F386325

General Info

Members Datasets Scaffolds Average Seq Length
284 186 568 120

Family's Representative Sequence

Representative Sequence 3300041511|Ga0451855_0701009|Ga0451855_0701009_285_689
Length 134
Sequence MDPGVRQDDDWISGPILMTTLYGLKNCDTCKKATKWLDRFGVAYSFVDYRDDKRSPETLLEWSKQAGGWDTLINKSSTTWRQLPENRKTPGSEAEWKLLLREYPQLIRRPVVVTNDGVMTQGFSDNGFKKLFGK

Samples

Sample ID Description Type Environment
1 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
40 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
41 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
84 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
85 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
86 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
96 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
97 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
104 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
105 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
106 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
107 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
108 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
109 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
110 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
111 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
112 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
113 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
114 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
115 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
116 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
117 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
118 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
119 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
120 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
121 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
122 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
123 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
124 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
125 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
126 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
127 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
137 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
151 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
152 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
164 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
165 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
166 2643221559 Lysobacter sp. Root559 Isolate Unclassified
167 2643221573 Lysobacter sp. Root604 Isolate Unclassified
168 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
169 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
170 2643221586 Lysobacter sp. Root667 Isolate Unclassified
171 2643221593 Lysobacter sp. Root690 Isolate Unclassified
172 2643221612 Lysobacter sp. Root76 Isolate Unclassified
173 2643221695 Lysobacter sp. Root494 Isolate Unclassified
174 2643221720 Lysobacter sp. Root916 Isolate Unclassified
175 2643221727 Lysobacter sp. Root96 Isolate Unclassified
176 2643221728 Lysobacter sp. Root983 Isolate Unclassified
177 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
178 2818991457 Xanthomonas translucens 569 Isolate Unclassified
179 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
180 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
181 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
182 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
183 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
184 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
185 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
186 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.61
Metatranscriptomes 0
Isolates 7.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.56
Nodule 0.35
Rhizoplane 13.03
Rhizosphere 54.58
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451855_0701009 3300041511 Bacteria 773
2 SwRhRL2b_contig_45537 2162886007 Bacteria 3892
3 Ga0055537_1000695 3300003773 Bacteria 17497
4 Ga0055536_1001443 3300003781 Bacteria 14353
5 Ga0055536_1004015 3300003781 Bacteria 7680
6 Ga0055534_1000089 3300003784 Bacteria 71523
7 Ga0055528_1000585 3300003790 Bacteria 27488
8 Ga0055531_10009527 3300003794 Bacteria 4956
9 Ga0055531_10012914 3300003794 Bacteria 3890
10 Ga0055531_10017726 3300003794 Bacteria 2987
11 Ga0055531_10032523 3300003794 Bacteria 1702
12 Ga0058692_1000020 3300003856 Bacteria 250589
13 Ga0065714_10014443 3300005288 Bacteria 2646
14 Ga0065704_10077265 3300005289 Bacteria 4796
15 Ga0065704_10097718 3300005289 Bacteria 2382
16 Ga0065715_10027404 3300005293 Bacteria 2064
17 Ga0065715_10179389 3300005293 Bacteria 1464
18 Ga0070658_11167542 3300005327 Bacteria 669
19 Ga0070683_100606518 3300005329 Bacteria 1048
20 Ga0070670_100002284 3300005331 Bacteria 15790
21 Ga0070670_100425101 3300005331 Bacteria 1175
22 Ga0070670_100574058 3300005331 Bacteria 1008
23 Ga0070680_101420941 3300005336 Bacteria 601
24 Ga0070660_100244639 3300005339 Bacteria 1462
25 Ga0070661_100296053 3300005344 Bacteria 1259
26 Ga0070668_100016377 3300005347 Bacteria 5543
27 Ga0070668_100487614 3300005347 Bacteria 1065
28 Ga0070669_100318906 3300005353 Bacteria 1254
29 Ga0070669_100379742 3300005353 Bacteria 1152
30 Ga0070669_100504399 3300005353 Bacteria 1004
31 Ga0070675_100404968 3300005354 Bacteria 1218
32 Ga0070675_101007349 3300005354 Bacteria 765
33 Ga0070675_101010240 3300005354 Bacteria 764
34 Ga0070671_100548599 3300005355 Bacteria 997
35 Ga0070674_100014421 3300005356 Bacteria 4914
36 Ga0070674_100156286 3300005356 Bacteria 1726
37 Ga0070673_100381264 3300005364 Bacteria 1257
38 Ga0070667_100475243 3300005367 Bacteria 1144
39 Ga0068867_100069149 3300005459 Bacteria 2637
40 Ga0070679_100035870 3300005530 Bacteria 4920
41 Ga0070672_100098904 3300005543 Bacteria 2363
42 Ga0070665_100148805 3300005548 Bacteria 2344
43 Ga0070665_100839479 3300005548 Bacteria 932
44 Ga0070664_100200154 3300005564 Bacteria 1782
45 Ga0070664_100644101 3300005564 Bacteria 985
46 Ga0070664_101856322 3300005564 Bacteria 572
47 Ga0081455_10597569 3300005937 Bacteria 720
48 Ga0075365_10338552 3300006038 Bacteria 1060
49 Ga0075364_10166193 3300006051 Bacteria 1491
50 Ga0075369_10339916 3300006186 Bacteria 704
51 Ga0099826_10293116 3300006948 Bacteria 835
52 Ga0105251_10000010 3300009011 Bacteria 186242
53 Ga0105242_10422781 3300009176 Bacteria 1249
54 Ga0105242_11047910 3300009176 Bacteria 826
55 Ga0105237_12450374 3300009545 Bacteria 532
56 Ga0105249_11127088 3300009553 Bacteria 855
57 Ga0105148_102296 3300009978 Bacteria 1341
58 Ga0105028_104617 3300009993 Bacteria 1435
59 Ga0157327_1021000 3300012512 Bacteria 737
60 Ga0157327_1029941 3300012512 Bacteria 673
61 Ga0157373_10167721 3300013100 Bacteria 1545
62 Ga0157373_10183757 3300013100 Bacteria 1472
63 Ga0157373_10289349 3300013100 Bacteria 1162
64 Ga0157378_11893744 3300013297 Bacteria 645
65 Ga0157372_12865932 3300013307 Bacteria 552
66 Ga0157375_10655073 3300013308 Bacteria 1206
67 Ga0182006_1016167 3300015261 Bacteria 3186
68 Ga0182006_1039474 3300015261 Bacteria 1862
69 Ga0182006_1084283 3300015261 Bacteria 1154
70 Ga0182005_1005941 3300015265 Bacteria 3777
71 Ga0163161_10170424 3300017792 Bacteria 1664
72 Ga0163161_10320104 3300017792 Bacteria 1226
73 Ga0209565_1000014 3300025263 Bacteria 530302
74 Ga0209565_1000081 3300025263 Bacteria 155639
75 Ga0209673_1000904 3300025273 Bacteria 37938
76 Ga0209675_1000021 3300025291 Bacteria 334833
77 Ga0209676_1000024 3300025292 Bacteria 578839
78 Ga0209676_1001141 3300025292 Bacteria 29048
79 Ga0209564_1000263 3300025295 Bacteria 112148
80 Ga0209256_1008445 3300025299 Bacteria 4773
81 Ga0209256_1013844 3300025299 Bacteria 2962
82 Ga0209257_1000148 3300025304 Bacteria 193131
83 Ga0209257_1000180 3300025304 Bacteria 158090
84 Ga0209257_1003198 3300025304 Bacteria 14522
85 Ga0209257_1011237 3300025304 Bacteria 4345
86 Ga0207713_1000292 3300025735 Bacteria 57738
87 Ga0207660_10207486 3300025917 Bacteria 1533
88 Ga0207657_10212621 3300025919 Bacteria 1551
89 Ga0207657_10735056 3300025919 Bacteria 765
90 Ga0207649_10820279 3300025920 Bacteria 727
91 Ga0207652_10207414 3300025921 Bacteria 1764
92 Ga0207681_10163875 3300025923 Bacteria 1679
93 Ga0207681_10303511 3300025923 Bacteria 1264
94 Ga0207650_10017366 3300025925 Bacteria 5038
95 Ga0207650_10506661 3300025925 Bacteria 1009
96 Ga0207659_10070002 3300025926 Bacteria 2557
97 Ga0207659_10606342 3300025926 Bacteria 934
98 Ga0207659_10833893 3300025926 Bacteria 792
99 Ga0207644_10092153 3300025931 Bacteria 2260
100 Ga0207644_11515784 3300025931 Unclassified 563
101 Ga0207686_11212828 3300025934 Bacteria 618
102 Ga0207709_10003032 3300025935 Bacteria 10197
103 Ga0207669_10077698 3300025937 Bacteria 2112
104 Ga0207669_10467496 3300025937 Bacteria 1003
105 Ga0207691_10017313 3300025940 Bacteria 6835
106 Ga0207711_10889524 3300025941 Bacteria 828
107 Ga0207661_10677422 3300025944 Bacteria 948
108 Ga0207679_10160453 3300025945 Bacteria 1840
109 Ga0207679_10281904 3300025945 Bacteria 1425
110 Ga0207651_10517218 3300025960 Bacteria 1034
111 Ga0207668_10033477 3300025972 Bacteria 3404
112 Ga0207678_11529766 3300026067 Bacteria 589
113 Ga0207708_10123664 3300026075 Bacteria 2018
114 Ga0207648_10103781 3300026089 Bacteria 2493
115 Ga0207675_100736177 3300026118 Bacteria 997
116 Ga0207683_10124662 3300026121 Bacteria 2314
117 Ga0207698_11324172 3300026142 Bacteria 735
118 Ga0209371_1000011 3300027312 Bacteria 848456
119 Ga0209974_10016576 3300027876 Bacteria 2446
120 Ga0268266_10502994 3300028379 Bacteria 1157
121 Ga0268256_1000011 3300030500 Bacteria 848625
122 Ga0316177_1088878 3300030731 Bacteria 714
123 Ga0316183_1205388 3300030742 Bacteria 10997
124 Ga0316182_1194389 3300030745 Bacteria 1194
125 Ga0307513_10106433 3300031456 Bacteria 2810
126 Ga0307513_10318043 3300031456 Bacteria 1316
127 Ga0307509_10233423 3300031507 Bacteria 1640
128 Ga0307408_100814137 3300031548 Bacteria 849
129 Ga0307413_10000289 3300031824 Bacteria 15520
130 Ga0307413_10399049 3300031824 Bacteria 1077
131 Ga0307413_12013605 3300031824 Bacteria 521
132 Ga0307406_10054694 3300031901 Bacteria 2548
133 Ga0307412_10452543 3300031911 Bacteria 1058
134 Ga0307412_10462904 3300031911 Bacteria 1048
135 Ga0307414_10000721 3300032004 Bacteria 16939
136 Ga0307414_10005212 3300032004 Bacteria 7139
137 Ga0307414_10036014 3300032004 Bacteria 3299
138 Ga0307414_10098302 3300032004 Bacteria 2195
139 Ga0307414_10126961 3300032004 Bacteria 1972
140 Ga0307414_10202068 3300032004 Bacteria 1617
141 Ga0307414_12094195 3300032004 Bacteria 528
142 Ga0307411_10344972 3300032005 Bacteria 1212
143 Ga0307411_11149772 3300032005 Bacteria 702
144 Ga0373930_0121295 3300034816 Bacteria 637
145 Ga0373950_0057315 3300034818 Bacteria 776
146 Ga0373952_0016301 3300035092 Bacteria 1509
147 Ga0395899_0106209 3300037312 Bacteria 2022
148 Ga0395900_0062529 3300037418 Bacteria 3827
149 Ga0395898_0352564 3300037466 Bacteria 1403
150 Ga0395898_1085083 3300037466 Bacteria 734
151 Ga0395905_0004849 3300037471 Bacteria 13871
152 Ga0395905_0080554 3300037471 Bacteria 3051
153 Ga0395901_0005473 3300038443 Bacteria 12858
154 Ga0439436_0021100 3300041404 Bacteria 1938
155 Ga0439436_0089656 3300041404 Bacteria 856
156 Ga0439439_0021481 3300041406 Bacteria 1608
157 Ga0439465_0003871 3300041413 Bacteria 4883
158 Ga0439465_0005202 3300041413 Bacteria 4169
159 Ga0451787_060824 3300041441 Bacteria 643
160 Ga0451789_0623999 3300041443 Bacteria 527
161 Ga0451789_0933608 3300041443 Bacteria 907
162 Ga0451789_1158698 3300041443 Bacteria 775
163 Ga0451791_0110364 3300041451 Bacteria 899
164 Ga0451791_0433900 3300041451 Bacteria 2396
165 Ga0451791_0966745 3300041451 Bacteria 1141
166 Ga0451791_1834064 3300041451 Bacteria 903
167 Ga0451793_0214991 3300041452 Bacteria 641
168 Ga0451793_1248729 3300041452 Bacteria 897
169 Ga0451793_1306742 3300041452 Bacteria 1134
170 Ga0451793_1840451 3300041452 Bacteria 1179
171 Ga0451797_1011254 3300041453 Bacteria 1150
172 Ga0451797_1338363 3300041453 Bacteria 861
173 Ga0451795_0540838 3300041456 Bacteria 644
174 Ga0451795_0606275 3300041456 Bacteria 769
175 Ga0451795_0611161 3300041456 Bacteria 752
176 Ga0451800_0377454 3300041459 Bacteria 9861
177 Ga0451802_0401666 3300041460 Bacteria 863
178 Ga0451802_1860401 3300041460 Bacteria 1992
179 Ga0451806_022060 3300041462 Bacteria 1185
180 Ga0451804_0068330 3300041463 Bacteria 567
181 Ga0451807_0728605 3300041486 Bacteria 3223
182 Ga0451807_1424668 3300041486 Bacteria 3451
183 Ga0451807_2159426 3300041486 Bacteria 1191
184 Ga0451837_0026769 3300041494 Bacteria 770
185 Ga0451837_0978859 3300041494 Bacteria 1143
186 Ga0451839_0240882 3300041496 Bacteria 1539
187 Ga0451845_0974495 3300041501 Bacteria 912
188 Ga0451849_0536073 3300041505 Bacteria 590
189 Ga0451851_0936658 3300041507 Bacteria 506
190 Ga0451843_0121813 3300041509 Bacteria 693
191 Ga0451843_0618192 3300041509 Bacteria 521
192 Ga0451843_1735662 3300041509 Bacteria 1207
193 Ga0439431_0063497 3300041997 Bacteria 975
194 Ga0439433_0023870 3300041999 Bacteria 1377
195 Ga0439432_059151 3300042006 Bacteria 1184
196 Ga0439432_088494 3300042006 Bacteria 933
197 Ga0439449_0038233 3300042007 Bacteria 1785
198 Ga0439449_0067974 3300042007 Bacteria 1313
199 Ga0439449_0142508 3300042007 Bacteria 892
200 Ga0439462_0031002 3300042015 Bacteria 1415
201 Ga0495638_0071458 3300046460 Bacteria 2123
202 Ga0495643_0002788 3300046522 Bacteria 13352
203 Ga0495663_0014559 3300046525 Bacteria 2205
204 Ga0495663_0019984 3300046525 Bacteria 1920
205 Ga0495621_0105583 3300046539 Bacteria 1076
206 Ga0495633_0230209 3300046558 Bacteria 847
207 Ga0495656_0029373 3300046615 Bacteria 2213
208 Ga0495668_0154601 3300046616 Bacteria 1256
209 Ga0495625_0667965 3300046660 Bacteria 617
210 Ga0495661_0134847 3300046665 Bacteria 1349
211 Ga0495660_0008944 3300046810 Bacteria 5851
212 Ga0495636_0229632 3300047318 Bacteria 853
213 Ga0495672_0000308 3300047320 Bacteria 65628
214 Ga0495686_0046914 3300047472 Bacteria 2729
215 Ga0496100_0667586 3300048903 Bacteria 810
216 Ga0496101_0077156 3300048904 Bacteria 2455
217 Ga0496101_0119864 3300048904 Bacteria 1988
218 Ga0496102_0244995 3300048905 Bacteria 1690
219 Ga0496105_0554960 3300048908 Bacteria 896
220 Ga0496107_0456038 3300048910 Bacteria 949
221 Ga0496109_0044164 3300048912 Bacteria 4042
222 Ga0496109_1711119 3300048912 Bacteria 563
223 Ga0496110_0530040 3300048913 Bacteria 1071
224 Ga0496112_0772116 3300048915 Bacteria 886
225 Ga0496112_1023470 3300048915 Bacteria 745
226 Ga0496113_0032447 3300048916 Bacteria 3796
227 Ga0496116_0118807 3300048919 Bacteria 1535
228 Ga0496116_0158201 3300048919 Bacteria 1247
229 Ga0496116_0379477 3300048919 Bacteria 634
230 Ga0496117_0000921 3300048920 Bacteria 45010
231 Ga0496117_0004978 3300048920 Bacteria 14251
232 Ga0496117_0051105 3300048920 Bacteria 2925
233 Ga0496118_0005500 3300048921 Bacteria 14377
234 Ga0496118_0015060 3300048921 Bacteria 7189
235 Ga0496118_0043466 3300048921 Bacteria 3531
236 Ga0496118_0045909 3300048921 Bacteria 3403
237 Ga0496118_0495962 3300048921 Bacteria 608
238 Ga0496119_0000320 3300048922 Bacteria 67229
239 Ga0496120_0000424 3300048923 Bacteria 67451
240 Ga0496122_0000220 3300048925 Bacteria 127065
241 Ga0496122_0000680 3300048925 Bacteria 68089
242 Ga0496122_0007784 3300048925 Bacteria 11783
243 Ga0496122_0089792 3300048925 Bacteria 2099
244 Ga0496122_0234502 3300048925 Bacteria 1040
245 Ga0496123_0000151 3300048926 Bacteria 141062
246 Ga0496123_0000226 3300048926 Bacteria 113889
247 Ga0496123_0050529 3300048926 Bacteria 2777
248 Ga0496123_0076856 3300048926 Bacteria 2053
249 Ga0496123_0100315 3300048926 Bacteria 1687
250 Ga0496124_0000705 3300048927 Bacteria 54667
251 Ga0496124_0029605 3300048927 Bacteria 4875
252 Ga0496124_0032992 3300048927 Bacteria 4562
253 Ga0496124_0139727 3300048927 Bacteria 1913
254 Ga0496124_0158810 3300048927 Bacteria 1764
255 Ga0496125_0002787 3300048928 Bacteria 22098
256 Ga0496125_0017331 3300048928 Bacteria 6875
257 Ga0496126_0282293 3300048929 Bacteria 1375
258 Ga0501034_0000822 3300049571 Bacteria 46209
259 nmdc:mga00v17_354432_c1 3300050491 Bacteria 954
260 nmdc:mga0yw44_654339_c1 3300050492 Bacteria 714
261 nmdc:mga0sz30_180617_c1 3300050516 Bacteria 936
262 Ga0500644_0090554 3300053088 Bacteria 1144
263 Ga0500634_0000101 3300053161 Bacteria 33679
264 2643819014 2643221559 Bacteria 4424915
265 2643879532 2643221573 Bacteria 4784121
266 2643905681 2643221579 Bacteria 4443405
267 2643913190 2643221581 Bacteria 3893603
268 2643941317 2643221586 Bacteria 4446529
269 2643974419 2643221593 Bacteria 6296053
270 2644080438 2643221612 Bacteria 4361984
271 2644528771 2643221695 Bacteria 3441323
272 2644662857 2643221720 Bacteria 4694283
273 2644697051 2643221727 Bacteria 4415595
274 2644698188 2643221728 Bacteria 4797149
275 2748015931 2747842501 Bacteria 5293829
276 2819663634 2818991457 Bacteria 5323295
277 2852651361 2852649853 Bacteria 4036942
278 2894416074 2894414249 Bacteria 4405451
279 2919132445 2919130084 Bacteria 5301837
280 2929197087 2929195423 Bacteria 5325372
281 2941489622 2941489479 Bacteria 6313767
282 2987608234 2987605356 Bacteria 4187822
283 2995950840 2995948881 Bacteria 6358104
284 8002871653 8002869464 Bacteria 3588529
285 Ga0451855_0701009
286 SwRhRL2b_contig_45537
287 Ga0055537_1000695
288 Ga0055536_1001443
289 Ga0055536_1004015
290 Ga0055534_1000089
291 Ga0055528_1000585
292 Ga0055531_10009527
293 Ga0055531_10012914
294 Ga0055531_10017726
295 Ga0055531_10032523
296 Ga0058692_1000020
297 Ga0065714_10014443
298 Ga0065704_10077265
299 Ga0065704_10097718
300 Ga0065715_10027404
301 Ga0065715_10179389
302 Ga0070658_11167542
303 Ga0070683_100606518
304 Ga0070670_100002284
305 Ga0070670_100425101
306 Ga0070670_100574058
307 Ga0070680_101420941
308 Ga0070660_100244639
309 Ga0070661_100296053
310 Ga0070668_100016377
311 Ga0070668_100487614
312 Ga0070669_100318906
313 Ga0070669_100379742
314 Ga0070669_100504399
315 Ga0070675_100404968
316 Ga0070675_101007349
317 Ga0070675_101010240
318 Ga0070671_100548599
319 Ga0070674_100014421
320 Ga0070674_100156286
321 Ga0070673_100381264
322 Ga0070667_100475243
323 Ga0068867_100069149
324 Ga0070679_100035870
325 Ga0070672_100098904
326 Ga0070665_100148805
327 Ga0070665_100839479
328 Ga0070664_100200154
329 Ga0070664_100644101
330 Ga0070664_101856322
331 Ga0081455_10597569
332 Ga0075365_10338552
333 Ga0075364_10166193
334 Ga0075369_10339916
335 Ga0099826_10293116
336 Ga0105251_10000010
337 Ga0105242_10422781
338 Ga0105242_11047910
339 Ga0105237_12450374
340 Ga0105249_11127088
341 Ga0105148_102296
342 Ga0105028_104617
343 Ga0157327_1021000
344 Ga0157327_1029941
345 Ga0157373_10167721
346 Ga0157373_10183757
347 Ga0157373_10289349
348 Ga0157378_11893744
349 Ga0157372_12865932
350 Ga0157375_10655073
351 Ga0182006_1016167
352 Ga0182006_1039474
353 Ga0182006_1084283
354 Ga0182005_1005941
355 Ga0163161_10170424
356 Ga0163161_10320104
357 Ga0209565_1000014
358 Ga0209565_1000081
359 Ga0209673_1000904
360 Ga0209675_1000021
361 Ga0209676_1000024
362 Ga0209676_1001141
363 Ga0209564_1000263
364 Ga0209256_1008445
365 Ga0209256_1013844
366 Ga0209257_1000148
367 Ga0209257_1000180
368 Ga0209257_1003198
369 Ga0209257_1011237
370 Ga0207713_1000292
371 Ga0207660_10207486
372 Ga0207657_10212621
373 Ga0207657_10735056
374 Ga0207649_10820279
375 Ga0207652_10207414
376 Ga0207681_10163875
377 Ga0207681_10303511
378 Ga0207650_10017366
379 Ga0207650_10506661
380 Ga0207659_10070002
381 Ga0207659_10606342
382 Ga0207659_10833893
383 Ga0207644_10092153
384 Ga0207644_11515784
385 Ga0207686_11212828
386 Ga0207709_10003032
387 Ga0207669_10077698
388 Ga0207669_10467496
389 Ga0207691_10017313
390 Ga0207711_10889524
391 Ga0207661_10677422
392 Ga0207679_10160453
393 Ga0207679_10281904
394 Ga0207651_10517218
395 Ga0207668_10033477
396 Ga0207678_11529766
397 Ga0207708_10123664
398 Ga0207648_10103781
399 Ga0207675_100736177
400 Ga0207683_10124662
401 Ga0207698_11324172
402 Ga0209371_1000011
403 Ga0209974_10016576
404 Ga0268266_10502994
405 Ga0268256_1000011
406 Ga0316177_1088878
407 Ga0316183_1205388
408 Ga0316182_1194389
409 Ga0307513_10106433
410 Ga0307513_10318043
411 Ga0307509_10233423
412 Ga0307408_100814137
413 Ga0307413_10000289
414 Ga0307413_10399049
415 Ga0307413_12013605
416 Ga0307406_10054694
417 Ga0307412_10452543
418 Ga0307412_10462904
419 Ga0307414_10000721
420 Ga0307414_10005212
421 Ga0307414_10036014
422 Ga0307414_10098302
423 Ga0307414_10126961
424 Ga0307414_10202068
425 Ga0307414_12094195
426 Ga0307411_10344972
427 Ga0307411_11149772
428 Ga0373930_0121295
429 Ga0373950_0057315
430 Ga0373952_0016301
431 Ga0395899_0106209
432 Ga0395900_0062529
433 Ga0395898_0352564
434 Ga0395898_1085083
435 Ga0395905_0004849
436 Ga0395905_0080554
437 Ga0395901_0005473
438 Ga0439436_0021100
439 Ga0439436_0089656
440 Ga0439439_0021481
441 Ga0439465_0003871
442 Ga0439465_0005202
443 Ga0451787_060824
444 Ga0451789_0623999
445 Ga0451789_0933608
446 Ga0451789_1158698
447 Ga0451791_0110364
448 Ga0451791_0433900
449 Ga0451791_0966745
450 Ga0451791_1834064
451 Ga0451793_0214991
452 Ga0451793_1248729
453 Ga0451793_1306742
454 Ga0451793_1840451
455 Ga0451797_1011254
456 Ga0451797_1338363
457 Ga0451795_0540838
458 Ga0451795_0606275
459 Ga0451795_0611161
460 Ga0451800_0377454
461 Ga0451802_0401666
462 Ga0451802_1860401
463 Ga0451806_022060
464 Ga0451804_0068330
465 Ga0451807_0728605
466 Ga0451807_1424668
467 Ga0451807_2159426
468 Ga0451837_0026769
469 Ga0451837_0978859
470 Ga0451839_0240882
471 Ga0451845_0974495
472 Ga0451849_0536073
473 Ga0451851_0936658
474 Ga0451843_0121813
475 Ga0451843_0618192
476 Ga0451843_1735662
477 Ga0439431_0063497
478 Ga0439433_0023870
479 Ga0439432_059151
480 Ga0439432_088494
481 Ga0439449_0038233
482 Ga0439449_0067974
483 Ga0439449_0142508
484 Ga0439462_0031002
485 Ga0495638_0071458
486 Ga0495643_0002788
487 Ga0495663_0014559
488 Ga0495663_0019984
489 Ga0495621_0105583
490 Ga0495633_0230209
491 Ga0495656_0029373
492 Ga0495668_0154601
493 Ga0495625_0667965
494 Ga0495661_0134847
495 Ga0495660_0008944
496 Ga0495636_0229632
497 Ga0495672_0000308
498 Ga0495686_0046914
499 Ga0496100_0667586
500 Ga0496101_0077156
501 Ga0496101_0119864
502 Ga0496102_0244995
503 Ga0496105_0554960
504 Ga0496107_0456038
505 Ga0496109_0044164
506 Ga0496109_1711119
507 Ga0496110_0530040
508 Ga0496112_0772116
509 Ga0496112_1023470
510 Ga0496113_0032447
511 Ga0496116_0118807
512 Ga0496116_0158201
513 Ga0496116_0379477
514 Ga0496117_0000921
515 Ga0496117_0004978
516 Ga0496117_0051105
517 Ga0496118_0005500
518 Ga0496118_0015060
519 Ga0496118_0043466
520 Ga0496118_0045909
521 Ga0496118_0495962
522 Ga0496119_0000320
523 Ga0496120_0000424
524 Ga0496122_0000220
525 Ga0496122_0000680
526 Ga0496122_0007784
527 Ga0496122_0089792
528 Ga0496122_0234502
529 Ga0496123_0000151
530 Ga0496123_0000226
531 Ga0496123_0050529
532 Ga0496123_0076856
533 Ga0496123_0100315
534 Ga0496124_0000705
535 Ga0496124_0029605
536 Ga0496124_0032992
537 Ga0496124_0139727
538 Ga0496124_0158810
539 Ga0496125_0002787
540 Ga0496125_0017331
541 Ga0496126_0282293
542 Ga0501034_0000822
543 nmdc:mga00v17_354432_c1
544 nmdc:mga0yw44_654339_c1
545 nmdc:mga0sz30_180617_c1
546 Ga0500644_0090554
547 Ga0500634_0000101
548 2643819014
549 2643879532
550 2643905681
551 2643913190
552 2643941317
553 2643974419
554 2644080438
555 2644528771
556 2644662857
557 2644697051
558 2644698188
559 2748015931
560 2819663634
561 2852651361
562 2894416074
563 2919132445
564 2929197087
565 2941489622
566 2987608234
567 2995950840
568 8002871653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

22

131

0.91

PF00462

Glutaredoxin

Glutaredoxin

19

72

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nv6-assembly3.cif.gz_C crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri with glutathione bound 0.9094 2 31
6nxv-assembly3.cif.gz_C crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.9091 2 31
1rw1-assembly1.cif.gz_A yffb (pa3664) protein 0.9068 1 113
3zmk-assembly1.cif.gz_A anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa 0.8989 1 31
6nxv-assembly1.cif.gz_A crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.8912 2 31
ID Description Score Start End Superfamily
af_A0A1D6IL16_82_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9906 2 31 3.40.30.10
4ke3D01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9438 1 29 3.40.30.10
af_Q4D776_60_147_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9396 1 30 3.40.30.10
3cbuB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9238 3 31 3.40.30.10
af_P24178_1_117_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9069 1 116 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A126NJT2-F1-model_v4 Arsenate reductase 0.9977 1 118
AF-A0A8A6YAR3-F1-model_v4 deleted 0.9975 1 118
AF-A0A381LNV8-F1-model_v4 deleted 0.9961 1 118
AF-Z9JIK5-F1-model_v4 Arsenate reductase 0.9959 1 118
AF-A0A7Z7J3K0-F1-model_v4 Arsenate reductase 0.995 1 118

Map