F386941

General Info

Members Datasets Scaffolds Average Seq Length
285 172 570 211

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0833325|Ga0395901_0833325_36_677
Length 213
Sequence MCDFHAHDLPPLADDEYVLDTARVRGFVADVRARIDRADSPASACELISPLFADLLADRDWLPAAFQEPAAHSGMGGGIGQWLVFRAADRSLSLFSLVVPPGAMTPVHDHLAWGLVGIYRGNQDEEFYAPHPGRGIELTRRRPLDPGDFYTLLPPRDDVHRVRTTSPETSVSIHLLANDTGCVWRHTFDEDTGEASPFRSGYVNAECETDRGS

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
69 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
70 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
71 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
72 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
73 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
82 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
83 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
110 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 7.72
Rhizosphere 87.02
Stem 0
Stem Tuber 0
Unclassified 14.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0833325 3300038443 Unclassified 909
2 ARcpr5yngRDRAFT_c003941 3300000043 Unclassified 1428
3 ARSoilOldRDRAFT_c001825 3300000044 Bacteria 1958
4 ARCol0yngRDRAFT_1002495 3300000652 Unclassified 1383
5 JGI25406J46586_10031817 3300003203 Bacteria 1969
6 JGI25406J46586_10037753 3300003203 Bacteria 1738
7 Ga0070676_10055871 3300005328 Unclassified 2331
8 Ga0070683_100174238 3300005329 Unclassified 2042
9 Ga0070683_100274930 3300005329 Bacteria 1602
10 Ga0070683_100630109 3300005329 Unclassified 1027
11 Ga0070677_10217668 3300005333 Bacteria 931
12 Ga0070680_100214118 3300005336 Bacteria 1626
13 Ga0070680_100365288 3300005336 Bacteria 1228
14 Ga0070682_100380227 3300005337 Bacteria 1062
15 Ga0070674_100053066 3300005356 Bacteria 2797
16 Ga0070714_100186156 3300005435 Bacteria 1892
17 Ga0070714_100600649 3300005435 Bacteria 1057
18 Ga0070714_101196200 3300005435 Bacteria 741
19 Ga0070713_100142165 3300005436 Bacteria 2127
20 Ga0070710_10009334 3300005437 Bacteria 4797
21 Ga0070711_100332393 3300005439 Bacteria 1217
22 Ga0070711_100734950 3300005439 Bacteria 833
23 Ga0070678_100313677 3300005456 Bacteria 1337
24 Ga0070681_10037075 3300005458 Bacteria 4893
25 Ga0070681_10164355 3300005458 Bacteria 2143
26 Ga0070681_10477112 3300005458 Unclassified 1160
27 Ga0070698_100440920 3300005471 Bacteria 1237
28 Ga0070698_100969365 3300005471 Bacteria 797
29 Ga0070698_101263011 3300005471 Unclassified 688
30 Ga0070679_100063428 3300005530 Bacteria 3683
31 Ga0070679_100088189 3300005530 Unclassified 3089
32 Ga0070684_100011230 3300005535 Bacteria 7131
33 Ga0070684_100478473 3300005535 Unclassified 1152
34 Ga0070693_100094730 3300005547 Bacteria 1807
35 Ga0070664_100481028 3300005564 Bacteria 1143
36 Ga0068864_101102584 3300005618 Bacteria 790
37 Ga0068861_100048294 3300005719 Unclassified 3217
38 Ga0081539_10000171 3300005985 Bacteria 152572
39 Ga0070717_10248493 3300006028 Bacteria 1571
40 Ga0070712_100071774 3300006175 Bacteria 2478
41 Ga0070712_100086995 3300006175 Bacteria 2279
42 Ga0075367_10082751 3300006178 Unclassified 1944
43 Ga0075428_100001897 3300006844 Bacteria 22426
44 Ga0075433_10243741 3300006852 Unclassified 1595
45 Ga0075434_100645477 3300006871 Bacteria 1077
46 Ga0075429_100318333 3300006880 Unclassified 1361
47 Ga0105240_10733964 3300009093 Unclassified 1075
48 Ga0111539_10027858 3300009094 Bacteria 6899
49 Ga0105245_10013332 3300009098 Bacteria 7162
50 Ga0105245_10149645 3300009098 Bacteria 2206
51 Ga0114129_10005548 3300009147 Bacteria 17845
52 Ga0114129_10032172 3300009147 Bacteria 7415
53 Ga0105242_10564431 3300009176 Bacteria 1094
54 Ga0105249_10632261 3300009553 Bacteria 1127
55 Ga0105239_10043321 3300010375 Bacteria 4933
56 Ga0105239_10654930 3300010375 Bacteria 1200
57 Ga0105246_10296180 3300011119 Bacteria 1304
58 Ga0105246_10327974 3300011119 Unclassified 1246
59 Ga0163162_10700497 3300013306 Bacteria 1134
60 Ga0157375_10239790 3300013308 Bacteria 1973
61 Ga0157375_10266265 3300013308 Bacteria 1875
62 Ga0163163_10324796 3300014325 Bacteria 1593
63 Ga0157380_10031618 3300014326 Bacteria 4065
64 Ga0182008_10171585 3300014497 Unclassified 1095
65 Ga0157377_10064838 3300014745 Bacteria 2096
66 Ga0157377_10086953 3300014745 Unclassified 1838
67 Ga0213874_10001954 3300021377 Bacteria 4337
68 Ga0213876_10008029 3300021384 Bacteria 5721
69 Ga0207699_10067303 3300025906 Bacteria 2177
70 Ga0207645_10403683 3300025907 Bacteria 919
71 Ga0207707_10064273 3300025912 Bacteria 3194
72 Ga0207707_10077595 3300025912 Bacteria 2900
73 Ga0207693_10002813 3300025915 Bacteria 15077
74 Ga0207693_10223449 3300025915 Bacteria 1479
75 Ga0207693_10407033 3300025915 Unclassified 1063
76 Ga0207657_10116729 3300025919 Bacteria 2199
77 Ga0207649_10165102 3300025920 Unclassified 1537
78 Ga0207652_10386766 3300025921 Bacteria 1262
79 Ga0207659_10624691 3300025926 Unclassified 919
80 Ga0207687_10093182 3300025927 Bacteria 2201
81 Ga0207700_10028845 3300025928 Bacteria 3910
82 Ga0207700_10188231 3300025928 Bacteria 1733
83 Ga0207664_10206578 3300025929 Bacteria 1698
84 Ga0207664_10305686 3300025929 Bacteria 1400
85 Ga0207706_10143079 3300025933 Unclassified 2104
86 Ga0207709_10111500 3300025935 Bacteria 1830
87 Ga0207669_10056908 3300025937 Bacteria 2377
88 Ga0207669_10369063 3300025937 Bacteria 1115
89 Ga0207661_10138213 3300025944 Bacteria 2094
90 Ga0207679_10425329 3300025945 Unclassified 1173
91 Ga0207679_10614700 3300025945 Unclassified 980
92 Ga0207675_100046092 3300026118 Unclassified 4072
93 Ga0207683_10325684 3300026121 Bacteria 1408
94 Ga0207428_10013780 3300027907 Bacteria 7047
95 Ga0373958_0059328 3300034819 Unclassified 826
96 Ga0373934_0049966 3300035086 Bacteria 1657
97 Ga0373936_0198618 3300035113 Bacteria 885
98 Ga0373953_0183448 3300035117 Bacteria 903
99 Ga0373956_0086736 3300035119 Unclassified 1441
100 Ga0373956_0132010 3300035119 Bacteria 1170
101 Ga0373924_0014155 3300035410 Bacteria 3011
102 Ga0373937_0007807 3300036401 Bacteria 9277
103 Ga0373937_0027404 3300036401 Bacteria 5153
104 Ga0395900_0541426 3300037418 Bacteria 1110
105 Ga0395898_0030809 3300037466 Bacteria 5366
106 Ga0436364_0911431 3300037853 Bacteria 7252
107 Ga0436364_1103284 3300037853 Bacteria 2035
108 Ga0436365_0095393 3300039437 Bacteria 1341
109 Ga0436365_0462510 3300039437 Unclassified 4215
110 Ga0436365_0572237 3300039437 Bacteria 18242
111 Ga0436365_1049951 3300039437 Bacteria 9712
112 Ga0436365_1294192 3300039437 Bacteria 1720
113 Ga0436365_1697510 3300039437 Bacteria 3902
114 Ga0436360_1286447 3300039438 Unclassified 991
115 Ga0436361_0476442 3300039447 Bacteria 1445
116 Ga0436363_0275177 3300039450 Bacteria 88978
117 Ga0436363_1269094 3300039450 Unclassified 826
118 Ga0436362_0648280 3300039453 Bacteria 1137
119 Ga0451807_0390620 3300041486 Bacteria 732
120 Ga0466963_0066502 3300044694 Bacteria 2418
121 Ga0466964_0232748 3300044706 Archaea 900
122 Ga0466971_0166086 3300044719 Archaea 1034
123 Ga0466968_0046979 3300044735 Bacteria 1835
124 Ga0466968_0198091 3300044735 Unclassified 940
125 Ga0466968_0234553 3300044735 Bacteria 867
126 Ga0466959_0133850 3300045049 Bacteria 1756
127 Ga0466959_0161492 3300045049 Unclassified 1575
128 Ga0451576_0108259 3300045051 Bacteria 2892
129 Ga0466958_0207152 3300045836 Bacteria 1249
130 Ga0466967_0009835 3300045976 Bacteria 7132
131 Ga0466967_0288254 3300045976 Bacteria 1577
132 Ga0495592_0003913 3300046454 Bacteria 10782
133 Ga0495603_0227453 3300046455 Bacteria 1076
134 Ga0495651_0021606 3300046462 Bacteria 5002
135 Ga0495653_0036645 3300046463 Bacteria 3862
136 Ga0495653_0554094 3300046463 Bacteria 711
137 Ga0495662_0166013 3300046476 Bacteria 1088
138 Ga0495596_0076079 3300046500 Unclassified 1304
139 Ga0495608_0008891 3300046511 Bacteria 7021
140 Ga0495628_0028144 3300046516 Bacteria 4570
141 Ga0495628_0293500 3300046516 Bacteria 1205
142 Ga0495630_0317657 3300046517 Bacteria 1191
143 Ga0495630_0445187 3300046517 Bacteria 993
144 Ga0495652_0437348 3300046529 Bacteria 918
145 Ga0495640_0094013 3300046533 Bacteria 1975
146 Ga0495587_0055936 3300046536 Bacteria 2322
147 Ga0495667_0012925 3300046559 Bacteria 5658
148 Ga0495667_0026128 3300046559 Bacteria 3933
149 Ga0495667_0489551 3300046559 Bacteria 771
150 Ga0495634_0094605 3300046642 Bacteria 1936
151 Ga0495635_0021934 3300046663 Bacteria 4450
152 Ga0495657_0047108 3300046675 Bacteria 2916
153 Ga0495657_0274299 3300046675 Bacteria 1010
154 Ga0495599_0323270 3300046678 Bacteria 928
155 Ga0495623_0279913 3300046679 Bacteria 928
156 Ga0495646_0062526 3300046680 Bacteria 2213
157 Ga0495600_0006155 3300046809 Bacteria 7274
158 Ga0495674_0046135 3300047319 Bacteria 3868
159 Ga0495680_0002500 3300047322 Bacteria 18803
160 Ga0495680_0474019 3300047322 Bacteria 853
161 Ga0495675_0233196 3300047444 Bacteria 1110
162 Ga0495684_0067615 3300047471 Bacteria 2717
163 Ga0495593_0394630 3300047673 Bacteria 692
164 Ga0495602_0010648 3300048088 Bacteria 9539
165 Ga0496101_0311230 3300048904 Bacteria 1235
166 Ga0496102_0645587 3300048905 Bacteria 982
167 Ga0496104_0094315 3300048907 Bacteria 2863
168 Ga0496104_0158298 3300048907 Bacteria 2173
169 Ga0496104_0182419 3300048907 Bacteria 2009
170 Ga0496105_0210729 3300048908 Bacteria 1584
171 Ga0496105_0490639 3300048908 Unclassified 965
172 Ga0496106_0327476 3300048909 Bacteria 1230
173 Ga0496106_0799701 3300048909 Unclassified 748
174 Ga0496108_0271332 3300048911 Bacteria 1477
175 Ga0496109_0073773 3300048912 Bacteria 3136
176 Ga0496109_0366871 3300048912 Bacteria 1360
177 Ga0496109_0571990 3300048912 Bacteria 1065
178 Ga0496109_0835233 3300048912 Bacteria 859
179 Ga0496110_0502768 3300048913 Bacteria 1103
180 Ga0496111_0351157 3300048914 Bacteria 1092
181 Ga0496112_0012287 3300048915 Bacteria 7864
182 Ga0496113_0021541 3300048916 Bacteria 4548
183 Ga0496114_0211917 3300048917 Bacteria 1699
184 Ga0496114_0243126 3300048917 Bacteria 1583
185 Ga0496114_0270810 3300048917 Bacteria 1496
186 Ga0501031_0032308 3300049568 Bacteria 3412
187 Ga0501031_0102724 3300049568 Unclassified 1865
188 Ga0501031_0338850 3300049568 Bacteria 973
189 Ga0501032_0021577 3300049569 Bacteria 4475
190 Ga0501032_0055136 3300049569 Bacteria 2674
191 Ga0501033_0009376 3300049570 Bacteria 7535
192 Ga0501033_0117443 3300049570 Bacteria 1932
193 Ga0501034_0061490 3300049571 Bacteria 3771
194 Ga0501036_0013090 3300049572 Bacteria 6891
195 Ga0501036_0089963 3300049572 Bacteria 2593
196 Ga0501036_0499441 3300049572 Bacteria 1012
197 Ga0501036_0543557 3300049572 Bacteria 965
198 Ga0501037_0020653 3300049573 Bacteria 4862
199 Ga0501037_0077794 3300049573 Bacteria 2407
200 Ga0501038_0017003 3300049574 Bacteria 6582
201 Ga0501038_0029451 3300049574 Bacteria 4864
202 Ga0501039_0057500 3300049575 Bacteria 3011
203 Ga0501039_0212184 3300049575 Bacteria 1522
204 Ga0501040_0011663 3300049576 Bacteria 5751
205 Ga0501040_0021077 3300049576 Bacteria 4346
206 Ga0501040_0033289 3300049576 Bacteria 3490
207 Ga0501041_0005957 3300049577 Bacteria 7131
208 Ga0501041_0054254 3300049577 Bacteria 2445
209 Ga0501041_0089922 3300049577 Bacteria 1895
210 Ga0501042_0010037 3300049578 Bacteria 6331
211 Ga0501042_0046461 3300049578 Bacteria 3095
212 Ga0501043_0014607 3300049579 Bacteria 6148
213 Ga0501043_0033072 3300049579 Bacteria 4067
214 Ga0501043_0086330 3300049579 Bacteria 2466
215 Ga0501046_0042338 3300049580 Bacteria 3631
216 Ga0501046_0054191 3300049580 Unclassified 3156
217 Ga0501048_0037717 3300049582 Bacteria 3470
218 Ga0501048_0045557 3300049582 Bacteria 3133
219 Ga0501048_0053358 3300049582 Bacteria 2875
220 Ga0501048_0255295 3300049582 Bacteria 1245
221 Ga0501068_0006144 3300049584 Bacteria 6606
222 Ga0501068_0009687 3300049584 Bacteria 5395
223 Ga0501068_0021981 3300049584 Bacteria 3728
224 Ga0501068_0069185 3300049584 Bacteria 2152
225 Ga0501069_0010963 3300049585 Bacteria 4806
226 Ga0501069_0073657 3300049585 Bacteria 1915
227 Ga0501069_0157486 3300049585 Bacteria 1307
228 Ga0501070_0012551 3300049586 Bacteria 7145
229 Ga0501070_0024001 3300049586 Bacteria 5113
230 Ga0501071_0050007 3300049587 Bacteria 3010
231 Ga0501071_0086850 3300049587 Bacteria 2294
232 Ga0501071_0117383 3300049587 Bacteria 1970
233 Ga0501072_0024730 3300049588 Bacteria 4674
234 Ga0501072_0042948 3300049588 Bacteria 3552
235 Ga0501073_0024287 3300049589 Bacteria 4352
236 Ga0501073_0131149 3300049589 Bacteria 1737
237 Ga0501073_0179701 3300049589 Bacteria 1464
238 Ga0501075_0021684 3300049591 Bacteria 4685
239 Ga0501075_0038062 3300049591 Bacteria 3595
240 Ga0501076_0010096 3300049592 Bacteria 6990
241 Ga0501076_0046579 3300049592 Bacteria 3426
242 Ga0501076_0077521 3300049592 Bacteria 2666
243 Ga0501076_0409827 3300049592 Bacteria 1115
244 Ga0501077_0002678 3300049593 Bacteria 10680
245 Ga0501077_0003461 3300049593 Bacteria 9474
246 Ga0501077_0094755 3300049593 Bacteria 1893
247 Ga0501077_0094766 3300049593 Bacteria 1892
248 Ga0501079_0010965 3300049741 Bacteria 6906
249 Ga0501079_0028890 3300049741 Bacteria 4255
250 Ga0501079_0094270 3300049741 Bacteria 2319
251 Ga0501080_0004249 3300049742 Bacteria 12711
252 Ga0501080_0384340 3300049742 Bacteria 1264
253 Ga0501081_0005696 3300049743 Bacteria 8061
254 Ga0501081_0096196 3300049743 Bacteria 2088
255 Ga0501081_0550980 3300049743 Unclassified 861
256 Ga0501083_0012494 3300049744 Bacteria 5939
257 Ga0501083_0056481 3300049744 Bacteria 2630
258 Ga0501035_0050829 3300049822 Bacteria 3713
259 Ga0501035_0051324 3300049822 Bacteria 3693
260 Ga0501035_0149758 3300049822 Bacteria 2026
261 Ga0501044_0054188 3300049823 Bacteria 4124
262 Ga0501044_0579781 3300049823 Bacteria 1016
263 Ga0501045_0009310 3300049824 Bacteria 6871
264 Ga0501045_0025049 3300049824 Bacteria 4286
265 nmdc:mga0yw44_223728_c1 3300050492 Unclassified 1248
266 nmdc:mga06z11_135621_c1 3300050494 Unclassified 1386
267 nmdc:mga05p37_10821_c1 3300050507 Bacteria 10831
268 nmdc:mga05p37_6139_c1 3300050507 Bacteria 14140
269 nmdc:mga09592_63050_c1 3300050508 Bacteria 3136
270 nmdc:mga08y16_10167_c1 3300050511 Bacteria 9877
271 nmdc:mga0a205_317271_c1 3300050515 Unclassified 1430
272 Ga0495612_0018268 3300053078 Bacteria 2809
273 Ga0495595_0088482 3300053084 Bacteria 1483
274 Ga0495595_0169808 3300053084 Bacteria 1079
275 Ga0495619_0071590 3300053085 Bacteria 2320
276 Ga0495619_0175754 3300053085 Bacteria 1481
277 Ga0501084_0032742 3300054114 Bacteria 4349
278 Ga0501084_0781132 3300054114 Bacteria 804
279 Ga0501082_0004390 3300060353 Bacteria 12314
280 Ga0501082_0077164 3300060353 Bacteria 2872
281 Ga0501082_0273301 3300060353 Bacteria 1471
282 Ga0466962_0026936 3300061719 Unclassified 2760
283 Ga0530510_0024230 3300061734 Bacteria 4329
284 Ga0530510_0176937 3300061734 Bacteria 1581
285 Ga0530510_0197070 3300061734 Bacteria 1495
286 Ga0395901_0833325
287 ARcpr5yngRDRAFT_c003941
288 ARSoilOldRDRAFT_c001825
289 ARCol0yngRDRAFT_1002495
290 JGI25406J46586_10031817
291 JGI25406J46586_10037753
292 Ga0070676_10055871
293 Ga0070683_100174238
294 Ga0070683_100274930
295 Ga0070683_100630109
296 Ga0070677_10217668
297 Ga0070680_100214118
298 Ga0070680_100365288
299 Ga0070682_100380227
300 Ga0070674_100053066
301 Ga0070714_100186156
302 Ga0070714_100600649
303 Ga0070714_101196200
304 Ga0070713_100142165
305 Ga0070710_10009334
306 Ga0070711_100332393
307 Ga0070711_100734950
308 Ga0070678_100313677
309 Ga0070681_10037075
310 Ga0070681_10164355
311 Ga0070681_10477112
312 Ga0070698_100440920
313 Ga0070698_100969365
314 Ga0070698_101263011
315 Ga0070679_100063428
316 Ga0070679_100088189
317 Ga0070684_100011230
318 Ga0070684_100478473
319 Ga0070693_100094730
320 Ga0070664_100481028
321 Ga0068864_101102584
322 Ga0068861_100048294
323 Ga0081539_10000171
324 Ga0070717_10248493
325 Ga0070712_100071774
326 Ga0070712_100086995
327 Ga0075367_10082751
328 Ga0075428_100001897
329 Ga0075433_10243741
330 Ga0075434_100645477
331 Ga0075429_100318333
332 Ga0105240_10733964
333 Ga0111539_10027858
334 Ga0105245_10013332
335 Ga0105245_10149645
336 Ga0114129_10005548
337 Ga0114129_10032172
338 Ga0105242_10564431
339 Ga0105249_10632261
340 Ga0105239_10043321
341 Ga0105239_10654930
342 Ga0105246_10296180
343 Ga0105246_10327974
344 Ga0163162_10700497
345 Ga0157375_10239790
346 Ga0157375_10266265
347 Ga0163163_10324796
348 Ga0157380_10031618
349 Ga0182008_10171585
350 Ga0157377_10064838
351 Ga0157377_10086953
352 Ga0213874_10001954
353 Ga0213876_10008029
354 Ga0207699_10067303
355 Ga0207645_10403683
356 Ga0207707_10064273
357 Ga0207707_10077595
358 Ga0207693_10002813
359 Ga0207693_10223449
360 Ga0207693_10407033
361 Ga0207657_10116729
362 Ga0207649_10165102
363 Ga0207652_10386766
364 Ga0207659_10624691
365 Ga0207687_10093182
366 Ga0207700_10028845
367 Ga0207700_10188231
368 Ga0207664_10206578
369 Ga0207664_10305686
370 Ga0207706_10143079
371 Ga0207709_10111500
372 Ga0207669_10056908
373 Ga0207669_10369063
374 Ga0207661_10138213
375 Ga0207679_10425329
376 Ga0207679_10614700
377 Ga0207675_100046092
378 Ga0207683_10325684
379 Ga0207428_10013780
380 Ga0373958_0059328
381 Ga0373934_0049966
382 Ga0373936_0198618
383 Ga0373953_0183448
384 Ga0373956_0086736
385 Ga0373956_0132010
386 Ga0373924_0014155
387 Ga0373937_0007807
388 Ga0373937_0027404
389 Ga0395900_0541426
390 Ga0395898_0030809
391 Ga0436364_0911431
392 Ga0436364_1103284
393 Ga0436365_0095393
394 Ga0436365_0462510
395 Ga0436365_0572237
396 Ga0436365_1049951
397 Ga0436365_1294192
398 Ga0436365_1697510
399 Ga0436360_1286447
400 Ga0436361_0476442
401 Ga0436363_0275177
402 Ga0436363_1269094
403 Ga0436362_0648280
404 Ga0451807_0390620
405 Ga0466963_0066502
406 Ga0466964_0232748
407 Ga0466971_0166086
408 Ga0466968_0046979
409 Ga0466968_0198091
410 Ga0466968_0234553
411 Ga0466959_0133850
412 Ga0466959_0161492
413 Ga0451576_0108259
414 Ga0466958_0207152
415 Ga0466967_0009835
416 Ga0466967_0288254
417 Ga0495592_0003913
418 Ga0495603_0227453
419 Ga0495651_0021606
420 Ga0495653_0036645
421 Ga0495653_0554094
422 Ga0495662_0166013
423 Ga0495596_0076079
424 Ga0495608_0008891
425 Ga0495628_0028144
426 Ga0495628_0293500
427 Ga0495630_0317657
428 Ga0495630_0445187
429 Ga0495652_0437348
430 Ga0495640_0094013
431 Ga0495587_0055936
432 Ga0495667_0012925
433 Ga0495667_0026128
434 Ga0495667_0489551
435 Ga0495634_0094605
436 Ga0495635_0021934
437 Ga0495657_0047108
438 Ga0495657_0274299
439 Ga0495599_0323270
440 Ga0495623_0279913
441 Ga0495646_0062526
442 Ga0495600_0006155
443 Ga0495674_0046135
444 Ga0495680_0002500
445 Ga0495680_0474019
446 Ga0495675_0233196
447 Ga0495684_0067615
448 Ga0495593_0394630
449 Ga0495602_0010648
450 Ga0496101_0311230
451 Ga0496102_0645587
452 Ga0496104_0094315
453 Ga0496104_0158298
454 Ga0496104_0182419
455 Ga0496105_0210729
456 Ga0496105_0490639
457 Ga0496106_0327476
458 Ga0496106_0799701
459 Ga0496108_0271332
460 Ga0496109_0073773
461 Ga0496109_0366871
462 Ga0496109_0571990
463 Ga0496109_0835233
464 Ga0496110_0502768
465 Ga0496111_0351157
466 Ga0496112_0012287
467 Ga0496113_0021541
468 Ga0496114_0211917
469 Ga0496114_0243126
470 Ga0496114_0270810
471 Ga0501031_0032308
472 Ga0501031_0102724
473 Ga0501031_0338850
474 Ga0501032_0021577
475 Ga0501032_0055136
476 Ga0501033_0009376
477 Ga0501033_0117443
478 Ga0501034_0061490
479 Ga0501036_0013090
480 Ga0501036_0089963
481 Ga0501036_0499441
482 Ga0501036_0543557
483 Ga0501037_0020653
484 Ga0501037_0077794
485 Ga0501038_0017003
486 Ga0501038_0029451
487 Ga0501039_0057500
488 Ga0501039_0212184
489 Ga0501040_0011663
490 Ga0501040_0021077
491 Ga0501040_0033289
492 Ga0501041_0005957
493 Ga0501041_0054254
494 Ga0501041_0089922
495 Ga0501042_0010037
496 Ga0501042_0046461
497 Ga0501043_0014607
498 Ga0501043_0033072
499 Ga0501043_0086330
500 Ga0501046_0042338
501 Ga0501046_0054191
502 Ga0501048_0037717
503 Ga0501048_0045557
504 Ga0501048_0053358
505 Ga0501048_0255295
506 Ga0501068_0006144
507 Ga0501068_0009687
508 Ga0501068_0021981
509 Ga0501068_0069185
510 Ga0501069_0010963
511 Ga0501069_0073657
512 Ga0501069_0157486
513 Ga0501070_0012551
514 Ga0501070_0024001
515 Ga0501071_0050007
516 Ga0501071_0086850
517 Ga0501071_0117383
518 Ga0501072_0024730
519 Ga0501072_0042948
520 Ga0501073_0024287
521 Ga0501073_0131149
522 Ga0501073_0179701
523 Ga0501075_0021684
524 Ga0501075_0038062
525 Ga0501076_0010096
526 Ga0501076_0046579
527 Ga0501076_0077521
528 Ga0501076_0409827
529 Ga0501077_0002678
530 Ga0501077_0003461
531 Ga0501077_0094755
532 Ga0501077_0094766
533 Ga0501079_0010965
534 Ga0501079_0028890
535 Ga0501079_0094270
536 Ga0501080_0004249
537 Ga0501080_0384340
538 Ga0501081_0005696
539 Ga0501081_0096196
540 Ga0501081_0550980
541 Ga0501083_0012494
542 Ga0501083_0056481
543 Ga0501035_0050829
544 Ga0501035_0051324
545 Ga0501035_0149758
546 Ga0501044_0054188
547 Ga0501044_0579781
548 Ga0501045_0009310
549 Ga0501045_0025049
550 nmdc:mga0yw44_223728_c1
551 nmdc:mga06z11_135621_c1
552 nmdc:mga05p37_10821_c1
553 nmdc:mga05p37_6139_c1
554 nmdc:mga09592_63050_c1
555 nmdc:mga08y16_10167_c1
556 nmdc:mga0a205_317271_c1
557 Ga0495612_0018268
558 Ga0495595_0088482
559 Ga0495595_0169808
560 Ga0495619_0071590
561 Ga0495619_0175754
562 Ga0501084_0032742
563 Ga0501084_0781132
564 Ga0501082_0004390
565 Ga0501082_0077164
566 Ga0501082_0273301
567 Ga0466962_0026936
568 Ga0530510_0024230
569 Ga0530510_0176937
570 Ga0530510_0197070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kov-assembly1.cif.gz_B crystal structure of azotobacter vinelandii 3-mercaptopropionic acid dioxygenase in complex with thiocyanate 0.9141 24 204
6xb9-assembly6.cif.gz_L crystal structure of azotobacter vinelandii 3-mercaptopropionic acid dioxygenase in complex with 3-hydroxypropionic acid 0.9122 24 204
6xb9-assembly1.cif.gz_F-2 crystal structure of azotobacter vinelandii 3-mercaptopropionic acid dioxygenase in complex with 3-hydroxypropionic acid 0.9052 24 204
4qma-assembly1.cif.gz_A crystal structure of a putative cysteine dioxygnase from ralstonia eutropha: an alternative modeling of 2gm6 from jcsg target 361076 0.9009 24 202
4tlf-assembly2.cif.gz_B crystal structure of thiol dioxygenase from pseudomonas aeruginosa 0.8999 24 204
ID Description Score Start End Superfamily
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8938 80 175 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.893 80 175 2.60.120.10
4qmaA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8781 61 202 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8762 77 175 2.60.120.10
af_P0A9U6_79_184_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.86 91 175 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A538J371-F1-model_v4 Cysteine dioxygenase 0.9469 15 209
AF-A0A1G9C2X1-F1-model_v4 Predicted metal-dependent enzyme of the double-stranded beta helix superfamily 0.9401 16 207
AF-A0A1Z4HGM6-F1-model_v4 deleted 0.9359 4 205
AF-A0A6L7U6N7-F1-model_v4 Cysteine dioxygenase 0.9309 15 209
AF-A0A538J371-F1-model_v4 Cysteine dioxygenase 0.9239 15 209

Map