F387356

General Info

Members Datasets Scaffolds Average Seq Length
286 207 572 124

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100107624|Ga0075428_1001076242
Length 132
Sequence MVASDSFAEFLREQLAPLGHITMRRMFGKTGVFCDGLMLGMVRDDTLYFRVDDHNRAIFKEAESFPPLNYDKGGSSIDLSFWRAPERLFDEPDELVAWARAALAAARRVAAKRERTAPRGRGKGSDPSRRTS

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
176 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
193 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
194 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
195 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
196 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
197 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
198 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
200 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
201 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
202 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
203 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
206 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
207 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.49
Nodule 0
Rhizoplane 6.64
Rhizosphere 76.92
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100107624 3300006844 Bacteria 3038
2 Ga0070666_10201681 3300005335 Bacteria 1400
3 Ga0070680_100016765 3300005336 Bacteria 5765
4 Ga0068868_100766954 3300005338 Unclassified 868
5 Ga0070689_101354756 3300005340 Bacteria 642
6 Ga0070691_10070729 3300005341 Bacteria 1693
7 Ga0070692_10001409 3300005345 Bacteria 8710
8 Ga0070675_100236199 3300005354 Bacteria 1596
9 Ga0070673_101388696 3300005364 Bacteria 661
10 Ga0070688_100137660 3300005365 Bacteria 1655
11 Ga0070688_101599882 3300005365 Bacteria 532
12 Ga0070703_10001251 3300005406 Bacteria 7729
13 Ga0070709_10008528 3300005434 Bacteria 5633
14 Ga0070709_10031379 3300005434 Bacteria 3195
15 Ga0070709_10853346 3300005434 Bacteria 718
16 Ga0070714_100105567 3300005435 Bacteria 2488
17 Ga0070714_100214535 3300005435 Bacteria 1766
18 Ga0070713_100025205 3300005436 Bacteria 4646
19 Ga0070713_100114850 3300005436 Bacteria 2353
20 Ga0070710_10043469 3300005437 Bacteria 2488
21 Ga0070701_10136587 3300005438 Bacteria 1398
22 Ga0070711_100008293 3300005439 Bacteria 6356
23 Ga0070711_100045820 3300005439 Bacteria 2977
24 Ga0070705_100000025 3300005440 Bacteria 79976
25 Ga0070700_100003299 3300005441 Bacteria 8321
26 Ga0070694_100002659 3300005444 Bacteria 10574
27 Ga0070694_100995863 3300005444 Bacteria 696
28 Ga0070708_100005472 3300005445 Bacteria 10068
29 Ga0070663_100372719 3300005455 Bacteria 1161
30 Ga0070678_101421106 3300005456 Bacteria 648
31 Ga0070662_100051761 3300005457 Bacteria 2966
32 Ga0070681_10039538 3300005458 Bacteria 4728
33 Ga0070681_10278392 3300005458 Bacteria 1584
34 Ga0068867_100510018 3300005459 Bacteria 1035
35 Ga0070706_100223197 3300005467 Bacteria 1759
36 Ga0070707_102232408 3300005468 Bacteria 515
37 Ga0070698_100106214 3300005471 Bacteria 2777
38 Ga0070697_100051529 3300005536 Bacteria 3344
39 Ga0070672_100158688 3300005543 Bacteria 1875
40 Ga0070686_101489506 3300005544 Bacteria 570
41 Ga0070695_100001562 3300005545 Bacteria 12784
42 Ga0070696_100001462 3300005546 Bacteria 15447
43 Ga0070693_100629333 3300005547 Bacteria 778
44 Ga0068855_100358820 3300005563 Bacteria 1604
45 Ga0068855_100398342 3300005563 Bacteria 1509
46 Ga0070664_100401227 3300005564 Bacteria 1254
47 Ga0070702_100149818 3300005615 Bacteria 1496
48 Ga0068859_100008042 3300005617 Bacteria 10692
49 Ga0068851_10173786 3300005834 Bacteria 1190
50 Ga0068870_10176772 3300005840 Bacteria 1278
51 Ga0068863_100090179 3300005841 Bacteria 2907
52 Ga0068863_101745061 3300005841 Bacteria 632
53 Ga0068858_100227714 3300005842 Bacteria 1767
54 Ga0068858_100259348 3300005842 Bacteria 1652
55 Ga0068858_100911113 3300005842 Bacteria 860
56 Ga0068860_100014163 3300005843 Bacteria 7822
57 Ga0068862_100002691 3300005844 Bacteria 15621
58 Ga0081455_10003418 3300005937 Bacteria 18249
59 Ga0081540_1000213 3300005983 Bacteria 61164
60 Ga0081540_1019434 3300005983 Bacteria 4127
61 Ga0070717_10460552 3300006028 Bacteria 1147
62 Ga0075368_10000329 3300006042 Bacteria 13873
63 Ga0075363_100009901 3300006048 Bacteria 4500
64 Ga0075363_100988773 3300006048 Bacteria 518
65 Ga0070715_10064582 3300006163 Bacteria 1617
66 Ga0070716_100020403 3300006173 Bacteria 3478
67 Ga0070712_100029893 3300006175 Bacteria 3656
68 Ga0075367_10000701 3300006178 Bacteria 12912
69 Ga0075367_10197088 3300006178 Bacteria 1258
70 Ga0075428_100331359 3300006844 Bacteria 1635
71 Ga0075428_100765906 3300006844 Bacteria 1027
72 Ga0075430_100101156 3300006846 Bacteria 2407
73 Ga0075430_100255437 3300006846 Bacteria 1452
74 Ga0075431_100000995 3300006847 Bacteria 25251
75 Ga0075431_100003958 3300006847 Bacteria 14433
76 Ga0075431_100149670 3300006847 Bacteria 2404
77 Ga0075429_100008866 3300006880 Bacteria 8745
78 Ga0075429_100495050 3300006880 Bacteria 1071
79 Ga0097620_100008042 3300006931 Bacteria 10692
80 Ga0075435_100005313 3300007076 Bacteria 8970
81 Ga0099794_10132770 3300007265 Bacteria 1258
82 Ga0099794_10148473 3300007265 Bacteria 1190
83 Ga0099794_10502221 3300007265 Bacteria 638
84 Ga0099794_10548088 3300007265 Bacteria 610
85 Ga0099795_10057498 3300007788 Bacteria 1434
86 Ga0099795_10102234 3300007788 Bacteria 1126
87 Ga0105240_10000522 3300009093 Bacteria 70833
88 Ga0105240_10537548 3300009093 Bacteria 1295
89 Ga0111539_10005534 3300009094 Bacteria 16339
90 Ga0111539_10370003 3300009094 Bacteria 1668
91 Ga0111539_11122109 3300009094 Bacteria 914
92 Ga0105245_10107585 3300009098 Bacteria 2589
93 Ga0114129_10105706 3300009147 Bacteria 3890
94 Ga0114129_10158912 3300009147 Bacteria 3090
95 Ga0114129_10694217 3300009147 Bacteria 1309
96 Ga0105243_10109413 3300009148 Bacteria 2308
97 Ga0105243_10868583 3300009148 Bacteria 895
98 Ga0105241_10070618 3300009174 Bacteria 2710
99 Ga0105242_10319209 3300009176 Bacteria 1424
100 Ga0105248_10038903 3300009177 Bacteria 5325
101 Ga0105237_10039192 3300009545 Bacteria 4783
102 Ga0105237_11946636 3300009545 Bacteria 596
103 Ga0105238_10113927 3300009551 Bacteria 2683
104 Ga0105249_10003429 3300009553 Bacteria 13728
105 Ga0105249_10229504 3300009553 Bacteria 1830
106 Ga0105239_10049446 3300010375 Bacteria 4611
107 Ga0105239_10497236 3300010375 Bacteria 1386
108 Ga0105239_10738033 3300010375 Bacteria 1127
109 Ga0105239_12933791 3300010375 Bacteria 556
110 Ga0105246_10219229 3300011119 Bacteria 1490
111 Ga0157320_1013961 3300012481 Bacteria 664
112 Ga0157370_11499490 3300013104 Unclassified 606
113 Ga0157378_11168372 3300013297 Bacteria 808
114 Ga0163162_10453192 3300013306 Bacteria 1415
115 Ga0157372_11783174 3300013307 Bacteria 708
116 Ga0157372_12930228 3300013307 Unclassified 546
117 Ga0163163_10189473 3300014325 Bacteria 2105
118 Ga0157380_10127369 3300014326 Bacteria 2166
119 Ga0157380_12184207 3300014326 Bacteria 617
120 Ga0182008_10436667 3300014497 Bacteria 709
121 Ga0157379_10146545 3300014968 Bacteria 2129
122 Ga0207656_10152640 3300025321 Bacteria 1095
123 Ga0207653_10001885 3300025885 Bacteria 6711
124 Ga0207692_10018653 3300025898 Bacteria 3119
125 Ga0207692_10835306 3300025898 Bacteria 604
126 Ga0207692_11171347 3300025898 Bacteria 510
127 Ga0207680_10142502 3300025903 Bacteria 1590
128 Ga0207680_10895961 3300025903 Bacteria 636
129 Ga0207647_10130402 3300025904 Bacteria 1478
130 Ga0207685_10070856 3300025905 Bacteria 1412
131 Ga0207699_10028424 3300025906 Bacteria 3108
132 Ga0207699_10980526 3300025906 Bacteria 625
133 Ga0207643_10157372 3300025908 Bacteria 1365
134 Ga0207643_10232081 3300025908 Bacteria 1132
135 Ga0207684_10199103 3300025910 Bacteria 1728
136 Ga0207654_10087985 3300025911 Bacteria 1886
137 Ga0207707_10210517 3300025912 Bacteria 1694
138 Ga0207707_10806675 3300025912 Bacteria 782
139 Ga0207695_10037330 3300025913 Bacteria 5242
140 Ga0207671_10098852 3300025914 Bacteria 2208
141 Ga0207671_11232641 3300025914 Bacteria 584
142 Ga0207671_11374940 3300025914 Bacteria 548
143 Ga0207663_10024656 3300025916 Bacteria 3466
144 Ga0207663_10049846 3300025916 Bacteria 2600
145 Ga0207663_11503279 3300025916 Bacteria 542
146 Ga0207660_10016996 3300025917 Bacteria 4826
147 Ga0207646_10133702 3300025922 Bacteria 2233
148 Ga0207694_10022602 3300025924 Bacteria 4771
149 Ga0207694_10554243 3300025924 Bacteria 965
150 Ga0207700_10037483 3300025928 Bacteria 3511
151 Ga0207700_10365653 3300025928 Bacteria 1258
152 Ga0207664_10046078 3300025929 Bacteria 3422
153 Ga0207706_10025433 3300025933 Bacteria 5304
154 Ga0207709_10087976 3300025935 Bacteria 2021
155 Ga0207665_10009425 3300025939 Bacteria 6407
156 Ga0207665_10174606 3300025939 Bacteria 1553
157 Ga0207711_10607763 3300025941 Bacteria 1020
158 Ga0207689_10148786 3300025942 Bacteria 1930
159 Ga0207661_10327068 3300025944 Bacteria 1379
160 Ga0207667_10337202 3300025949 Bacteria 1539
161 Ga0207712_10028942 3300025961 Bacteria 3711
162 Ga0207658_11423097 3300025986 Bacteria 634
163 Ga0207703_10227422 3300026035 Bacteria 1671
164 Ga0207678_10026427 3300026067 Bacteria 5063
165 Ga0207708_10005311 3300026075 Bacteria 9488
166 Ga0207708_10269718 3300026075 Bacteria 1376
167 Ga0207641_10060873 3300026088 Bacteria 3219
168 Ga0207641_10088610 3300026088 Bacteria 2703
169 Ga0207648_10466738 3300026089 Bacteria 1151
170 Ga0207676_10149951 3300026095 Bacteria 2007
171 Ga0207674_10015659 3300026116 Bacteria 8325
172 Ga0207698_10195964 3300026142 Bacteria 1804
173 Ga0209179_1105363 3300027512 Bacteria 629
174 Ga0209588_1089365 3300027671 Bacteria 993
175 Ga0209813_10000883 3300027866 Bacteria 6756
176 Ga0207428_10007797 3300027907 Bacteria 9745
177 Ga0207428_10340014 3300027907 Bacteria 1106
178 Ga0268265_10026430 3300028380 Bacteria 4130
179 Ga0268265_10997178 3300028380 Bacteria 827
180 Ga0268264_10006067 3300028381 Bacteria 10212
181 Ga0307511_10100487 3300030521 Bacteria 1902
182 Ga0307513_10494074 3300031456 Bacteria 942
183 Ga0307509_10245562 3300031507 Bacteria 1578
184 Ga0307509_10709416 3300031507 Bacteria 672
185 Ga0307508_10072415 3300031616 Bacteria 3021
186 Ga0307508_10328297 3300031616 Bacteria 1121
187 Ga0307516_10143640 3300031730 Bacteria 2153
188 Ga0307507_10060183 3300033179 Bacteria 3548
189 Ga0307510_10068005 3300033180 Bacteria 3580
190 Ga0373930_0047392 3300034816 Bacteria 930
191 Ga0373936_0324180 3300035113 Bacteria 698
192 Ga0373939_0219757 3300035114 Bacteria 727
193 Ga0373931_0018275 3300035691 Bacteria 3484
194 Ga0373935_0030280 3300035692 Bacteria 3353
195 Ga0373927_0029935 3300035695 Bacteria 3551
196 Ga0373933_0212662 3300035724 Bacteria 1239
197 Ga0373925_0242008 3300037068 Bacteria 1445
198 Ga0436361_0216310 3300039447 Bacteria 1005
199 Ga0436361_1074319 3300039447 Bacteria 500
200 Ga0436362_0958351 3300039453 Bacteria 925
201 Ga0451841_0524108 3300041498 Bacteria 538
202 Ga0466964_0054704 3300044706 Bacteria 1646
203 Ga0466968_0616803 3300044735 Bacteria 549
204 Ga0466960_0073410 3300044901 Bacteria 1707
205 Ga0495603_0292034 3300046455 Bacteria 936
206 Ga0495639_0232328 3300046475 Bacteria 909
207 Ga0495662_0445098 3300046476 Bacteria 636
208 Ga0495620_0375958 3300046515 Bacteria 538
209 Ga0495628_0876362 3300046516 Bacteria 624
210 Ga0495648_0212469 3300046524 Bacteria 960
211 Ga0495645_0010074 3300046543 Bacteria 6623
212 Ga0495622_0063098 3300046557 Bacteria 1715
213 Ga0495667_0881282 3300046559 Bacteria 549
214 Ga0495634_0162034 3300046642 Bacteria 1410
215 Ga0495635_0315666 3300046663 Bacteria 1046
216 Ga0495657_0286586 3300046675 Bacteria 984
217 Ga0495599_0169823 3300046678 Bacteria 1346
218 Ga0495646_0447064 3300046680 Bacteria 668
219 Ga0495604_0291228 3300047317 Bacteria 1099
220 Ga0495674_0996636 3300047319 Bacteria 642
221 Ga0495675_0064556 3300047444 Bacteria 2316
222 Ga0496100_0215338 3300048903 Bacteria 1407
223 Ga0496100_0342095 3300048903 Bacteria 1128
224 Ga0496100_0478059 3300048903 Bacteria 958
225 Ga0496102_0011750 3300048905 Bacteria 7556
226 Ga0496102_0594023 3300048905 Bacteria 1030
227 Ga0496102_1256096 3300048905 Bacteria 660
228 Ga0496104_0509834 3300048907 Bacteria 1114
229 Ga0496104_1671946 3300048907 Bacteria 539
230 Ga0496106_0003937 3300048909 Bacteria 11089
231 Ga0496106_0003944 3300048909 Bacteria 11084
232 Ga0496107_0019932 3300048910 Bacteria 4736
233 Ga0496107_0128285 3300048910 Bacteria 1871
234 Ga0496107_1351671 3300048910 Bacteria 508
235 Ga0496108_0090644 3300048911 Bacteria 2599
236 Ga0496108_0127965 3300048911 Bacteria 2182
237 Ga0496109_0140254 3300048912 Bacteria 2260
238 Ga0496110_0297420 3300048913 Bacteria 1470
239 Ga0496112_0061410 3300048915 Bacteria 3704
240 Ga0496115_1168972 3300048918 Bacteria 580
241 Ga0496116_0166853 3300048919 Bacteria 1199
242 Ga0496118_0001550 3300048921 Bacteria 34182
243 Ga0496119_0256769 3300048922 Bacteria 879
244 Ga0496121_0000077 3300048924 Bacteria 235293
245 Ga0496124_0003919 3300048927 Bacteria 17775
246 Ga0496125_0058094 3300048928 Bacteria 3127
247 Ga0496126_0461538 3300048929 Bacteria 1021
248 nmdc:mga03683_515524_c1 3300050489 Bacteria 580
249 nmdc:mga0k408_670797_c1 3300050493 Bacteria 609
250 nmdc:mga06z11_894668_c1 3300050494 Bacteria 541
251 nmdc:mga05p37_369667_c1 3300050507 Bacteria 1683
252 nmdc:mga05p37_628173_c1 3300050507 Bacteria 1207
253 nmdc:mga05p37_94376_c1 3300050507 Bacteria 3686
254 nmdc:mga09592_10131_c1 3300050508 Bacteria 7668
255 nmdc:mga09592_1489288_c1 3300050508 Bacteria 551
256 nmdc:mga0qj67_152536_c1 3300050509 Bacteria 1874
257 nmdc:mga0qj67_95089_c1 3300050509 Bacteria 2398
258 nmdc:mga06r32_84784_c1 3300050510 Bacteria 3089
259 nmdc:mga06r32_92644_c1 3300050510 Bacteria 2955
260 nmdc:mga08y16_15248_c1 3300050511 Bacteria 8084
261 nmdc:mga08y16_17443_c1 3300050511 Bacteria 7561
262 nmdc:mga08y16_274467_c1 3300050511 Bacteria 1740
263 nmdc:mga0n895_250856_c1 3300050512 Bacteria 1796
264 nmdc:mga0n895_295434_c1 3300050512 Bacteria 1642
265 nmdc:mga0rr50_1510_c1 3300050513 Bacteria 12812
266 nmdc:mga0sz30_94711_c1 3300050516 Bacteria 1301
267 Ga0500635_0001500 3300053080 Bacteria 5609
268 Ga0500635_0095679 3300053080 Bacteria 1086
269 Ga0500566_0000091 3300053094 Bacteria 45305
270 Ga0500648_150438 3300053097 Bacteria 1239
271 Ga0500554_006312 3300053102 Bacteria 2650
272 Ga0500595_011474 3300053119 Bacteria 3469
273 Ga0500618_125663 3300053125 Bacteria 581
274 Ga0500559_0011608 3300053136 Bacteria 3762
275 Ga0500568_0006642 3300053139 Bacteria 5784
276 Ga0500573_0139427 3300053140 Bacteria 1336
277 Ga0500603_002162 3300053150 Bacteria 4340
278 Ga0500603_067468 3300053150 Bacteria 1013
279 Ga0500638_102708 3300053162 Bacteria 1331
280 Ga0500639_092248 3300053163 Bacteria 1506
281 Ga0500636_0017922 3300053177 Bacteria 4185
282 Ga0500636_0184203 3300053177 Bacteria 1118
283 Ga0500637_0000344 3300053178 Bacteria 17596
284 Ga0500637_0265428 3300053178 Bacteria 951
285 Ga0500596_031100 3300053735 Bacteria 828
286 Ga0500661_004887 3300055283 Bacteria 2507
287 Ga0075428_100107624
288 Ga0070666_10201681
289 Ga0070680_100016765
290 Ga0068868_100766954
291 Ga0070689_101354756
292 Ga0070691_10070729
293 Ga0070692_10001409
294 Ga0070675_100236199
295 Ga0070673_101388696
296 Ga0070688_100137660
297 Ga0070688_101599882
298 Ga0070703_10001251
299 Ga0070709_10008528
300 Ga0070709_10031379
301 Ga0070709_10853346
302 Ga0070714_100105567
303 Ga0070714_100214535
304 Ga0070713_100025205
305 Ga0070713_100114850
306 Ga0070710_10043469
307 Ga0070701_10136587
308 Ga0070711_100008293
309 Ga0070711_100045820
310 Ga0070705_100000025
311 Ga0070700_100003299
312 Ga0070694_100002659
313 Ga0070694_100995863
314 Ga0070708_100005472
315 Ga0070663_100372719
316 Ga0070678_101421106
317 Ga0070662_100051761
318 Ga0070681_10039538
319 Ga0070681_10278392
320 Ga0068867_100510018
321 Ga0070706_100223197
322 Ga0070707_102232408
323 Ga0070698_100106214
324 Ga0070697_100051529
325 Ga0070672_100158688
326 Ga0070686_101489506
327 Ga0070695_100001562
328 Ga0070696_100001462
329 Ga0070693_100629333
330 Ga0068855_100358820
331 Ga0068855_100398342
332 Ga0070664_100401227
333 Ga0070702_100149818
334 Ga0068859_100008042
335 Ga0068851_10173786
336 Ga0068870_10176772
337 Ga0068863_100090179
338 Ga0068863_101745061
339 Ga0068858_100227714
340 Ga0068858_100259348
341 Ga0068858_100911113
342 Ga0068860_100014163
343 Ga0068862_100002691
344 Ga0081455_10003418
345 Ga0081540_1000213
346 Ga0081540_1019434
347 Ga0070717_10460552
348 Ga0075368_10000329
349 Ga0075363_100009901
350 Ga0075363_100988773
351 Ga0070715_10064582
352 Ga0070716_100020403
353 Ga0070712_100029893
354 Ga0075367_10000701
355 Ga0075367_10197088
356 Ga0075428_100331359
357 Ga0075428_100765906
358 Ga0075430_100101156
359 Ga0075430_100255437
360 Ga0075431_100000995
361 Ga0075431_100003958
362 Ga0075431_100149670
363 Ga0075429_100008866
364 Ga0075429_100495050
365 Ga0097620_100008042
366 Ga0075435_100005313
367 Ga0099794_10132770
368 Ga0099794_10148473
369 Ga0099794_10502221
370 Ga0099794_10548088
371 Ga0099795_10057498
372 Ga0099795_10102234
373 Ga0105240_10000522
374 Ga0105240_10537548
375 Ga0111539_10005534
376 Ga0111539_10370003
377 Ga0111539_11122109
378 Ga0105245_10107585
379 Ga0114129_10105706
380 Ga0114129_10158912
381 Ga0114129_10694217
382 Ga0105243_10109413
383 Ga0105243_10868583
384 Ga0105241_10070618
385 Ga0105242_10319209
386 Ga0105248_10038903
387 Ga0105237_10039192
388 Ga0105237_11946636
389 Ga0105238_10113927
390 Ga0105249_10003429
391 Ga0105249_10229504
392 Ga0105239_10049446
393 Ga0105239_10497236
394 Ga0105239_10738033
395 Ga0105239_12933791
396 Ga0105246_10219229
397 Ga0157320_1013961
398 Ga0157370_11499490
399 Ga0157378_11168372
400 Ga0163162_10453192
401 Ga0157372_11783174
402 Ga0157372_12930228
403 Ga0163163_10189473
404 Ga0157380_10127369
405 Ga0157380_12184207
406 Ga0182008_10436667
407 Ga0157379_10146545
408 Ga0207656_10152640
409 Ga0207653_10001885
410 Ga0207692_10018653
411 Ga0207692_10835306
412 Ga0207692_11171347
413 Ga0207680_10142502
414 Ga0207680_10895961
415 Ga0207647_10130402
416 Ga0207685_10070856
417 Ga0207699_10028424
418 Ga0207699_10980526
419 Ga0207643_10157372
420 Ga0207643_10232081
421 Ga0207684_10199103
422 Ga0207654_10087985
423 Ga0207707_10210517
424 Ga0207707_10806675
425 Ga0207695_10037330
426 Ga0207671_10098852
427 Ga0207671_11232641
428 Ga0207671_11374940
429 Ga0207663_10024656
430 Ga0207663_10049846
431 Ga0207663_11503279
432 Ga0207660_10016996
433 Ga0207646_10133702
434 Ga0207694_10022602
435 Ga0207694_10554243
436 Ga0207700_10037483
437 Ga0207700_10365653
438 Ga0207664_10046078
439 Ga0207706_10025433
440 Ga0207709_10087976
441 Ga0207665_10009425
442 Ga0207665_10174606
443 Ga0207711_10607763
444 Ga0207689_10148786
445 Ga0207661_10327068
446 Ga0207667_10337202
447 Ga0207712_10028942
448 Ga0207658_11423097
449 Ga0207703_10227422
450 Ga0207678_10026427
451 Ga0207708_10005311
452 Ga0207708_10269718
453 Ga0207641_10060873
454 Ga0207641_10088610
455 Ga0207648_10466738
456 Ga0207676_10149951
457 Ga0207674_10015659
458 Ga0207698_10195964
459 Ga0209179_1105363
460 Ga0209588_1089365
461 Ga0209813_10000883
462 Ga0207428_10007797
463 Ga0207428_10340014
464 Ga0268265_10026430
465 Ga0268265_10997178
466 Ga0268264_10006067
467 Ga0307511_10100487
468 Ga0307513_10494074
469 Ga0307509_10245562
470 Ga0307509_10709416
471 Ga0307508_10072415
472 Ga0307508_10328297
473 Ga0307516_10143640
474 Ga0307507_10060183
475 Ga0307510_10068005
476 Ga0373930_0047392
477 Ga0373936_0324180
478 Ga0373939_0219757
479 Ga0373931_0018275
480 Ga0373935_0030280
481 Ga0373927_0029935
482 Ga0373933_0212662
483 Ga0373925_0242008
484 Ga0436361_0216310
485 Ga0436361_1074319
486 Ga0436362_0958351
487 Ga0451841_0524108
488 Ga0466964_0054704
489 Ga0466968_0616803
490 Ga0466960_0073410
491 Ga0495603_0292034
492 Ga0495639_0232328
493 Ga0495662_0445098
494 Ga0495620_0375958
495 Ga0495628_0876362
496 Ga0495648_0212469
497 Ga0495645_0010074
498 Ga0495622_0063098
499 Ga0495667_0881282
500 Ga0495634_0162034
501 Ga0495635_0315666
502 Ga0495657_0286586
503 Ga0495599_0169823
504 Ga0495646_0447064
505 Ga0495604_0291228
506 Ga0495674_0996636
507 Ga0495675_0064556
508 Ga0496100_0215338
509 Ga0496100_0342095
510 Ga0496100_0478059
511 Ga0496102_0011750
512 Ga0496102_0594023
513 Ga0496102_1256096
514 Ga0496104_0509834
515 Ga0496104_1671946
516 Ga0496106_0003937
517 Ga0496106_0003944
518 Ga0496107_0019932
519 Ga0496107_0128285
520 Ga0496107_1351671
521 Ga0496108_0090644
522 Ga0496108_0127965
523 Ga0496109_0140254
524 Ga0496110_0297420
525 Ga0496112_0061410
526 Ga0496115_1168972
527 Ga0496116_0166853
528 Ga0496118_0001550
529 Ga0496119_0256769
530 Ga0496121_0000077
531 Ga0496124_0003919
532 Ga0496125_0058094
533 Ga0496126_0461538
534 nmdc:mga03683_515524_c1
535 nmdc:mga0k408_670797_c1
536 nmdc:mga06z11_894668_c1
537 nmdc:mga05p37_369667_c1
538 nmdc:mga05p37_628173_c1
539 nmdc:mga05p37_94376_c1
540 nmdc:mga09592_10131_c1
541 nmdc:mga09592_1489288_c1
542 nmdc:mga0qj67_152536_c1
543 nmdc:mga0qj67_95089_c1
544 nmdc:mga06r32_84784_c1
545 nmdc:mga06r32_92644_c1
546 nmdc:mga08y16_15248_c1
547 nmdc:mga08y16_17443_c1
548 nmdc:mga08y16_274467_c1
549 nmdc:mga0n895_250856_c1
550 nmdc:mga0n895_295434_c1
551 nmdc:mga0rr50_1510_c1
552 nmdc:mga0sz30_94711_c1
553 Ga0500635_0001500
554 Ga0500635_0095679
555 Ga0500566_0000091
556 Ga0500648_150438
557 Ga0500554_006312
558 Ga0500595_011474
559 Ga0500618_125663
560 Ga0500559_0011608
561 Ga0500568_0006642
562 Ga0500573_0139427
563 Ga0500603_002162
564 Ga0500603_067468
565 Ga0500638_102708
566 Ga0500639_092248
567 Ga0500636_0017922
568 Ga0500636_0184203
569 Ga0500637_0000344
570 Ga0500637_0265428
571 Ga0500596_031100
572 Ga0500661_004887

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04993

TfoX_N

TfoX N-terminal domain

13

106

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2od0-assembly1.cif.gz_B the crystal structure of gene product vp1028 from vibrio parahaemolyticus 0.7898 5 106
2od0-assembly1.cif.gz_B the crystal structure of gene product vp1028 from vibrio parahaemolyticus 0.7762 5 106
6lnw-assembly1.cif.gz_A crystal structure of accessory secretory protein 1,2 and 3 in streptococcus pneumoniae 0.7487 19 51
5vae-assembly1.cif.gz_A crystal structure of accessory secretion protein 1 and 3 0.7452 19 53
5e9u-assembly2.cif.gz_H crystal structure of gtfa/b complex bound to udp and glcnac 0.7395 19 54
ID Description Score Start End Superfamily
af_P75869_6_107_3.30.1460.30 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,;YgaC/TfoX-N like chaperone 0.8875 6 106 3.30.1460.30
af_P75869_6_107_3.30.1460.30 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,;YgaC/TfoX-N like chaperone 0.8638 6 106 3.30.1460.30
2od0B00 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,;YgaC/TfoX-N like chaperone 0.7737 12 106 3.30.1460.30
af_Q2G1R1_5_82_3.30.1460.30 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,;YgaC/TfoX-N like chaperone 0.7226 5 86 3.30.1460.30
2od0B00 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,;YgaC/TfoX-N like chaperone 0.7206 12 106 3.30.1460.30
ID Description Score Start End GO Terms
AF-A0A521L1J2-F1-model_v4 TfoX family protein 0.9959 1 114
AF-A0A521L1J2-F1-model_v4 TfoX family protein 0.9788 1 114
AF-A0A1I3FV77-F1-model_v4 DNA transformation protein 0.9619 1 121
AF-A0A1I3FV77-F1-model_v4 DNA transformation protein 0.954 1 121
AF-A0A1G9WR51-F1-model_v4 DNA transformation protein 0.9508 1 126

Map