F386161

General Info

Members Datasets Scaffolds Average Seq Length
284 160 568 284

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10000953|Ga0105245_1000095328
Length 343
Sequence MWLITGAVRGMGVDIARAALAAGNAVVATGRNPEKVTRAVGAADDLLAVKLDITDPADADAAVQAAVDRFGRIDVLVNNAGNFYAGFFEEVSPEHFRAQIETNLFGPVNVTRAVLPVMRTQRSGLIVTMSSTAGIAGQEFTSAYATSKFALEGWIESLSPEVAPFGIRTMLVEPGFFRTELLEDASTTWPAPSIDDYADRTRRTVAAWQAMNGRQGGDPAKLAAALVQLASRDEPPAPTRSQPWSRRQGPCSPRSMPTGAVRGAFYPSLRPLFRAACRRTSSATACGSVVSKSMSFAQVGVMTIRTMPSTYNPRTPASHSTRCSGVMWSALFMPMNSSGMWST

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 2.82
Rhizosphere 95.42
Stem 0
Stem Tuber 0
Unclassified 1.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10000953 3300009098 Bacteria 26302
2 Ga0065704_10000466 3300005289 Bacteria 25227
3 Ga0065707_10000841 3300005295 Bacteria 28277
4 Ga0070658_10117940 3300005327 Bacteria 2204
5 Ga0070676_10148286 3300005328 Bacteria 1499
6 Ga0070690_100026951 3300005330 Bacteria 3550
7 Ga0068869_100005225 3300005334 Bacteria 8154
8 Ga0068869_100013368 3300005334 Bacteria 5459
9 Ga0068869_100180737 3300005334 Bacteria 1654
10 Ga0070666_10065797 3300005335 Bacteria 2459
11 Ga0070680_100395369 3300005336 Bacteria 1178
12 Ga0070682_100142523 3300005337 Bacteria 1635
13 Ga0068868_100330507 3300005338 Bacteria 1301
14 Ga0070660_100138028 3300005339 Bacteria 1954
15 Ga0070689_100045527 3300005340 Bacteria 3379
16 Ga0070691_10176318 3300005341 Bacteria 1110
17 Ga0070687_100093232 3300005343 Bacteria 1670
18 Ga0070668_100094640 3300005347 Bacteria 2359
19 Ga0070668_100147956 3300005347 Bacteria 1897
20 Ga0070671_100013613 3300005355 Bacteria 6559
21 Ga0070673_100104862 3300005364 Bacteria 2335
22 Ga0070673_100260124 3300005364 Bacteria 1516
23 Ga0070713_100200905 3300005436 Bacteria 1800
24 Ga0070710_10018017 3300005437 Bacteria 3626
25 Ga0070711_100058684 3300005439 Bacteria 2669
26 Ga0070705_100001386 3300005440 Bacteria 12869
27 Ga0070705_100036829 3300005440 Bacteria 2754
28 Ga0070694_100033775 3300005444 Bacteria 3370
29 Ga0070708_100012193 3300005445 Bacteria 7009
30 Ga0070708_100075139 3300005445 Bacteria 3049
31 Ga0070662_100001717 3300005457 Bacteria 13476
32 Ga0070681_10046023 3300005458 Bacteria 4363
33 Ga0070681_10049271 3300005458 Bacteria 4208
34 Ga0070681_10260711 3300005458 Bacteria 1645
35 Ga0070681_10322612 3300005458 Bacteria 1454
36 Ga0068867_100005908 3300005459 Bacteria 8683
37 Ga0068867_100416753 3300005459 Bacteria 1137
38 Ga0070706_100001518 3300005467 Bacteria 24335
39 Ga0070707_100003540 3300005468 Bacteria 14741
40 Ga0070707_100022606 3300005468 Bacteria 5946
41 Ga0070707_100048795 3300005468 Bacteria 4056
42 Ga0070707_100331643 3300005468 Bacteria 1478
43 Ga0070698_100001854 3300005471 Bacteria 23543
44 Ga0070698_100018761 3300005471 Bacteria 7281
45 Ga0070698_100581028 3300005471 Bacteria 1060
46 Ga0070699_100046181 3300005518 Bacteria 3769
47 Ga0070699_100077854 3300005518 Bacteria 2887
48 Ga0070679_100069556 3300005530 Bacteria 3511
49 Ga0070679_100149205 3300005530 Bacteria 2316
50 Ga0070679_100286109 3300005530 Bacteria 1600
51 Ga0070684_100086310 3300005535 Bacteria 2785
52 Ga0070697_100000008 3300005536 Bacteria 191922
53 Ga0070697_100130803 3300005536 Bacteria 2105
54 Ga0068853_100090733 3300005539 Bacteria 2686
55 Ga0070672_100183826 3300005543 Bacteria 1743
56 Ga0070695_100004362 3300005545 Bacteria 8292
57 Ga0070695_100057579 3300005545 Bacteria 2512
58 Ga0070695_100183387 3300005545 Bacteria 1484
59 Ga0070696_100002314 3300005546 Bacteria 12572
60 Ga0070696_100375210 3300005546 Bacteria 1107
61 Ga0070696_100594220 3300005546 Bacteria 892
62 Ga0070704_100017889 3300005549 Bacteria 4522
63 Ga0068857_100781597 3300005577 Bacteria 911
64 Ga0068854_100002045 3300005578 Bacteria 12367
65 Ga0068852_100098121 3300005616 Bacteria 2637
66 Ga0068864_100183333 3300005618 Bacteria 1915
67 Ga0068864_100439493 3300005618 Bacteria 1246
68 Ga0068866_10001007 3300005718 Bacteria 12379
69 Ga0068863_100006499 3300005841 Bacteria 11467
70 Ga0068863_100079015 3300005841 Bacteria 3116
71 Ga0068858_100077781 3300005842 Bacteria 3082
72 Ga0068860_100003787 3300005843 Bacteria 15557
73 Ga0068860_100566305 3300005843 Bacteria 1139
74 Ga0068862_100129253 3300005844 Bacteria 2233
75 Ga0070717_10192956 3300006028 Bacteria 1780
76 Ga0070717_10241978 3300006028 Bacteria 1591
77 Ga0070717_10561007 3300006028 Bacteria 1034
78 Ga0070715_10048677 3300006163 Bacteria 1813
79 Ga0070716_100054336 3300006173 Bacteria 2287
80 Ga0070712_100169357 3300006175 Bacteria 1693
81 Ga0070712_100236114 3300006175 Bacteria 1454
82 Ga0075369_10138716 3300006186 Bacteria 1108
83 Ga0097621_100011366 3300006237 Bacteria 6551
84 Ga0097621_100109283 3300006237 Bacteria 2335
85 Ga0068871_100069144 3300006358 Bacteria 2899
86 Ga0075428_100099031 3300006844 Bacteria 3178
87 Ga0075428_100207499 3300006844 Bacteria 2117
88 Ga0075430_100015525 3300006846 Bacteria 6484
89 Ga0075431_100092291 3300006847 Bacteria 3125
90 Ga0075431_100577321 3300006847 Bacteria 1110
91 Ga0075434_100007946 3300006871 Bacteria 9831
92 Ga0075434_100101257 3300006871 Bacteria 2887
93 Ga0075434_100169239 3300006871 Bacteria 2205
94 Ga0075434_100191992 3300006871 Bacteria 2063
95 Ga0075434_100413501 3300006871 Bacteria 1370
96 Ga0075429_100007297 3300006880 Bacteria 9594
97 Ga0075429_100053967 3300006880 Bacteria 3497
98 Ga0068865_100000520 3300006881 Bacteria 21527
99 Ga0075436_100174794 3300006914 Bacteria 1516
100 Ga0097620_100003607 3300006931 Bacteria 15781
101 Ga0097620_100099574 3300006931 Bacteria 2962
102 Ga0075435_100024638 3300007076 Bacteria 4672
103 Ga0075435_100174334 3300007076 Bacteria 1815
104 Ga0075435_100269301 3300007076 Bacteria 1453
105 Ga0099795_10023156 3300007788 Bacteria 2058
106 Ga0111539_10020795 3300009094 Bacteria 8079
107 Ga0111539_10188536 3300009094 Bacteria 2407
108 Ga0111539_10544388 3300009094 Bacteria 1352
109 Ga0105247_10067866 3300009101 Bacteria 2223
110 Ga0114129_10027282 3300009147 Bacteria 8085
111 Ga0114129_10041959 3300009147 Bacteria 6442
112 Ga0105243_10000039 3300009148 Bacteria 166207
113 Ga0105243_10007619 3300009148 Bacteria 8320
114 Ga0105243_10088488 3300009148 Bacteria 2544
115 Ga0105243_10227908 3300009148 Bacteria 1651
116 Ga0105241_10031676 3300009174 Bacteria 3959
117 Ga0105241_10097276 3300009174 Bacteria 2333
118 Ga0105242_10000013 3300009176 Bacteria 133981
119 Ga0105242_10000515 3300009176 Bacteria 30355
120 Ga0105242_10004865 3300009176 Bacteria 10396
121 Ga0105242_10167621 3300009176 Bacteria 1928
122 Ga0105248_10002791 3300009177 Bacteria 19407
123 Ga0105248_10019622 3300009177 Bacteria 7483
124 Ga0105248_10020505 3300009177 Bacteria 7325
125 Ga0105248_10534932 3300009177 Bacteria 1322
126 Ga0105237_10382735 3300009545 Bacteria 1412
127 Ga0105237_10524518 3300009545 Bacteria 1191
128 Ga0105238_10386646 3300009551 Bacteria 1391
129 Ga0105238_10618557 3300009551 Bacteria 1092
130 Ga0105249_10032025 3300009553 Bacteria 4755
131 Ga0105249_10156551 3300009553 Bacteria 2198
132 Ga0105249_10207091 3300009553 Bacteria 1922
133 Ga0105249_10315994 3300009553 Bacteria 1572
134 Ga0105239_10041730 3300010375 Bacteria 5027
135 Ga0105239_10061430 3300010375 Unclassified 4124
136 Ga0105239_10320066 3300010375 Bacteria 1749
137 Ga0105246_10036845 3300011119 Bacteria 3279
138 Ga0105246_10203650 3300011119 Bacteria 1540
139 Ga0157371_10035042 3300013102 Bacteria 3598
140 Ga0157369_10174866 3300013105 Bacteria 2261
141 Ga0157369_10310532 3300013105 Bacteria 1640
142 Ga0157374_10109436 3300013296 Bacteria 2656
143 Ga0157374_10369424 3300013296 Bacteria 1427
144 Ga0157378_10040018 3300013297 Unclassified 4158
145 Ga0157378_10217153 3300013297 Bacteria 1816
146 Ga0157378_10412579 3300013297 Bacteria 1333
147 Ga0163162_10036562 3300013306 Unclassified 4895
148 Ga0163162_10257448 3300013306 Bacteria 1877
149 Ga0163162_10285727 3300013306 Bacteria 1781
150 Ga0163162_10381517 3300013306 Bacteria 1543
151 Ga0157372_10053579 3300013307 Bacteria 4497
152 Ga0157372_10094790 3300013307 Bacteria 3400
153 Ga0157372_10247025 3300013307 Bacteria 2071
154 Ga0157372_10435091 3300013307 Bacteria 1529
155 Ga0157375_10195587 3300013308 Bacteria 2177
156 Ga0157375_10279269 3300013308 Bacteria 1833
157 Ga0157375_10318017 3300013308 Bacteria 1721
158 Ga0157375_10416733 3300013308 Bacteria 1509
159 Ga0163163_10019255 3300014325 Bacteria 6407
160 Ga0157380_10625944 3300014326 Bacteria 1069
161 Ga0207653_10000204 3300025885 Bacteria 40118
162 Ga0207642_10000952 3300025899 Bacteria 9050
163 Ga0207642_10057083 3300025899 Bacteria 1794
164 Ga0207645_10004293 3300025907 Bacteria 10576
165 Ga0207643_10045335 3300025908 Bacteria 2483
166 Ga0207684_10071319 3300025910 Bacteria 2952
167 Ga0207707_10088508 3300025912 Bacteria 2705
168 Ga0207695_10160151 3300025913 Bacteria 2183
169 Ga0207663_10318541 3300025916 Bacteria 1168
170 Ga0207660_10042220 3300025917 Bacteria 3200
171 Ga0207660_10317769 3300025917 Bacteria 1243
172 Ga0207652_10041185 3300025921 Bacteria 3925
173 Ga0207652_10466244 3300025921 Bacteria 1138
174 Ga0207646_10002883 3300025922 Bacteria 19953
175 Ga0207646_10011653 3300025922 Bacteria 8501
176 Ga0207646_10293590 3300025922 Bacteria 1469
177 Ga0207646_10312793 3300025922 Bacteria 1419
178 Ga0207681_10024333 3300025923 Bacteria 3885
179 Ga0207687_10001117 3300025927 Bacteria 18250
180 Ga0207687_10219513 3300025927 Bacteria 1496
181 Ga0207644_10233656 3300025931 Bacteria 1462
182 Ga0207706_10000536 3300025933 Bacteria 40290
183 Ga0207686_10000006 3300025934 Bacteria 259583
184 Ga0207686_10000030 3300025934 Bacteria 159065
185 Ga0207686_10000622 3300025934 Bacteria 22055
186 Ga0207686_10210946 3300025934 Bacteria 1396
187 Ga0207686_10406334 3300025934 Bacteria 1038
188 Ga0207709_10000037 3300025935 Bacteria 279771
189 Ga0207709_10005334 3300025935 Bacteria 7312
190 Ga0207669_10003268 3300025937 Bacteria 7011
191 Ga0207704_10002547 3300025938 Bacteria 8214
192 Ga0207691_10160538 3300025940 Bacteria 1972
193 Ga0207691_10263234 3300025940 Bacteria 1486
194 Ga0207711_10003543 3300025941 Bacteria 13516
195 Ga0207711_10009883 3300025941 Bacteria 7934
196 Ga0207689_10007230 3300025942 Bacteria 9751
197 Ga0207689_10013626 3300025942 Bacteria 6933
198 Ga0207667_10026470 3300025949 Bacteria 6336
199 Ga0207651_10039530 3300025960 Bacteria 3112
200 Ga0207640_10008817 3300025981 Bacteria 5614
201 Ga0207708_10076164 3300026075 Bacteria 2573
202 Ga0207641_10077180 3300026088 Bacteria 2882
203 Ga0207648_10000389 3300026089 Bacteria 48602
204 Ga0207676_10040130 3300026095 Bacteria 3586
205 Ga0207683_10005212 3300026121 Bacteria 11161
206 Ga0207428_10446393 3300027907 Bacteria 943
207 Ga0268264_10024589 3300028381 Bacteria 4918
208 Ga0265320_10087014 3300031240 Bacteria 1452
209 Ga0307513_10051086 3300031456 Bacteria 4463
210 Ga0307509_10149693 3300031507 Bacteria 2252
211 Ga0307509_10182672 3300031507 Bacteria 1960
212 Ga0307408_100082581 3300031548 Bacteria 2405
213 Ga0307405_10049779 3300031731 Bacteria 2592
214 Ga0307405_10092424 3300031731 Bacteria 2007
215 Ga0307405_10324788 3300031731 Bacteria 1177
216 Ga0307413_10157552 3300031824 Bacteria 1591
217 Ga0307410_10005845 3300031852 Bacteria 6567
218 Ga0307410_10073774 3300031852 Bacteria 2374
219 Ga0307410_10079060 3300031852 Bacteria 2303
220 Ga0307410_10168399 3300031852 Bacteria 1648
221 Ga0307410_10205298 3300031852 Bacteria 1507
222 Ga0307406_10014280 3300031901 Bacteria 4567
223 Ga0307406_10062464 3300031901 Bacteria 2410
224 Ga0307406_10106148 3300031901 Bacteria 1923
225 Ga0307407_10022437 3300031903 Bacteria 3275
226 Ga0307407_10220929 3300031903 Bacteria 1281
227 Ga0307412_10062780 3300031911 Bacteria 2503
228 Ga0307409_100007517 3300031995 Bacteria 6528
229 Ga0307409_100017360 3300031995 Bacteria 4793
230 Ga0307409_100051484 3300031995 Bacteria 3151
231 Ga0307409_100234075 3300031995 Bacteria 1667
232 Ga0307409_100260989 3300031995 Bacteria 1590
233 Ga0307409_100348527 3300031995 Bacteria 1396
234 Ga0307409_100431943 3300031995 Bacteria 1266
235 Ga0307416_100001891 3300032002 Bacteria 11690
236 Ga0307416_100090653 3300032002 Bacteria 2622
237 Ga0307416_100248250 3300032002 Bacteria 1730
238 Ga0307414_10073718 3300032004 Bacteria 2471
239 Ga0307414_10165103 3300032004 Bacteria 1764
240 Ga0307411_10059158 3300032005 Bacteria 2539
241 Ga0307411_10234911 3300032005 Bacteria 1431
242 Ga0307415_100004894 3300032126 Bacteria 7035
243 Ga0307415_100009384 3300032126 Bacteria 5479
244 Ga0307415_100092762 3300032126 Bacteria 2190
245 Ga0307415_100308282 3300032126 Bacteria 1315
246 Ga0373932_0018351 3300035112 Bacteria 1808
247 Ga0373941_0069363 3300035115 Bacteria 1166
248 Ga0373931_0234698 3300035691 Bacteria 1110
249 Ga0395899_0235992 3300037312 Bacteria 1261
250 Ga0395901_0263650 3300038443 Bacteria 1793
251 Ga0451576_0229676 3300045051 Bacteria 1938
252 Ga0451576_0290805 3300045051 Unclassified 1708
253 Ga0495582_0118064 3300046473 Bacteria 1493
254 Ga0495628_0190908 3300046516 Bacteria 1547
255 Ga0495659_0142531 3300046664 Bacteria 957
256 Ga0495670_0170773 3300046691 Bacteria 1145
257 Ga0495674_0205938 3300047319 Bacteria 1631
258 Ga0496104_0005823 3300048907 Bacteria 10796
259 Ga0496104_0225951 3300048907 Bacteria 1784
260 Ga0496106_0215984 3300048909 Bacteria 1528
261 Ga0496110_0452036 3300048913 Bacteria 1171
262 Ga0496112_0297389 3300048915 Bacteria 1560
263 Ga0496114_0001922 3300048917 Bacteria 15824
264 Ga0496114_0198819 3300048917 Bacteria 1755
265 Ga0496115_0094031 3300048918 Bacteria 2452
266 nmdc:mga05p37_115432_c1 3300050507 Bacteria 3301
267 nmdc:mga05p37_19068_c1 3300050507 Bacteria 8296
268 nmdc:mga09592_173549_c1 3300050508 Bacteria 1865
269 nmdc:mga0qj67_72561_c1 3300050509 Bacteria 2749
270 nmdc:mga06r32_100234_c1 3300050510 Bacteria 2841
271 nmdc:mga06r32_3983_c1 3300050510 Bacteria 13234
272 nmdc:mga08y16_137449_c1 3300050511 Bacteria 2540
273 nmdc:mga08y16_530976_c1 3300050511 Bacteria 1192
274 nmdc:mga0n895_11384_c1 3300050512 Bacteria 7934
275 nmdc:mga0n895_367961_c1 3300050512 Bacteria 1455
276 nmdc:mga0n895_5853_c1 3300050512 Bacteria 10335
277 nmdc:mga0n895_85806_c1 3300050512 Bacteria 3144
278 nmdc:mga0rr50_193127_c1 3300050513 Bacteria 1670
279 nmdc:mga0rr50_237017_c1 3300050513 Bacteria 1511
280 nmdc:mga0rr50_24977_c1 3300050513 Bacteria 4149
281 nmdc:mga08x19_148002_c1 3300050514 Bacteria 1589
282 nmdc:mga0a205_371672_c1 3300050515 Bacteria 1296
283 nmdc:mga0a205_50309_c1 3300050515 Bacteria 4023
284 Ga0500622_0000064 3300053156 Bacteria 127531
285 Ga0105245_10000953
286 Ga0065704_10000466
287 Ga0065707_10000841
288 Ga0070658_10117940
289 Ga0070676_10148286
290 Ga0070690_100026951
291 Ga0068869_100005225
292 Ga0068869_100013368
293 Ga0068869_100180737
294 Ga0070666_10065797
295 Ga0070680_100395369
296 Ga0070682_100142523
297 Ga0068868_100330507
298 Ga0070660_100138028
299 Ga0070689_100045527
300 Ga0070691_10176318
301 Ga0070687_100093232
302 Ga0070668_100094640
303 Ga0070668_100147956
304 Ga0070671_100013613
305 Ga0070673_100104862
306 Ga0070673_100260124
307 Ga0070713_100200905
308 Ga0070710_10018017
309 Ga0070711_100058684
310 Ga0070705_100001386
311 Ga0070705_100036829
312 Ga0070694_100033775
313 Ga0070708_100012193
314 Ga0070708_100075139
315 Ga0070662_100001717
316 Ga0070681_10046023
317 Ga0070681_10049271
318 Ga0070681_10260711
319 Ga0070681_10322612
320 Ga0068867_100005908
321 Ga0068867_100416753
322 Ga0070706_100001518
323 Ga0070707_100003540
324 Ga0070707_100022606
325 Ga0070707_100048795
326 Ga0070707_100331643
327 Ga0070698_100001854
328 Ga0070698_100018761
329 Ga0070698_100581028
330 Ga0070699_100046181
331 Ga0070699_100077854
332 Ga0070679_100069556
333 Ga0070679_100149205
334 Ga0070679_100286109
335 Ga0070684_100086310
336 Ga0070697_100000008
337 Ga0070697_100130803
338 Ga0068853_100090733
339 Ga0070672_100183826
340 Ga0070695_100004362
341 Ga0070695_100057579
342 Ga0070695_100183387
343 Ga0070696_100002314
344 Ga0070696_100375210
345 Ga0070696_100594220
346 Ga0070704_100017889
347 Ga0068857_100781597
348 Ga0068854_100002045
349 Ga0068852_100098121
350 Ga0068864_100183333
351 Ga0068864_100439493
352 Ga0068866_10001007
353 Ga0068863_100006499
354 Ga0068863_100079015
355 Ga0068858_100077781
356 Ga0068860_100003787
357 Ga0068860_100566305
358 Ga0068862_100129253
359 Ga0070717_10192956
360 Ga0070717_10241978
361 Ga0070717_10561007
362 Ga0070715_10048677
363 Ga0070716_100054336
364 Ga0070712_100169357
365 Ga0070712_100236114
366 Ga0075369_10138716
367 Ga0097621_100011366
368 Ga0097621_100109283
369 Ga0068871_100069144
370 Ga0075428_100099031
371 Ga0075428_100207499
372 Ga0075430_100015525
373 Ga0075431_100092291
374 Ga0075431_100577321
375 Ga0075434_100007946
376 Ga0075434_100101257
377 Ga0075434_100169239
378 Ga0075434_100191992
379 Ga0075434_100413501
380 Ga0075429_100007297
381 Ga0075429_100053967
382 Ga0068865_100000520
383 Ga0075436_100174794
384 Ga0097620_100003607
385 Ga0097620_100099574
386 Ga0075435_100024638
387 Ga0075435_100174334
388 Ga0075435_100269301
389 Ga0099795_10023156
390 Ga0111539_10020795
391 Ga0111539_10188536
392 Ga0111539_10544388
393 Ga0105247_10067866
394 Ga0114129_10027282
395 Ga0114129_10041959
396 Ga0105243_10000039
397 Ga0105243_10007619
398 Ga0105243_10088488
399 Ga0105243_10227908
400 Ga0105241_10031676
401 Ga0105241_10097276
402 Ga0105242_10000013
403 Ga0105242_10000515
404 Ga0105242_10004865
405 Ga0105242_10167621
406 Ga0105248_10002791
407 Ga0105248_10019622
408 Ga0105248_10020505
409 Ga0105248_10534932
410 Ga0105237_10382735
411 Ga0105237_10524518
412 Ga0105238_10386646
413 Ga0105238_10618557
414 Ga0105249_10032025
415 Ga0105249_10156551
416 Ga0105249_10207091
417 Ga0105249_10315994
418 Ga0105239_10041730
419 Ga0105239_10061430
420 Ga0105239_10320066
421 Ga0105246_10036845
422 Ga0105246_10203650
423 Ga0157371_10035042
424 Ga0157369_10174866
425 Ga0157369_10310532
426 Ga0157374_10109436
427 Ga0157374_10369424
428 Ga0157378_10040018
429 Ga0157378_10217153
430 Ga0157378_10412579
431 Ga0163162_10036562
432 Ga0163162_10257448
433 Ga0163162_10285727
434 Ga0163162_10381517
435 Ga0157372_10053579
436 Ga0157372_10094790
437 Ga0157372_10247025
438 Ga0157372_10435091
439 Ga0157375_10195587
440 Ga0157375_10279269
441 Ga0157375_10318017
442 Ga0157375_10416733
443 Ga0163163_10019255
444 Ga0157380_10625944
445 Ga0207653_10000204
446 Ga0207642_10000952
447 Ga0207642_10057083
448 Ga0207645_10004293
449 Ga0207643_10045335
450 Ga0207684_10071319
451 Ga0207707_10088508
452 Ga0207695_10160151
453 Ga0207663_10318541
454 Ga0207660_10042220
455 Ga0207660_10317769
456 Ga0207652_10041185
457 Ga0207652_10466244
458 Ga0207646_10002883
459 Ga0207646_10011653
460 Ga0207646_10293590
461 Ga0207646_10312793
462 Ga0207681_10024333
463 Ga0207687_10001117
464 Ga0207687_10219513
465 Ga0207644_10233656
466 Ga0207706_10000536
467 Ga0207686_10000006
468 Ga0207686_10000030
469 Ga0207686_10000622
470 Ga0207686_10210946
471 Ga0207686_10406334
472 Ga0207709_10000037
473 Ga0207709_10005334
474 Ga0207669_10003268
475 Ga0207704_10002547
476 Ga0207691_10160538
477 Ga0207691_10263234
478 Ga0207711_10003543
479 Ga0207711_10009883
480 Ga0207689_10007230
481 Ga0207689_10013626
482 Ga0207667_10026470
483 Ga0207651_10039530
484 Ga0207640_10008817
485 Ga0207708_10076164
486 Ga0207641_10077180
487 Ga0207648_10000389
488 Ga0207676_10040130
489 Ga0207683_10005212
490 Ga0207428_10446393
491 Ga0268264_10024589
492 Ga0265320_10087014
493 Ga0307513_10051086
494 Ga0307509_10149693
495 Ga0307509_10182672
496 Ga0307408_100082581
497 Ga0307405_10049779
498 Ga0307405_10092424
499 Ga0307405_10324788
500 Ga0307413_10157552
501 Ga0307410_10005845
502 Ga0307410_10073774
503 Ga0307410_10079060
504 Ga0307410_10168399
505 Ga0307410_10205298
506 Ga0307406_10014280
507 Ga0307406_10062464
508 Ga0307406_10106148
509 Ga0307407_10022437
510 Ga0307407_10220929
511 Ga0307412_10062780
512 Ga0307409_100007517
513 Ga0307409_100017360
514 Ga0307409_100051484
515 Ga0307409_100234075
516 Ga0307409_100260989
517 Ga0307409_100348527
518 Ga0307409_100431943
519 Ga0307416_100001891
520 Ga0307416_100090653
521 Ga0307416_100248250
522 Ga0307414_10073718
523 Ga0307414_10165103
524 Ga0307411_10059158
525 Ga0307411_10234911
526 Ga0307415_100004894
527 Ga0307415_100009384
528 Ga0307415_100092762
529 Ga0307415_100308282
530 Ga0373932_0018351
531 Ga0373941_0069363
532 Ga0373931_0234698
533 Ga0395899_0235992
534 Ga0395901_0263650
535 Ga0451576_0229676
536 Ga0451576_0290805
537 Ga0495582_0118064
538 Ga0495628_0190908
539 Ga0495659_0142531
540 Ga0495670_0170773
541 Ga0495674_0205938
542 Ga0496104_0005823
543 Ga0496104_0225951
544 Ga0496106_0215984
545 Ga0496110_0452036
546 Ga0496112_0297389
547 Ga0496114_0001922
548 Ga0496114_0198819
549 Ga0496115_0094031
550 nmdc:mga05p37_115432_c1
551 nmdc:mga05p37_19068_c1
552 nmdc:mga09592_173549_c1
553 nmdc:mga0qj67_72561_c1
554 nmdc:mga06r32_100234_c1
555 nmdc:mga06r32_3983_c1
556 nmdc:mga08y16_137449_c1
557 nmdc:mga08y16_530976_c1
558 nmdc:mga0n895_11384_c1
559 nmdc:mga0n895_367961_c1
560 nmdc:mga0n895_5853_c1
561 nmdc:mga0n895_85806_c1
562 nmdc:mga0rr50_193127_c1
563 nmdc:mga0rr50_237017_c1
564 nmdc:mga0rr50_24977_c1
565 nmdc:mga08x19_148002_c1
566 nmdc:mga0a205_371672_c1
567 nmdc:mga0a205_50309_c1
568 Ga0500622_0000064

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

1

189

0.96

PF08659

KR

KR domain

1

165

0.87

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

6

235

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9424 5 236
7ulh-assembly1.cif.gz_E crystal structure of a short chain dehydrogenase from mycobacterium avium 104 0.9393 5 179
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9324 4 245
7ulh-assembly1.cif.gz_F crystal structure of a short chain dehydrogenase from mycobacterium avium 104 0.9265 5 180
6zz0-assembly1.cif.gz_A structure of the borneol dehydrogenase of salvia rosmarinus (apo) 0.9252 1 180
ID Description Score Start End Superfamily
af_Q54HW7_18_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9515 1 280 3.40.50.720
af_Q2QLP7_18_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9512 6 179 3.40.50.720
af_Q54WM6_4_292_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9486 1 279 3.40.50.720
af_Q54HW7_18_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9482 1 280 3.40.50.720
af_C7FZY1_11_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9462 1 277 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7W8W6H2-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG 0.9836 2 171 GO:0016491
AF-V7D3L8-F1-model_v4 Short-chain dehydrogenase 0.9753 5 229 GO:0016491
AF-A0A364WC55-F1-model_v4 deleted 0.9675 3 268
AF-A0A3D9NWM5-F1-model_v4 deleted 0.965 5 278
AF-A0A4Q5SBG4-F1-model_v4 SDR family oxidoreductase 0.965 1 208 GO:0016491

Map