F386554

General Info

Members Datasets Scaffolds Average Seq Length
285 195 570 212

Family's Representative Sequence

Representative Sequence 3300003354|JGI25160J50197_1019750|JGI25160J50197_10197502
Length 236
Sequence MILCVNSKKHSTKQLNCTTYSCGMINFVPIFPLNIVVYPGEQLNLHIFEERYKQLINECFETNKPFGIPTVMDNHVEDLGTLVKVTEIVERYEDGRMDIRTEGLKIFRVLEIIKVVPDKLYSGAIVNYPDTVDAGNIRMMRKIIASIRELHRLLKVTKEFKKEDDALVSYDIAHHAGLSLKEEYEVLGLLQENQRLEYLKRHLNKVIPLIGGIDSLKEKIQLNGHFKELKGFNLDF

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
161 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
162 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
163 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
164 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
165 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
166 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
167 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
168 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
169 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
179 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
180 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
181 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
182 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
183 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
184 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
185 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
186 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
187 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
188 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
189 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
190 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
194 2818991444 Filimonas endophytica 3197 Isolate Unclassified
195 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.72
Nodule 0
Rhizoplane 0
Rhizosphere 86.32
Stem 0
Stem Tuber 0
Unclassified 24.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1019750 3300003354 Unclassified 2057
2 JGI25406J46586_10005186 3300003203 Bacteria 6043
3 JGI25406J46586_10021681 3300003203 Bacteria 2573
4 rootH2_10000636 3300003320 Bacteria 11774
5 rootL2_10184595 3300003322 Bacteria 3792
6 rootL2_10230221 3300003322 Unclassified 1019
7 rootL2_10230223 3300003322 Bacteria 3993
8 Ga0065712_10161233 3300005290 Bacteria 1301
9 Ga0070658_10272129 3300005327 Unclassified 1441
10 Ga0070676_10121927 3300005328 Unclassified 1637
11 Ga0070683_100026609 3300005329 Bacteria 5211
12 Ga0070690_100050984 3300005330 Bacteria 2641
13 Ga0070690_100645915 3300005330 Bacteria 808
14 Ga0070670_100347220 3300005331 Unclassified 1303
15 Ga0070677_10070882 3300005333 Bacteria 1466
16 Ga0068869_100102596 3300005334 Bacteria 2166
17 Ga0070666_10070491 3300005335 Unclassified 2378
18 Ga0070682_100103150 3300005337 Bacteria 1887
19 Ga0068868_100016946 3300005338 Bacteria 5421
20 Ga0070660_100025464 3300005339 Unclassified 4397
21 Ga0070687_100390616 3300005343 Unclassified 909
22 Ga0070661_100030797 3300005344 Bacteria 3877
23 Ga0070661_100104915 3300005344 Bacteria 2106
24 Ga0070668_100288408 3300005347 Unclassified 1373
25 Ga0070675_100013155 3300005354 Bacteria 6502
26 Ga0070675_100109797 3300005354 Bacteria 2332
27 Ga0070675_100247405 3300005354 Bacteria 1559
28 Ga0070671_100030531 3300005355 Bacteria 4447
29 Ga0070671_100092064 3300005355 Bacteria 2540
30 Ga0070673_100571467 3300005364 Bacteria 1029
31 Ga0070659_100379341 3300005366 Unclassified 1190
32 Ga0070714_100328836 3300005435 Bacteria 1431
33 Ga0070713_100066186 3300005436 Bacteria 3038
34 Ga0070700_100297064 3300005441 Bacteria 1177
35 Ga0070678_100036432 3300005456 Bacteria 3444
36 Ga0070662_100038343 3300005457 Unclassified 3404
37 Ga0070681_10040676 3300005458 Unclassified 4657
38 Ga0068867_100277487 3300005459 Bacteria 1373
39 Ga0070679_100037839 3300005530 Bacteria 4794
40 Ga0070684_100027800 3300005535 Unclassified 4777
41 Ga0068853_100040345 3300005539 Unclassified 3983
42 Ga0068853_100060041 3300005539 Bacteria 3285
43 Ga0070672_100026735 3300005543 Bacteria 4300
44 Ga0070686_100392082 3300005544 Unclassified 1054
45 Ga0070693_100334999 3300005547 Unclassified 1031
46 Ga0070665_100000014 3300005548 Bacteria 484881
47 Ga0070665_100307011 3300005548 Bacteria 1590
48 Ga0068855_100404001 3300005563 Unclassified 1496
49 Ga0068855_100815773 3300005563 Unclassified 991
50 Ga0070664_100009648 3300005564 Bacteria 7831
51 Ga0068857_100038645 3300005577 Unclassified 4226
52 Ga0068854_100020377 3300005578 Unclassified 4486
53 Ga0068854_100555755 3300005578 Bacteria 974
54 Ga0068856_100029902 3300005614 Bacteria 5323
55 Ga0070702_100005502 3300005615 Bacteria 5910
56 Ga0068852_100004742 3300005616 Bacteria 9652
57 Ga0068852_100179576 3300005616 Bacteria 1989
58 Ga0068864_100074497 3300005618 Bacteria 2962
59 Ga0068864_100246139 3300005618 Unclassified 1658
60 Ga0068864_100561568 3300005618 Unclassified 1104
61 Ga0068864_100658503 3300005618 Unclassified 1020
62 Ga0068861_100571942 3300005719 Unclassified 1033
63 Ga0068851_10253494 3300005834 Unclassified 999
64 Ga0068851_10489166 3300005834 Unclassified 736
65 Ga0068863_100329209 3300005841 Unclassified 1485
66 Ga0068860_100001067 3300005843 Bacteria 30243
67 Ga0068860_100024374 3300005843 Bacteria 5846
68 Ga0068860_100099366 3300005843 Bacteria 2776
69 Ga0068860_100144128 3300005843 Bacteria 2291
70 Ga0068862_100060364 3300005844 Unclassified 3257
71 Ga0081538_10016004 3300005981 Bacteria 5773
72 Ga0081538_10029836 3300005981 Bacteria 3717
73 Ga0081539_10000523 3300005985 Bacteria 79800
74 Ga0081539_10001181 3300005985 Bacteria 47185
75 Ga0081539_10007172 3300005985 Bacteria 10277
76 Ga0081539_10037264 3300005985 Bacteria 2899
77 Ga0068871_100010526 3300006358 Bacteria 6756
78 Ga0068871_100068370 3300006358 Unclassified 2917
79 Ga0068871_100088962 3300006358 Bacteria 2570
80 Ga0075428_100159384 3300006844 Bacteria 2449
81 Ga0075430_100062232 3300006846 Bacteria 3136
82 Ga0075431_100004640 3300006847 Bacteria 13490
83 Ga0075431_100011581 3300006847 Bacteria 8893
84 Ga0075429_100016339 3300006880 Bacteria 6433
85 Ga0075429_100046839 3300006880 Bacteria 3762
86 Ga0105240_10002692 3300009093 Bacteria 28281
87 Ga0105240_10213670 3300009093 Bacteria 2252
88 Ga0111539_10010311 3300009094 Bacteria 11763
89 Ga0111539_10241845 3300009094 Bacteria 2101
90 Ga0111539_10301925 3300009094 Bacteria 1863
91 Ga0111539_11880415 3300009094 Bacteria 694
92 Ga0114129_10007446 3300009147 Bacteria 15592
93 Ga0114129_10202643 3300009147 Bacteria 2686
94 Ga0114129_10576314 3300009147 Unclassified 1461
95 Ga0105242_10277792 3300009176 Bacteria 1520
96 Ga0105242_10443561 3300009176 Bacteria 1222
97 Ga0105237_10002469 3300009545 Bacteria 22938
98 Ga0105237_10006802 3300009545 Bacteria 12609
99 Ga0105239_10003350 3300010375 Bacteria 19690
100 Ga0105239_10231335 3300010375 Bacteria 2074
101 Ga0105239_10328332 3300010375 Bacteria 1725
102 Ga0105246_10741811 3300011119 Bacteria 865
103 Ga0157373_10027854 3300013100 Bacteria 4076
104 Ga0157371_10065016 3300013102 Unclassified 2583
105 Ga0157371_10190355 3300013102 Bacteria 1469
106 Ga0157370_10021430 3300013104 Bacteria 6440
107 Ga0157369_10047185 3300013105 Bacteria 4678
108 Ga0157369_11251816 3300013105 Unclassified 757
109 Ga0157374_10070119 3300013296 Unclassified 3302
110 Ga0157378_10001706 3300013297 Bacteria 19763
111 Ga0157378_10038433 3300013297 Unclassified 4242
112 Ga0163162_10110871 3300013306 Bacteria 2841
113 Ga0163162_10705337 3300013306 Bacteria 1131
114 Ga0157372_10417625 3300013307 Bacteria 1563
115 Ga0157372_10745598 3300013307 Unclassified 1139
116 Ga0157372_11042300 3300013307 Bacteria 947
117 Ga0157372_11080239 3300013307 Bacteria 929
118 Ga0157375_10922414 3300013308 Bacteria 1016
119 Ga0163163_10145863 3300014325 Bacteria 2410
120 Ga0157380_10002108 3300014326 Bacteria 13337
121 Ga0157377_10030824 3300014745 Bacteria 2909
122 Ga0157377_10278575 3300014745 Unclassified 1095
123 Ga0157379_10348167 3300014968 Bacteria 1356
124 Ga0157376_10013206 3300014969 Bacteria 6155
125 Ga0157376_10110573 3300014969 Unclassified 2418
126 Ga0163161_10433024 3300017792 Bacteria 1060
127 Ga0163161_10710878 3300017792 Unclassified 837
128 Ga0213876_10011135 3300021384 Unclassified 4811
129 Ga0207426_1000211 3300025302 Bacteria 137322
130 Ga0207682_10112755 3300025893 Bacteria 1198
131 Ga0207680_10024858 3300025903 Unclassified 3295
132 Ga0207645_10004307 3300025907 Bacteria 10558
133 Ga0207645_10148612 3300025907 Bacteria 1529
134 Ga0207705_10192554 3300025909 Bacteria 1543
135 Ga0207695_10009338 3300025913 Bacteria 12131
136 Ga0207695_10529314 3300025913 Bacteria 1060
137 Ga0207671_10005360 3300025914 Bacteria 11858
138 Ga0207671_10067991 3300025914 Bacteria 2654
139 Ga0207671_10323964 3300025914 Bacteria 1220
140 Ga0207662_10006304 3300025918 Bacteria 6390
141 Ga0207657_10002165 3300025919 Bacteria 21284
142 Ga0207649_10034794 3300025920 Unclassified 3021
143 Ga0207652_10100574 3300025921 Bacteria 2552
144 Ga0207681_10259966 3300025923 Bacteria 1359
145 Ga0207650_10236656 3300025925 Unclassified 1475
146 Ga0207659_10088747 3300025926 Bacteria 2304
147 Ga0207659_10099251 3300025926 Unclassified 2192
148 Ga0207644_10216587 3300025931 Unclassified 1516
149 Ga0207690_10422015 3300025932 Unclassified 1067
150 Ga0207706_10005451 3300025933 Bacteria 11857
151 Ga0207686_10322483 3300025934 Bacteria 1155
152 Ga0207691_10017591 3300025940 Bacteria 6775
153 Ga0207689_10139794 3300025942 Bacteria 1995
154 Ga0207661_10056463 3300025944 Unclassified 3152
155 Ga0207679_10175969 3300025945 Unclassified 1766
156 Ga0207679_10787099 3300025945 Unclassified 867
157 Ga0207667_10281440 3300025949 Unclassified 1699
158 Ga0207667_10957889 3300025949 Unclassified 845
159 Ga0207651_10035891 3300025960 Bacteria 3230
160 Ga0207651_10288635 3300025960 Unclassified 1359
161 Ga0207651_10481883 3300025960 Bacteria 1069
162 Ga0207677_10035793 3300026023 Bacteria 3228
163 Ga0207677_10224525 3300026023 Bacteria 1509
164 Ga0207639_10024970 3300026041 Bacteria 4330
165 Ga0207639_10381352 3300026041 Bacteria 1266
166 Ga0207678_10152206 3300026067 Unclassified 1975
167 Ga0207678_10791119 3300026067 Bacteria 837
168 Ga0207702_10419245 3300026078 Unclassified 1294
169 Ga0207641_10315583 3300026088 Bacteria 1481
170 Ga0207648_10019802 3300026089 Bacteria 6072
171 Ga0207648_10029523 3300026089 Bacteria 4862
172 Ga0207648_10122676 3300026089 Bacteria 2285
173 Ga0207676_10030826 3300026095 Unclassified 4029
174 Ga0207676_10058379 3300026095 Bacteria 3044
175 Ga0207676_10256430 3300026095 Unclassified 1577
176 Ga0207674_10166522 3300026116 Unclassified 2158
177 Ga0207674_10460043 3300026116 Bacteria 1230
178 Ga0207683_10071893 3300026121 Bacteria 3059
179 Ga0207683_10940748 3300026121 Bacteria 802
180 Ga0207698_10441854 3300026142 Unclassified 1253
181 Ga0207698_11109519 3300026142 Unclassified 804
182 Ga0207698_11217737 3300026142 Unclassified 767
183 Ga0207428_10089353 3300027907 Bacteria 2394
184 Ga0268265_10046006 3300028380 Unclassified 3260
185 Ga0268264_10004563 3300028381 Bacteria 11794
186 Ga0268264_10016730 3300028381 Bacteria 6003
187 Ga0307511_10249533 3300030521 Bacteria 855
188 Ga0307513_10559735 3300031456 Bacteria 855
189 Ga0307509_10042184 3300031507 Bacteria 4947
190 Ga0307408_100037155 3300031548 Bacteria 3429
191 Ga0265313_10090732 3300031595 Bacteria 1372
192 Ga0307413_10080551 3300031824 Bacteria 2085
193 Ga0307410_10775607 3300031852 Bacteria 813
194 Ga0307406_10900211 3300031901 Bacteria 753
195 Ga0307407_10376833 3300031903 Bacteria 1012
196 Ga0307407_10641221 3300031903 Bacteria 795
197 Ga0307412_10042966 3300031911 Bacteria 2941
198 Ga0307412_10180685 3300031911 Bacteria 1587
199 Ga0307412_10869346 3300031911 Bacteria 788
200 Ga0307409_100185244 3300031995 Bacteria 1847
201 Ga0307409_100192124 3300031995 Bacteria 1818
202 Ga0307409_100785892 3300031995 Bacteria 958
203 Ga0307416_100199118 3300032002 Bacteria 1898
204 Ga0307416_100354949 3300032002 Bacteria 1485
205 Ga0307416_101102408 3300032002 Bacteria 898
206 Ga0307414_10017528 3300032004 Bacteria 4384
207 Ga0307414_10746070 3300032004 Bacteria 889
208 Ga0307411_10384889 3300032005 Bacteria 1155
209 Ga0395900_0056103 3300037418 Unclassified 4056
210 Ga0436364_0526786 3300037853 Unclassified 3552
211 Ga0436364_0989332 3300037853 Bacteria 1621
212 Ga0395901_0015054 3300038443 Bacteria 7866
213 Ga0436365_0238349 3300039437 Bacteria 9503
214 Ga0436365_0834397 3300039437 Bacteria 2083
215 Ga0451843_1076318 3300041509 Bacteria 686
216 Ga0451853_1353322 3300041512 Bacteria 1173
217 Ga0466972_0000057 3300044658 Bacteria 110775
218 Ga0466965_0285214 3300044683 Bacteria 893
219 Ga0466970_0000169 3300044765 Bacteria 31008
220 Ga0466957_0001667 3300044842 Bacteria 11661
221 Ga0466960_0119827 3300044901 Bacteria 1377
222 Ga0495629_0570107 3300046459 Bacteria 759
223 Ga0495638_0213918 3300046460 Bacteria 1081
224 Ga0495664_0177399 3300046477 Bacteria 1292
225 Ga0495625_0154174 3300046660 Bacteria 1543
226 Ga0495684_0292960 3300047471 Bacteria 1171
227 Ga0495686_0248137 3300047472 Bacteria 1001
228 Ga0496124_0056946 3300048927 Unclassified 3295
229 Ga0501298_052645 3300049521 Bacteria 847
230 Ga0501032_0159056 3300049569 Bacteria 1483
231 Ga0501034_0027135 3300049571 Bacteria 5826
232 Ga0501036_0062416 3300049572 Unclassified 3156
233 Ga0501037_0002081 3300049573 Bacteria 14500
234 Ga0501038_0014178 3300049574 Bacteria 7261
235 Ga0501039_0055338 3300049575 Unclassified 3072
236 Ga0501043_0247264 3300049579 Bacteria 1374
237 Ga0501046_0222222 3300049580 Unclassified 1398
238 Ga0501047_0297674 3300049581 Unclassified 1456
239 Ga0501209_060206 3300049656 Bacteria 1058
240 Ga0501214_029933 3300049659 Bacteria 742
241 Ga0501217_239843 3300049661 Bacteria 580
242 Ga0501243_034292 3300049675 Bacteria 875
243 Ga0501257_011229 3300049686 Bacteria 2042
244 Ga0501219_000339 3300049703 Bacteria 8028
245 Ga0501225_0023163 3300049705 Unclassified 1712
246 Ga0501241_027296 3300049758 Bacteria 1067
247 Ga0501268_043733 3300049765 Bacteria 850
248 Ga0501279_084817 3300049775 Unclassified 551
249 Ga0501035_0023209 3300049822 Bacteria 5691
250 Ga0501044_0015467 3300049823 Bacteria 8219
251 Ga0501284_00002 3300050005 Bacteria 220402
252 nmdc:mga0k408_18877_c1 3300050493 Bacteria 3849
253 nmdc:mga05p37_27934_c1 3300050507 Bacteria 6873
254 nmdc:mga05p37_75153_c1 3300050507 Bacteria 4159
255 nmdc:mga09592_19249_c1 3300050508 Bacteria 5604
256 nmdc:mga06r32_25555_c1 3300050510 Bacteria 5494
257 nmdc:mga06r32_447173_c1 3300050510 Bacteria 1272
258 nmdc:mga08y16_126954_c1 3300050511 Bacteria 2653
259 nmdc:mga08y16_1301720_c1 3300050511 Bacteria 693
260 Ga0500644_0004768 3300053088 Bacteria 3405
261 Ga0500644_0005026 3300053088 Unclassified 3328
262 Ga0500646_0001190 3300053090 Bacteria 6990
263 Ga0500646_0050022 3300053090 Bacteria 1203
264 Ga0500646_0069967 3300053090 Bacteria 1050
265 Ga0500583_0025868 3300053092 Bacteria 2512
266 Ga0500556_0043416 3300053104 Bacteria 1596
267 Ga0500556_0069589 3300053104 Bacteria 1312
268 Ga0500562_000094 3300053108 Bacteria 36637
269 Ga0500562_073810 3300053108 Bacteria 921
270 Ga0500594_0010648 3300053118 Bacteria 2139
271 Ga0500594_0054010 3300053118 Bacteria 1140
272 Ga0500652_031544 3300053131 Bacteria 2080
273 Ga0500655_009143 3300053133 Bacteria 1784
274 Ga0500622_0000652 3300053156 Bacteria 30940
275 Ga0500622_0025588 3300053156 Bacteria 3117
276 Ga0500637_0014359 3300053178 Bacteria 4177
277 Ga0500645_005067 3300053730 Unclassified 4923
278 Ga0500661_007640 3300055283 Bacteria 1996
279 Ga0590071_020836 3300059421 Bacteria 1545
280 Ga0590071_061880 3300059421 Bacteria 916
281 Ga0590074_027739 3300059423 Bacteria 993
282 Ga0590075_012045 3300059424 Bacteria 2097
283 Ga0466962_0380395 3300061719 Bacteria 705
284 2819585739 2818991444 Bacteria 6968812
285 2929159544 2929154850 Bacteria 6753285
286 JGI25160J50197_1019750
287 JGI25406J46586_10005186
288 JGI25406J46586_10021681
289 rootH2_10000636
290 rootL2_10184595
291 rootL2_10230221
292 rootL2_10230223
293 Ga0065712_10161233
294 Ga0070658_10272129
295 Ga0070676_10121927
296 Ga0070683_100026609
297 Ga0070690_100050984
298 Ga0070690_100645915
299 Ga0070670_100347220
300 Ga0070677_10070882
301 Ga0068869_100102596
302 Ga0070666_10070491
303 Ga0070682_100103150
304 Ga0068868_100016946
305 Ga0070660_100025464
306 Ga0070687_100390616
307 Ga0070661_100030797
308 Ga0070661_100104915
309 Ga0070668_100288408
310 Ga0070675_100013155
311 Ga0070675_100109797
312 Ga0070675_100247405
313 Ga0070671_100030531
314 Ga0070671_100092064
315 Ga0070673_100571467
316 Ga0070659_100379341
317 Ga0070714_100328836
318 Ga0070713_100066186
319 Ga0070700_100297064
320 Ga0070678_100036432
321 Ga0070662_100038343
322 Ga0070681_10040676
323 Ga0068867_100277487
324 Ga0070679_100037839
325 Ga0070684_100027800
326 Ga0068853_100040345
327 Ga0068853_100060041
328 Ga0070672_100026735
329 Ga0070686_100392082
330 Ga0070693_100334999
331 Ga0070665_100000014
332 Ga0070665_100307011
333 Ga0068855_100404001
334 Ga0068855_100815773
335 Ga0070664_100009648
336 Ga0068857_100038645
337 Ga0068854_100020377
338 Ga0068854_100555755
339 Ga0068856_100029902
340 Ga0070702_100005502
341 Ga0068852_100004742
342 Ga0068852_100179576
343 Ga0068864_100074497
344 Ga0068864_100246139
345 Ga0068864_100561568
346 Ga0068864_100658503
347 Ga0068861_100571942
348 Ga0068851_10253494
349 Ga0068851_10489166
350 Ga0068863_100329209
351 Ga0068860_100001067
352 Ga0068860_100024374
353 Ga0068860_100099366
354 Ga0068860_100144128
355 Ga0068862_100060364
356 Ga0081538_10016004
357 Ga0081538_10029836
358 Ga0081539_10000523
359 Ga0081539_10001181
360 Ga0081539_10007172
361 Ga0081539_10037264
362 Ga0068871_100010526
363 Ga0068871_100068370
364 Ga0068871_100088962
365 Ga0075428_100159384
366 Ga0075430_100062232
367 Ga0075431_100004640
368 Ga0075431_100011581
369 Ga0075429_100016339
370 Ga0075429_100046839
371 Ga0105240_10002692
372 Ga0105240_10213670
373 Ga0111539_10010311
374 Ga0111539_10241845
375 Ga0111539_10301925
376 Ga0111539_11880415
377 Ga0114129_10007446
378 Ga0114129_10202643
379 Ga0114129_10576314
380 Ga0105242_10277792
381 Ga0105242_10443561
382 Ga0105237_10002469
383 Ga0105237_10006802
384 Ga0105239_10003350
385 Ga0105239_10231335
386 Ga0105239_10328332
387 Ga0105246_10741811
388 Ga0157373_10027854
389 Ga0157371_10065016
390 Ga0157371_10190355
391 Ga0157370_10021430
392 Ga0157369_10047185
393 Ga0157369_11251816
394 Ga0157374_10070119
395 Ga0157378_10001706
396 Ga0157378_10038433
397 Ga0163162_10110871
398 Ga0163162_10705337
399 Ga0157372_10417625
400 Ga0157372_10745598
401 Ga0157372_11042300
402 Ga0157372_11080239
403 Ga0157375_10922414
404 Ga0163163_10145863
405 Ga0157380_10002108
406 Ga0157377_10030824
407 Ga0157377_10278575
408 Ga0157379_10348167
409 Ga0157376_10013206
410 Ga0157376_10110573
411 Ga0163161_10433024
412 Ga0163161_10710878
413 Ga0213876_10011135
414 Ga0207426_1000211
415 Ga0207682_10112755
416 Ga0207680_10024858
417 Ga0207645_10004307
418 Ga0207645_10148612
419 Ga0207705_10192554
420 Ga0207695_10009338
421 Ga0207695_10529314
422 Ga0207671_10005360
423 Ga0207671_10067991
424 Ga0207671_10323964
425 Ga0207662_10006304
426 Ga0207657_10002165
427 Ga0207649_10034794
428 Ga0207652_10100574
429 Ga0207681_10259966
430 Ga0207650_10236656
431 Ga0207659_10088747
432 Ga0207659_10099251
433 Ga0207644_10216587
434 Ga0207690_10422015
435 Ga0207706_10005451
436 Ga0207686_10322483
437 Ga0207691_10017591
438 Ga0207689_10139794
439 Ga0207661_10056463
440 Ga0207679_10175969
441 Ga0207679_10787099
442 Ga0207667_10281440
443 Ga0207667_10957889
444 Ga0207651_10035891
445 Ga0207651_10288635
446 Ga0207651_10481883
447 Ga0207677_10035793
448 Ga0207677_10224525
449 Ga0207639_10024970
450 Ga0207639_10381352
451 Ga0207678_10152206
452 Ga0207678_10791119
453 Ga0207702_10419245
454 Ga0207641_10315583
455 Ga0207648_10019802
456 Ga0207648_10029523
457 Ga0207648_10122676
458 Ga0207676_10030826
459 Ga0207676_10058379
460 Ga0207676_10256430
461 Ga0207674_10166522
462 Ga0207674_10460043
463 Ga0207683_10071893
464 Ga0207683_10940748
465 Ga0207698_10441854
466 Ga0207698_11109519
467 Ga0207698_11217737
468 Ga0207428_10089353
469 Ga0268265_10046006
470 Ga0268264_10004563
471 Ga0268264_10016730
472 Ga0307511_10249533
473 Ga0307513_10559735
474 Ga0307509_10042184
475 Ga0307408_100037155
476 Ga0265313_10090732
477 Ga0307413_10080551
478 Ga0307410_10775607
479 Ga0307406_10900211
480 Ga0307407_10376833
481 Ga0307407_10641221
482 Ga0307412_10042966
483 Ga0307412_10180685
484 Ga0307412_10869346
485 Ga0307409_100185244
486 Ga0307409_100192124
487 Ga0307409_100785892
488 Ga0307416_100199118
489 Ga0307416_100354949
490 Ga0307416_101102408
491 Ga0307414_10017528
492 Ga0307414_10746070
493 Ga0307411_10384889
494 Ga0395900_0056103
495 Ga0436364_0526786
496 Ga0436364_0989332
497 Ga0395901_0015054
498 Ga0436365_0238349
499 Ga0436365_0834397
500 Ga0451843_1076318
501 Ga0451853_1353322
502 Ga0466972_0000057
503 Ga0466965_0285214
504 Ga0466970_0000169
505 Ga0466957_0001667
506 Ga0466960_0119827
507 Ga0495629_0570107
508 Ga0495638_0213918
509 Ga0495664_0177399
510 Ga0495625_0154174
511 Ga0495684_0292960
512 Ga0495686_0248137
513 Ga0496124_0056946
514 Ga0501298_052645
515 Ga0501032_0159056
516 Ga0501034_0027135
517 Ga0501036_0062416
518 Ga0501037_0002081
519 Ga0501038_0014178
520 Ga0501039_0055338
521 Ga0501043_0247264
522 Ga0501046_0222222
523 Ga0501047_0297674
524 Ga0501209_060206
525 Ga0501214_029933
526 Ga0501217_239843
527 Ga0501243_034292
528 Ga0501257_011229
529 Ga0501219_000339
530 Ga0501225_0023163
531 Ga0501241_027296
532 Ga0501268_043733
533 Ga0501279_084817
534 Ga0501035_0023209
535 Ga0501044_0015467
536 Ga0501284_00002
537 nmdc:mga0k408_18877_c1
538 nmdc:mga05p37_27934_c1
539 nmdc:mga05p37_75153_c1
540 nmdc:mga09592_19249_c1
541 nmdc:mga06r32_25555_c1
542 nmdc:mga06r32_447173_c1
543 nmdc:mga08y16_126954_c1
544 nmdc:mga08y16_1301720_c1
545 Ga0500644_0004768
546 Ga0500644_0005026
547 Ga0500646_0001190
548 Ga0500646_0050022
549 Ga0500646_0069967
550 Ga0500583_0025868
551 Ga0500556_0043416
552 Ga0500556_0069589
553 Ga0500562_000094
554 Ga0500562_073810
555 Ga0500594_0010648
556 Ga0500594_0054010
557 Ga0500652_031544
558 Ga0500655_009143
559 Ga0500622_0000652
560 Ga0500622_0025588
561 Ga0500637_0014359
562 Ga0500645_005067
563 Ga0500661_007640
564 Ga0590071_020836
565 Ga0590071_061880
566 Ga0590074_027739
567 Ga0590075_012045
568 Ga0466962_0380395
569 2819585739
570 2929159544

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02190

LON_substr_bdg

ATP-dependent protease La (LON) substrate-binding domain

28

205

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6u-assembly1.cif.gz_C lon protease from thermus thermophilus 0.8477 3 199
2ane-assembly1.cif.gz_D crystal structure of n-terminal domain of e.coli lon protease 0.8332 3 106
3ljc-assembly1.cif.gz_A crystal structure of lon n-terminal domain. 0.824 1 199
7p6u-assembly1.cif.gz_F lon protease from thermus thermophilus 0.8222 3 199
7cay-assembly1.cif.gz_A crystal structure of lon n-terminal domain protein from xanthomonas campestris 0.8031 3 178
ID Description Score Start End Superfamily
af_I1K7N5_54_171_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9177 2 106 2.30.130.40
af_B4FM67_80_193_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9127 1 106 2.30.130.40
af_I1KCV7_279_380_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9013 3 108 2.30.130.40
af_K7KDV3_6_113_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.898 5 95 2.30.130.40
af_I1KCV7_279_380_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.8931 3 108 2.30.130.40
ID Description Score Start End GO Terms
AF-A0A537JS05-F1-model_v4 Peptidase S16 0.9977 1 183
AF-A0A537JS05-F1-model_v4 Peptidase S16 0.9869 1 183
AF-A0A7Y5XXK5-F1-model_v4 Peptidase S16 0.968 5 99
AF-A0A537TLV3-F1-model_v4 Lon N-terminal domain-containing protein 0.9579 5 82
AF-A0A1C4B1M9-F1-model_v4 Lon N-terminal domain-containing protein 0.9566 1 209

Map