F386586

General Info

Members Datasets Scaffolds Average Seq Length
285 210 570 91

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100418953|Ga0070690_1004189532
Length 91
Sequence MPQYVIERDVPGAHKMTEAEVRELAGKSVAVLNELGPQIQWNQSYVTENEVYCIYLAPDEATIRQHAQRVGIPASRVAAVRRLMTTFDAGA

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
87 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
89 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
104 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
118 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
119 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
120 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
198 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
201 2511231031 Pseudomonas sp. GM16 Isolate Nodule
202 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
203 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
204 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
205 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
206 2773857673 Pseudomonas sp. 443 Isolate Unclassified
207 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
208 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
209 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
210 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.79
Metatranscriptomes 0.7
Isolates 3.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0.7
Rhizoplane 0.7
Rhizosphere 92.98
Stem 0
Stem Tuber 0
Unclassified 8.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100418953 3300005330 Bacteria 987
2 JGI24739J22299_10003649 3300001989 Bacteria 5876
3 rootH2_10086332 3300003320 Bacteria 6199
4 Ga0070683_100090071 3300005329 Bacteria 2880
5 Ga0070680_100165393 3300005336 Bacteria 1860
6 Ga0070680_100475910 3300005336 Bacteria 1067
7 Ga0070660_100067684 3300005339 Bacteria 2783
8 Ga0070660_100283770 3300005339 Bacteria 1355
9 Ga0070660_101342075 3300005339 Bacteria 607
10 Ga0070691_10345146 3300005341 Bacteria 825
11 Ga0070661_100447630 3300005344 Bacteria 1027
12 Ga0070669_100091114 3300005353 Bacteria 2286
13 Ga0070659_100263184 3300005366 Bacteria 1431
14 Ga0070714_100134893 3300005435 Bacteria 2210
15 Ga0070714_101555179 3300005435 Unclassified 646
16 Ga0070713_100061767 3300005436 Bacteria 3135
17 Ga0070713_100166923 3300005436 Bacteria 1969
18 Ga0070713_100408616 3300005436 Bacteria 1269
19 Ga0070713_101411778 3300005436 Bacteria 675
20 Ga0070713_102272669 3300005436 Unclassified 525
21 Ga0070700_101494269 3300005441 Bacteria 574
22 Ga0070694_100859817 3300005444 Bacteria 747
23 Ga0070708_100738665 3300005445 Bacteria 926
24 Ga0070708_100750928 3300005445 Bacteria 917
25 Ga0070663_100275432 3300005455 Bacteria 1339
26 Ga0070681_10269307 3300005458 Bacteria 1615
27 Ga0070681_10775204 3300005458 Bacteria 876
28 Ga0070706_100015614 3300005467 Bacteria 7015
29 Ga0070706_100151259 3300005467 Bacteria 2166
30 Ga0070706_101381788 3300005467 Unclassified 645
31 Ga0070698_101519510 3300005471 Bacteria 621
32 Ga0070699_100020563 3300005518 Bacteria 5694
33 Ga0070699_100439277 3300005518 Bacteria 1182
34 Ga0070699_101259774 3300005518 Unclassified 678
35 Ga0070697_100008258 3300005536 Bacteria 8124
36 Ga0070697_100397067 3300005536 Bacteria 1196
37 Ga0070697_100440210 3300005536 Bacteria 1134
38 Ga0068853_100903317 3300005539 Bacteria 848
39 Ga0070695_101234105 3300005545 Bacteria 616
40 Ga0070696_100215568 3300005546 Bacteria 1438
41 Ga0070696_100379779 3300005546 Bacteria 1101
42 Ga0070693_100536443 3300005547 Unclassified 835
43 Ga0070693_100537111 3300005547 Bacteria 835
44 Ga0070665_100327416 3300005548 Bacteria 1536
45 Ga0070704_100243028 3300005549 Bacteria 1474
46 Ga0070704_100921442 3300005549 Bacteria 787
47 Ga0068855_100237371 3300005563 Bacteria 2038
48 Ga0068851_10492116 3300005834 Bacteria 734
49 Ga0068860_101121450 3300005843 Bacteria 806
50 Ga0068862_100042440 3300005844 Bacteria 3875
51 Ga0070717_10062554 3300006028 Bacteria 3087
52 Ga0070717_10208804 3300006028 Bacteria 1713
53 Ga0070716_100747033 3300006173 Bacteria 752
54 Ga0097621_100070659 3300006237 Bacteria 2883
55 Ga0068871_100038561 3300006358 Bacteria 3817
56 Ga0075428_100755436 3300006844 Bacteria 1034
57 Ga0075431_101331594 3300006847 Unclassified 679
58 Ga0075433_10086461 3300006852 Bacteria 2768
59 Ga0075433_10245618 3300006852 Bacteria 1589
60 Ga0075433_11413362 3300006852 Bacteria 602
61 Ga0075433_11558571 3300006852 Bacteria 570
62 Ga0075434_100083218 3300006871 Bacteria 3197
63 Ga0075434_100114738 3300006871 Bacteria 2707
64 Ga0075434_100672040 3300006871 Bacteria 1054
65 Ga0075434_101724621 3300006871 Bacteria 634
66 Ga0075429_100442018 3300006880 Bacteria 1140
67 Ga0075429_101180476 3300006880 Bacteria 668
68 Ga0075436_100042260 3300006914 Bacteria 3144
69 Ga0079104_1023672 3300006946 Bacteria 1629
70 Ga0075435_100153600 3300007076 Bacteria 1936
71 Ga0075435_100569264 3300007076 Bacteria 982
72 Ga0105240_10442467 3300009093 Bacteria 1456
73 Ga0105240_11652842 3300009093 Bacteria 669
74 Ga0105240_12097330 3300009093 Bacteria 587
75 Ga0111539_10229067 3300009094 Bacteria 2164
76 Ga0114129_10259949 3300009147 Bacteria 2327
77 Ga0114129_10448761 3300009147 Bacteria 1692
78 Ga0105237_11727011 3300009545 Unclassified 633
79 Ga0105238_12115945 3300009551 Bacteria 597
80 Ga0157373_10095835 3300013100 Bacteria 2089
81 Ga0157373_11205556 3300013100 Bacteria 571
82 Ga0157373_11253324 3300013100 Bacteria 560
83 Ga0157374_10067574 3300013296 Bacteria 3360
84 Ga0157374_10502939 3300013296 Bacteria 1216
85 Ga0157372_10133649 3300013307 Bacteria 2856
86 Ga0163163_10563596 3300014325 Bacteria 1202
87 Ga0157376_10363671 3300014969 Bacteria 1388
88 Ga0163161_10911091 3300017792 Bacteria 745
89 Ga0213874_10040842 3300021377 Bacteria 1387
90 Ga0207699_10027808 3300025906 Bacteria 3136
91 Ga0207705_10073266 3300025909 Bacteria 2485
92 Ga0207684_10048248 3300025910 Bacteria 3611
93 Ga0207684_10487261 3300025910 Bacteria 1057
94 Ga0207684_11431092 3300025910 Bacteria 565
95 Ga0207707_10062695 3300025912 Bacteria 3235
96 Ga0207707_10830739 3300025912 Bacteria 768
97 Ga0207695_11554953 3300025913 Bacteria 542
98 Ga0207671_11591074 3300025914 Unclassified 503
99 Ga0207660_10171014 3300025917 Unclassified 1682
100 Ga0207660_10543546 3300025917 Bacteria 944
101 Ga0207657_10380891 3300025919 Bacteria 1111
102 Ga0207700_10126245 3300025928 Bacteria 2082
103 Ga0207700_10626129 3300025928 Bacteria 958
104 Ga0207700_11652120 3300025928 Bacteria 566
105 Ga0207664_10080829 3300025929 Bacteria 2643
106 Ga0207664_11480400 3300025929 Bacteria 600
107 Ga0207644_11766099 3300025931 Bacteria 518
108 Ga0207686_10226524 3300025934 Bacteria 1353
109 Ga0207661_10162203 3300025944 Bacteria 1940
110 Ga0207667_10131163 3300025949 Bacteria 2581
111 Ga0207640_10722079 3300025981 Bacteria 856
112 Ga0207678_10126932 3300026067 Bacteria 2176
113 Ga0207678_10504957 3300026067 Bacteria 1054
114 Ga0207702_10200410 3300026078 Bacteria 1850
115 Ga0209967_1001982 3300027364 Bacteria 2638
116 Ga0209968_1022740 3300027526 Bacteria 1024
117 Ga0209999_1060326 3300027543 Bacteria 721
118 Ga0209982_1007237 3300027552 Bacteria 1621
119 Ga0209983_1087861 3300027665 Bacteria 699
120 Ga0209966_1025126 3300027695 Bacteria 1181
121 Ga0209974_10256537 3300027876 Bacteria 659
122 Ga0207428_10360688 3300027907 Bacteria 1068
123 Ga0268266_10311791 3300028379 Bacteria 1470
124 Ga0268265_10079217 3300028380 Unclassified 2587
125 Ga0268265_10083286 3300028380 Bacteria 2532
126 Ga0268264_10765109 3300028381 Bacteria 963
127 Ga0265336_10000798 3300028666 Bacteria 16614
128 Ga0265338_10120479 3300028800 Bacteria 2092
129 Ga0307511_10006713 3300030521 Bacteria 11592
130 Ga0265760_10012806 3300031090 Bacteria 2400
131 Ga0265328_10009220 3300031239 Bacteria 4026
132 Ga0265328_10234233 3300031239 Bacteria 701
133 Ga0265328_10351281 3300031239 Bacteria 574
134 Ga0265329_10188605 3300031242 Bacteria 676
135 Ga0265339_10011972 3300031249 Bacteria 5316
136 Ga0265339_10081625 3300031249 Bacteria 1708
137 Ga0265327_10020827 3300031251 Bacteria 3980
138 Ga0265316_10435114 3300031344 Bacteria 942
139 Ga0307514_10001054 3300031649 Bacteria 39555
140 Ga0265314_10027446 3300031711 Bacteria 4262
141 Ga0307413_10067051 3300031824 Bacteria 2242
142 Ga0307407_10574722 3300031903 Bacteria 836
143 Ga0307412_10481319 3300031911 Bacteria 1029
144 Ga0307409_100212592 3300031995 Bacteria 1739
145 Ga0307409_100395196 3300031995 Bacteria 1319
146 Ga0307416_100789679 3300032002 Bacteria 1044
147 Ga0307416_102025771 3300032002 Bacteria 678
148 Ga0307414_10001178 3300032004 Bacteria 13438
149 Ga0307411_10198401 3300032005 Bacteria 1539
150 Ga0307415_100238551 3300032126 Bacteria 1469
151 Ga0316583_10045660 3300032133 Bacteria 1546
152 Ga0316593_10283310 3300032168 Bacteria 625
153 Ga0307510_10006150 3300033180 Bacteria 14304
154 Ga0373926_0049412 3300035083 Bacteria 1515
155 Ga0373923_0216195 3300035111 Bacteria 890
156 Ga0373923_0441321 3300035111 Bacteria 630
157 Ga0373957_0189381 3300035120 Bacteria 855
158 Ga0373935_0173516 3300035692 Bacteria 1476
159 Ga0373927_0001889 3300035695 Bacteria 15478
160 Ga0373947_0078071 3300035725 Unclassified 2043
161 Ga0373937_0944970 3300036401 Bacteria 811
162 Ga0373925_0208431 3300037068 Unclassified 1557
163 Ga0395905_0019290 3300037471 Bacteria 6465
164 Ga0395905_0075497 3300037471 Bacteria 3159
165 Ga0436363_1214346 3300039450 Bacteria 1382
166 Ga0436362_0333759 3300039453 Bacteria 776
167 Ga0439463_014531 3300042016 Bacteria 1941
168 Ga0450914_013282 3300042118 Bacteria 836
169 Ga0450903_017450 3300042138 Bacteria 1121
170 Ga0439464_0003825 3300042439 Bacteria 3828
171 Ga0451577_0107677 3300042876 Bacteria 2491
172 Ga0451577_0124352 3300042876 Bacteria 2311
173 Ga0453683_0139385 3300044673 Bacteria 1530
174 Ga0453683_0583403 3300044673 Bacteria 728
175 Ga0453684_0025782 3300044712 Bacteria 8522
176 Ga0453684_0026439 3300044712 Bacteria 8380
177 Ga0466959_0225048 3300045049 Unclassified 1300
178 Ga0451576_0009258 3300045051 Bacteria 11446
179 Ga0495592_0683985 3300046454 Unclassified 618
180 Ga0495591_026231 3300046458 Bacteria 1814
181 Ga0495629_0129125 3300046459 Unclassified 1761
182 Ga0495653_0687599 3300046463 Bacteria 622
183 Ga0495653_0809251 3300046463 Bacteria 563
184 Ga0495580_0147979 3300046472 Unclassified 1627
185 Ga0495580_0151766 3300046472 Bacteria 1605
186 Ga0495580_0372957 3300046472 Unclassified 965
187 Ga0495664_0425519 3300046477 Bacteria 796
188 Ga0495607_0012888 3300046501 Bacteria 5498
189 Ga0495583_0027938 3300046506 Bacteria 2779
190 Ga0495610_0001186 3300046512 Bacteria 23573
191 Ga0495620_0000574 3300046515 Bacteria 23138
192 Ga0495628_0730385 3300046516 Bacteria 697
193 Ga0495630_0187904 3300046517 Bacteria 1576
194 Ga0495637_0001361 3300046520 Bacteria 14686
195 Ga0495640_0073132 3300046533 Bacteria 2295
196 Ga0495609_0001539 3300046538 Bacteria 15130
197 Ga0495621_0104186 3300046539 Bacteria 1082
198 Ga0495633_0084235 3300046558 Bacteria 1479
199 Ga0495668_0029369 3300046616 Bacteria 3106
200 Ga0495635_0133841 3300046663 Bacteria 1690
201 Ga0495635_0821202 3300046663 Bacteria 598
202 Ga0495661_0294879 3300046665 Bacteria 813
203 Ga0495657_0008561 3300046675 Bacteria 7814
204 Ga0495599_0079539 3300046678 Bacteria 2047
205 Ga0495658_0157355 3300046683 Unclassified 1399
206 Ga0495670_0000269 3300046691 Bacteria 24362
207 Ga0495589_0509030 3300046794 Bacteria 549
208 Ga0495660_0027466 3300046810 Bacteria 3219
209 Ga0495604_0117309 3300047317 Bacteria 1931
210 Ga0495674_0122732 3300047319 Bacteria 2194
211 Ga0495680_0666932 3300047322 Bacteria 690
212 Ga0495684_0032308 3300047471 Bacteria 4018
213 Ga0495686_0121063 3300047472 Bacteria 1560
214 Ga0496100_0392767 3300048903 Bacteria 1055
215 Ga0496111_0400754 3300048914 Bacteria 1014
216 Ga0501031_0052630 3300049568 Plasmid 2653
217 Ga0501034_1504835 3300049571 Bacteria 547
218 Ga0501036_0427426 3300049572 Bacteria 1104
219 Ga0501036_0983550 3300049572 Bacteria 691
220 Ga0501037_1039011 3300049573 Bacteria 532
221 Ga0501038_0651342 3300049574 Bacteria 793
222 Ga0501039_0903416 3300049575 Bacteria 687
223 Ga0501040_1320215 3300049576 Bacteria 523
224 Ga0501041_0554083 3300049577 Bacteria 733
225 Ga0501041_0577357 3300049577 Bacteria 717
226 Ga0501042_1406133 3300049578 Unclassified 509
227 Ga0501043_0370470 3300049579 Bacteria 1086
228 Ga0501046_0258201 3300049580 Bacteria 1281
229 Ga0501048_0223099 3300049582 Unclassified 1337
230 Ga0501048_0874529 3300049582 Bacteria 646
231 Ga0501070_0004858 3300049586 Bacteria 11486
232 Ga0501071_0045547 3300049587 Bacteria 3149
233 Ga0501072_0093449 3300049588 Bacteria 2389
234 Ga0501072_0347301 3300049588 Bacteria 1178
235 Ga0501074_0687777 3300049590 Unclassified 722
236 Ga0501075_0029500 3300049591 Bacteria 4058
237 Ga0501075_0158615 3300049591 Bacteria 1726
238 Ga0501075_0260745 3300049591 Bacteria 1321
239 Ga0501076_1794194 3300049592 Bacteria 503
240 Ga0501077_0261069 3300049593 Bacteria 1102
241 Ga0501202_031692 3300049652 Unclassified 1106
242 Ga0501079_0844869 3300049741 Unclassified 721
243 Ga0501080_1352799 3300049742 Bacteria 609
244 Ga0501081_0109779 3300049743 Bacteria 1957
245 Ga0501035_0211233 3300049822 Bacteria 1660
246 Ga0501035_0313347 3300049822 Bacteria 1320
247 Ga0501035_0472502 3300049822 Bacteria 1035
248 Ga0501035_0721478 3300049822 Bacteria 802
249 Ga0501044_0508074 3300049823 Bacteria 1106
250 Ga0501044_0838280 3300049823 Bacteria 797
251 Ga0501045_0314507 3300049824 Bacteria 1165
252 nmdc:mga0k408_740548_c1 3300050493 Unclassified 574
253 nmdc:mga06z11_78956_c1 3300050494 Bacteria 1760
254 nmdc:mga04h51_235212_c1 3300050495 Bacteria 730
255 nmdc:mga05p37_22848_c1 3300050507 Bacteria 7584
256 nmdc:mga05p37_384444_c1 3300050507 Bacteria 1643
257 nmdc:mga05p37_842851_c1 3300050507 Bacteria 997
258 nmdc:mga09592_87725_c1 3300050508 Bacteria 2656
259 nmdc:mga0qj67_292991_c1 3300050509 Bacteria 1319
260 nmdc:mga06r32_1253607_c1 3300050510 Bacteria 686
261 nmdc:mga08y16_232443_c1 3300050511 Bacteria 1907
262 nmdc:mga0n895_1009577_c1 3300050512 Bacteria 813
263 nmdc:mga0n895_148375_c1 3300050512 Bacteria 2374
264 nmdc:mga0n895_441157_c1 3300050512 Bacteria 1315
265 nmdc:mga0rr50_1125677_c1 3300050513 Bacteria 668
266 nmdc:mga0rr50_18432_c1 3300050513 Bacteria 4690
267 nmdc:mga0rr50_538036_c1 3300050513 Bacteria 994
268 nmdc:mga08x19_856155_c1 3300050514 Bacteria 646
269 nmdc:mga0a205_104465_c1 3300050515 Bacteria 2732
270 nmdc:mga0a205_1523401_c1 3300050515 Bacteria 517
271 nmdc:mga0a205_71093_c1 3300050515 Bacteria 3361
272 Ga0500594_0010926 3300053118 Bacteria 2115
273 Ga0500588_0326914 3300053146 Bacteria 582
274 Ga0501084_0288026 3300054114 Bacteria 1387
275 Ga0530510_0165188 3300061734 Bacteria 1638
276 2511416123 2511231031 Bacteria 6558529
277 2524002494 2523533628 Bacteria 4098242
278 2738732505 2738541279 Bacteria 6149495
279 2738765070 2738541285 Bacteria 6150075
280 2739214085 2738543007 Bacteria 6149845
281 2774134380 2773857673 Bacteria 6513460
282 2819572389 2818991442 Bacteria 8318214
283 2819656626 2818991456 Bacteria 6123676
284 2883068062 2883068021 Bacteria 6192739
285 2904522725 2904518522 Bacteria 6068986
286 Ga0070690_100418953
287 JGI24739J22299_10003649
288 rootH2_10086332
289 Ga0070683_100090071
290 Ga0070680_100165393
291 Ga0070680_100475910
292 Ga0070660_100067684
293 Ga0070660_100283770
294 Ga0070660_101342075
295 Ga0070691_10345146
296 Ga0070661_100447630
297 Ga0070669_100091114
298 Ga0070659_100263184
299 Ga0070714_100134893
300 Ga0070714_101555179
301 Ga0070713_100061767
302 Ga0070713_100166923
303 Ga0070713_100408616
304 Ga0070713_101411778
305 Ga0070713_102272669
306 Ga0070700_101494269
307 Ga0070694_100859817
308 Ga0070708_100738665
309 Ga0070708_100750928
310 Ga0070663_100275432
311 Ga0070681_10269307
312 Ga0070681_10775204
313 Ga0070706_100015614
314 Ga0070706_100151259
315 Ga0070706_101381788
316 Ga0070698_101519510
317 Ga0070699_100020563
318 Ga0070699_100439277
319 Ga0070699_101259774
320 Ga0070697_100008258
321 Ga0070697_100397067
322 Ga0070697_100440210
323 Ga0068853_100903317
324 Ga0070695_101234105
325 Ga0070696_100215568
326 Ga0070696_100379779
327 Ga0070693_100536443
328 Ga0070693_100537111
329 Ga0070665_100327416
330 Ga0070704_100243028
331 Ga0070704_100921442
332 Ga0068855_100237371
333 Ga0068851_10492116
334 Ga0068860_101121450
335 Ga0068862_100042440
336 Ga0070717_10062554
337 Ga0070717_10208804
338 Ga0070716_100747033
339 Ga0097621_100070659
340 Ga0068871_100038561
341 Ga0075428_100755436
342 Ga0075431_101331594
343 Ga0075433_10086461
344 Ga0075433_10245618
345 Ga0075433_11413362
346 Ga0075433_11558571
347 Ga0075434_100083218
348 Ga0075434_100114738
349 Ga0075434_100672040
350 Ga0075434_101724621
351 Ga0075429_100442018
352 Ga0075429_101180476
353 Ga0075436_100042260
354 Ga0079104_1023672
355 Ga0075435_100153600
356 Ga0075435_100569264
357 Ga0105240_10442467
358 Ga0105240_11652842
359 Ga0105240_12097330
360 Ga0111539_10229067
361 Ga0114129_10259949
362 Ga0114129_10448761
363 Ga0105237_11727011
364 Ga0105238_12115945
365 Ga0157373_10095835
366 Ga0157373_11205556
367 Ga0157373_11253324
368 Ga0157374_10067574
369 Ga0157374_10502939
370 Ga0157372_10133649
371 Ga0163163_10563596
372 Ga0157376_10363671
373 Ga0163161_10911091
374 Ga0213874_10040842
375 Ga0207699_10027808
376 Ga0207705_10073266
377 Ga0207684_10048248
378 Ga0207684_10487261
379 Ga0207684_11431092
380 Ga0207707_10062695
381 Ga0207707_10830739
382 Ga0207695_11554953
383 Ga0207671_11591074
384 Ga0207660_10171014
385 Ga0207660_10543546
386 Ga0207657_10380891
387 Ga0207700_10126245
388 Ga0207700_10626129
389 Ga0207700_11652120
390 Ga0207664_10080829
391 Ga0207664_11480400
392 Ga0207644_11766099
393 Ga0207686_10226524
394 Ga0207661_10162203
395 Ga0207667_10131163
396 Ga0207640_10722079
397 Ga0207678_10126932
398 Ga0207678_10504957
399 Ga0207702_10200410
400 Ga0209967_1001982
401 Ga0209968_1022740
402 Ga0209999_1060326
403 Ga0209982_1007237
404 Ga0209983_1087861
405 Ga0209966_1025126
406 Ga0209974_10256537
407 Ga0207428_10360688
408 Ga0268266_10311791
409 Ga0268265_10079217
410 Ga0268265_10083286
411 Ga0268264_10765109
412 Ga0265336_10000798
413 Ga0265338_10120479
414 Ga0307511_10006713
415 Ga0265760_10012806
416 Ga0265328_10009220
417 Ga0265328_10234233
418 Ga0265328_10351281
419 Ga0265329_10188605
420 Ga0265339_10011972
421 Ga0265339_10081625
422 Ga0265327_10020827
423 Ga0265316_10435114
424 Ga0307514_10001054
425 Ga0265314_10027446
426 Ga0307413_10067051
427 Ga0307407_10574722
428 Ga0307412_10481319
429 Ga0307409_100212592
430 Ga0307409_100395196
431 Ga0307416_100789679
432 Ga0307416_102025771
433 Ga0307414_10001178
434 Ga0307411_10198401
435 Ga0307415_100238551
436 Ga0316583_10045660
437 Ga0316593_10283310
438 Ga0307510_10006150
439 Ga0373926_0049412
440 Ga0373923_0216195
441 Ga0373923_0441321
442 Ga0373957_0189381
443 Ga0373935_0173516
444 Ga0373927_0001889
445 Ga0373947_0078071
446 Ga0373937_0944970
447 Ga0373925_0208431
448 Ga0395905_0019290
449 Ga0395905_0075497
450 Ga0436363_1214346
451 Ga0436362_0333759
452 Ga0439463_014531
453 Ga0450914_013282
454 Ga0450903_017450
455 Ga0439464_0003825
456 Ga0451577_0107677
457 Ga0451577_0124352
458 Ga0453683_0139385
459 Ga0453683_0583403
460 Ga0453684_0025782
461 Ga0453684_0026439
462 Ga0466959_0225048
463 Ga0451576_0009258
464 Ga0495592_0683985
465 Ga0495591_026231
466 Ga0495629_0129125
467 Ga0495653_0687599
468 Ga0495653_0809251
469 Ga0495580_0147979
470 Ga0495580_0151766
471 Ga0495580_0372957
472 Ga0495664_0425519
473 Ga0495607_0012888
474 Ga0495583_0027938
475 Ga0495610_0001186
476 Ga0495620_0000574
477 Ga0495628_0730385
478 Ga0495630_0187904
479 Ga0495637_0001361
480 Ga0495640_0073132
481 Ga0495609_0001539
482 Ga0495621_0104186
483 Ga0495633_0084235
484 Ga0495668_0029369
485 Ga0495635_0133841
486 Ga0495635_0821202
487 Ga0495661_0294879
488 Ga0495657_0008561
489 Ga0495599_0079539
490 Ga0495658_0157355
491 Ga0495670_0000269
492 Ga0495589_0509030
493 Ga0495660_0027466
494 Ga0495604_0117309
495 Ga0495674_0122732
496 Ga0495680_0666932
497 Ga0495684_0032308
498 Ga0495686_0121063
499 Ga0496100_0392767
500 Ga0496111_0400754
501 Ga0501031_0052630
502 Ga0501034_1504835
503 Ga0501036_0427426
504 Ga0501036_0983550
505 Ga0501037_1039011
506 Ga0501038_0651342
507 Ga0501039_0903416
508 Ga0501040_1320215
509 Ga0501041_0554083
510 Ga0501041_0577357
511 Ga0501042_1406133
512 Ga0501043_0370470
513 Ga0501046_0258201
514 Ga0501048_0223099
515 Ga0501048_0874529
516 Ga0501070_0004858
517 Ga0501071_0045547
518 Ga0501072_0093449
519 Ga0501072_0347301
520 Ga0501074_0687777
521 Ga0501075_0029500
522 Ga0501075_0158615
523 Ga0501075_0260745
524 Ga0501076_1794194
525 Ga0501077_0261069
526 Ga0501202_031692
527 Ga0501079_0844869
528 Ga0501080_1352799
529 Ga0501081_0109779
530 Ga0501035_0211233
531 Ga0501035_0313347
532 Ga0501035_0472502
533 Ga0501035_0721478
534 Ga0501044_0508074
535 Ga0501044_0838280
536 Ga0501045_0314507
537 nmdc:mga0k408_740548_c1
538 nmdc:mga06z11_78956_c1
539 nmdc:mga04h51_235212_c1
540 nmdc:mga05p37_22848_c1
541 nmdc:mga05p37_384444_c1
542 nmdc:mga05p37_842851_c1
543 nmdc:mga09592_87725_c1
544 nmdc:mga0qj67_292991_c1
545 nmdc:mga06r32_1253607_c1
546 nmdc:mga08y16_232443_c1
547 nmdc:mga0n895_1009577_c1
548 nmdc:mga0n895_148375_c1
549 nmdc:mga0n895_441157_c1
550 nmdc:mga0rr50_1125677_c1
551 nmdc:mga0rr50_18432_c1
552 nmdc:mga0rr50_538036_c1
553 nmdc:mga08x19_856155_c1
554 nmdc:mga0a205_104465_c1
555 nmdc:mga0a205_1523401_c1
556 nmdc:mga0a205_71093_c1
557 Ga0500594_0010926
558 Ga0500588_0326914
559 Ga0501084_0288026
560 Ga0530510_0165188
561 2511416123
562 2524002494
563 2738732505
564 2738765070
565 2739214085
566 2774134380
567 2819572389
568 2819656626
569 2883068062
570 2904522725

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14026

SCO4226-like

Nickel responsive protein SCO4226-like

4

80

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.8557 3 84
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.8366 3 84
2ift-assembly1.cif.gz_A crystal structure of putative methylase hi0767 from haemophilus influenzae. nesg target ir102. 0.7764 38 55
2hxv-assembly1.cif.gz_A-2 crystal structure of a diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase (tm1828) from thermotoga maritima at 1.80 a resolution 0.7252 36 57
3i3w-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7051 3 70
ID Description Score Start End Superfamily
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.8467 4 84 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.8288 1 80 3.30.70.3090
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.8277 4 84 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7844 1 80 3.30.70.3090
3i3wB04 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.6761 5 70 3.30.310.50
ID Description Score Start End GO Terms
AF-A0A286C6H2-F1-model_v4 DUF4242 domain-containing protein 1.001 1 79
AF-A0A512B9Q4-F1-model_v4 DUF4242 domain-containing protein 0.9926 1 88
AF-A0A7Y2HHT9-F1-model_v4 DUF4242 domain-containing protein 0.9916 2 88
AF-A0A530QG42-F1-model_v4 DUF4242 domain-containing protein 0.991 1 82
AF-A0A2V9DGU8-F1-model_v4 DUF4242 domain-containing protein 0.9893 1 89

Map