_100315742 Ga0070714_1003157421 326
213 3300005983 Ga0081540_1000288 Ga0081540_100028826 326
214 3300005985 Ga0081539_10013201 Ga0081539_100132012 326
215 3300006173 Ga0070716_100006790 Ga0070716_1000067902 326
216 3300006175 Ga0070712_100010194 Ga0070712_1000101943 326
217 3300006844 Ga0075428_100090743 Ga0075428_1000907432 326
218 3300006846 Ga0075430_100013449 Ga0075430_1000134495 326
219 3300006847 Ga0075431_100024750 Ga0075431_1000247505 326
220 3300007788 Ga0099795_10113333 Ga0099795_101133331 326
221 3300017792 Ga0163161_10364805 Ga0163161_103648052 326
222 3300025915 Ga0207693_10001554 Ga0207693_1000155418 326
223 3300025915 Ga0207693_10045838 Ga0207693_100458384 326
224 3300025929 Ga0207664_10459825 Ga0207664_104598252 326
225 3300025939 Ga0207665_10030965 Ga0207665_100309653 326
226 3300031344 Ga0265316_10179536 Ga0265316_101795362 326
227 3300033180 Ga0307510_10070691 Ga0307510_100706912 326
228 3300048904 Ga0496101_0227266 Ga0496101_0227266_57_1037 326
229 3300048910 Ga0496107_0122887 Ga0496107_0122887_31_1011 326
230 3300050509 nmdc:mga0qj67_103114_c1 nmdc:mga0qj67_103114_c1_1153_2133 326
231 3300050510 nmdc:mga06r32_180944_c1 nmdc:mga06r32_180944_c1_980_1960 326
232 3300050512 nmdc:mga0n895_359883_c1 nmdc:mga0n895_359883_c1_270_1250 326
233 3300050514 nmdc:mga08x19_242008_c1 nmdc:mga08x19_242008_c1_196_1176 326
234 3300053092 Ga0500583_0003498 Ga0500583_0003498_2577_3557 326
235 3300053153 Ga0500616_0034738 Ga0500616_0034738_237_1217 326
236 3300053156 Ga0500622_0058408 Ga0500622_0058408_295_1275 326
237 iso_pu_bacteria 2617270735 2617351598 326
238 3300005983 Ga0081540_1000136 Ga0081540_10001364 328
239 3300053093 Ga0500651_0017378 Ga0500651_0017378_3406_4392 328
240 3300053130 Ga0500642_0028198 Ga0500642_0028198_915_1901 328
241 3300053731 Ga0500609_006231 Ga0500609_006231_183_1169 328
242 3300005983 Ga0081540_1000791 Ga0081540_10007915 329
243 3300007788 Ga0099795_10092283 Ga0099795_100922832 329
244 3300009147 Ga0114129_10607595 Ga0114129_106075952 329
245 3300025915 Ga0207693_10125674 Ga0207693_101256742 329
246 3300050507 nmdc:mga05p37_663640_c1 nmdc:mga05p37_663640_c1_116_1105 329
247 3300005843 Ga0068860_100000173 Ga0068860_10000017361 330
248 3300028381 Ga0268264_10000045 Ga0268264_1000004554 330
249 3300048909 Ga0496106_0146742 Ga0496106_0146742_119_1165 330
250 3300005290 Ga0065712_10121426 Ga0065712_101214262 336
251 3300025932 Ga0207690_10178645 Ga0207690_101786451 336
252 3300003203 JGI25406J46586_10000172 JGI25406J46586_100001728 339
253 3300005985 Ga0081539_10000003 Ga0081539_10000003451 339
254 3300002070 JGI24750J21931_1002756 JGI24750J21931_10027562 340
255 3300005295 Ga0065707_10110066 Ga0065707_101100662 340
256 3300005334 Ga0068869_100016816 Ga0068869_1000168162 340
257 3300005334 Ga0068869_100319450 Ga0068869_1003194502 340
258 3300005347 Ga0070668_100074866 Ga0070668_1000748661 340
259 3300005353 Ga0070669_100162701 Ga0070669_1001627012 340
260 3300005441 Ga0070700_100166149 Ga0070700_1001661492 340
261 3300005457 Ga0070662_100008591 Ga0070662_1000085914 340
262 3300005545 Ga0070695_100110165 Ga0070695_1001101651 340
263 3300005549 Ga0070704_100152454 Ga0070704_1001524542 340
264 3300005843 Ga0068860_100017077 Ga0068860_1000170776 340
265 3300005844 Ga0068862_100071373 Ga0068862_1000713733 340
266 3300005983 Ga0081540_1007009 Ga0081540_10070093 340
267 3300006881 Ga0068865_100211069 Ga0068865_1002110692 340
268 3300009148 Ga0105243_10043301 Ga0105243_100433013 340
269 3300009176 Ga0105242_10033672 Ga0105242_100336725 340
270 3300009553 Ga0105249_10031393 Ga0105249_100313935 340
271 3300010375 Ga0105239_10029647 Ga0105239_100296472 340
272 3300013306 Ga0163162_10045641 Ga0163162_100456414 340
273 3300014968 Ga0157379_10155844 Ga0157379_101558442 340
274 3300025923 Ga0207681_10048619 Ga0207681_100486192 340
275 3300025933 Ga0207706_10009049 Ga0207706_100090494 340
276 3300025934 Ga0207686_10026876 Ga0207686_100268763 340
277 3300025938 Ga0207704_10285475 Ga0207704_102854752 340
278 3300025942 Ga0207689_10014912 Ga0207689_100149126 340
279 3300025961 Ga0207712_10014523 Ga0207712_100145233 340
280 3300025972 Ga0207668_10018841 Ga0207668_100188412 340
281 3300025986 Ga0207658_10024995 Ga0207658_100249952 340
282 3300026075 Ga0207708_10190157 Ga0207708_101901572 340
283 3300026118 Ga0207675_100024918 Ga0207675_1000249182 340
284 3300028380 Ga0268265_10006558 Ga0268265_100065586 340
285 3300039437 Ga0436365_1860749 Ga0436365_1860749_1493_2524 340
286 3300048929 Ga0496126_0004460 Ga0496126_0004460_5649_6671 340

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

47

224

0.98

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

227

329

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j31-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase (kmo-396prot) 0.9856 8 38
4j36-assembly1.cif.gz_A cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) 0.9842 9 41
4j36-assembly2.cif.gz_B cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) 0.9836 8 41
4j34-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase - truncated at position 394 plus his tag cleaved. 0.982 8 41
4x4j-assembly1.cif.gz_B-2 structural and functional studies of bexe: insights into oxidation during be-7585a biosynthesis 0.9813 10 40
ID Description Score Start End Superfamily
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9836 8 41 3.50.50.60
af_Q5VQP1_29_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9783 10 40 3.50.50.60
af_Q46904_1_359_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9696 9 39 3.50.50.60
af_Q9C1W3_1_361_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9621 10 39 3.50.50.60
af_Q8WSW2_5_214_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9606 9 40 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A4P8IU87-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9916 1 311 GO:0006631
GO:0009056
GO:0016616
GO:0070403
AF-I3CLF8-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9913 11 311 GO:0006631
GO:0009056
GO:0016616
GO:0070403
AF-A0A1Q7VQ31-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9896 5 257 GO:0006631
GO:0009056
GO:0016616
GO:0070403
AF-A0A537PMH4-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9864 1 229 GO:0006631
GO:0009056
GO:0016616
GO:0070403
AF-A0A4P8IU87-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9853 1 311 GO:0006631
GO:0009056
GO:0016616
GO:0070403

Feature Viewer

pLDDT pTM Quality
90.62 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map