F386076

General Info

Members Datasets Scaffolds Average Seq Length
284 207 568 183

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100635712|Ga0068855_1006357122
Length 186
Sequence MASEVATLAGGCFWCTEAVFKDVIGVESVESGYIGGNVPNPTYKQVCGGDTGHAEAIRVTFDPDQVRYGDLLDMFFATHDPTQLNRQGNDMGTQYRSAIFPHSPDQREEAQAAIARAAADWPAPIVTSIEPPSDQPAPEWYPAEDYHQRYWEGEGQRNPYCLAVIPPKLAKLRKRFAARSKAVEAA

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
106 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
109 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
167 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
168 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
184 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
187 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.35
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.1
Nodule 0
Rhizoplane 1.76
Rhizosphere 88.03
Stem 0
Stem Tuber 0.35
Unclassified 3.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100635712 3300005563 Bacteria 1148
2 LJQas_1003186 3300000549 Bacteria 2216
3 rootL2_10027514 3300003322 Bacteria 6077
4 Ga0065704_10076463 3300005289 Bacteria 5109
5 Ga0065712_10167034 3300005290 Bacteria 1267
6 Ga0065712_10377497 3300005290 Unclassified 756
7 Ga0065707_10294325 3300005295 Bacteria 1018
8 Ga0068869_100076367 3300005334 Bacteria 2490
9 Ga0068869_100398367 3300005334 Bacteria 1132
10 Ga0070666_10549529 3300005335 Bacteria 840
11 Ga0068868_100403560 3300005338 Bacteria 1180
12 Ga0070660_100614003 3300005339 Bacteria 910
13 Ga0070689_100455552 3300005340 Bacteria 1089
14 Ga0070689_101008183 3300005340 Bacteria 741
15 Ga0070687_100300450 3300005343 Bacteria 1018
16 Ga0070668_100027998 3300005347 Bacteria 4277
17 Ga0070674_100514528 3300005356 Bacteria 999
18 Ga0070667_100239221 3300005367 Bacteria 1620
19 Ga0070700_100109751 3300005441 Bacteria 1832
20 Ga0070700_100295900 3300005441 Bacteria 1179
21 Ga0070694_100352914 3300005444 Bacteria 1140
22 Ga0070662_100000593 3300005457 Bacteria 22037
23 Ga0068867_100065982 3300005459 Bacteria 2695
24 Ga0068867_100067948 3300005459 Bacteria 2659
25 Ga0070707_100153200 3300005468 Unclassified 2245
26 Ga0070679_100137213 3300005530 Bacteria 2427
27 Ga0070695_100422418 3300005545 Bacteria 1015
28 Ga0070695_100517585 3300005545 Bacteria 925
29 Ga0070696_100239862 3300005546 Bacteria 1367
30 Ga0070696_100265669 3300005546 Bacteria 1303
31 Ga0070696_100590111 3300005546 Bacteria 895
32 Ga0068854_100188598 3300005578 Bacteria 1614
33 Ga0070702_100541708 3300005615 Bacteria 862
34 Ga0068859_100002973 3300005617 Bacteria 17182
35 Ga0068859_100078955 3300005617 Unclassified 3331
36 Ga0068859_100110563 3300005617 Bacteria 2810
37 Ga0068859_100163269 3300005617 Bacteria 2307
38 Ga0068864_100116791 3300005618 Bacteria 2381
39 Ga0068861_100190281 3300005719 Bacteria 1715
40 Ga0068861_100671456 3300005719 Bacteria 960
41 Ga0068851_10503152 3300005834 Bacteria 727
42 Ga0068870_10189491 3300005840 Bacteria 1240
43 Ga0068863_100056864 3300005841 Bacteria 3703
44 Ga0068858_100000170 3300005842 Bacteria 69171
45 Ga0068858_100009168 3300005842 Bacteria 9459
46 Ga0068858_100066148 3300005842 Bacteria 3346
47 Ga0068860_100054626 3300005843 Unclassified 3796
48 Ga0068862_100023251 3300005844 Bacteria 5192
49 Ga0068862_100039932 3300005844 Unclassified 3987
50 Ga0075363_100000507 3300006048 Bacteria 12472
51 Ga0075364_10076366 3300006051 Bacteria 2211
52 Ga0075364_10188877 3300006051 Bacteria 1395
53 Ga0075362_10000006 3300006177 Bacteria 123313
54 Ga0075362_10329007 3300006177 Bacteria 762
55 Ga0075362_10356270 3300006177 Bacteria 733
56 Ga0075367_10128863 3300006178 Bacteria 1563
57 Ga0075369_10004106 3300006186 Bacteria 5359
58 Ga0075366_10000166 3300006195 Bacteria 28151
59 Ga0075366_10117397 3300006195 Bacteria 1602
60 Ga0097621_100355059 3300006237 Bacteria 1304
61 Ga0097621_100824466 3300006237 Bacteria 861
62 Ga0075370_10000012 3300006353 Bacteria 64975
63 Ga0075370_10202500 3300006353 Bacteria 1171
64 Ga0068871_100128178 3300006358 Bacteria 2149
65 Ga0075430_100243162 3300006846 Bacteria 1491
66 Ga0075431_100041274 3300006847 Bacteria 4756
67 Ga0075434_100048397 3300006871 Bacteria 4218
68 Ga0075434_100072145 3300006871 Bacteria 3445
69 Ga0075429_100015737 3300006880 Bacteria 6553
70 Ga0075429_100053775 3300006880 Bacteria 3503
71 Ga0075436_100031272 3300006914 Bacteria 3664
72 Ga0075436_100054916 3300006914 Bacteria 2750
73 Ga0075436_100086062 3300006914 Bacteria 2183
74 Ga0097620_100002973 3300006931 Bacteria 17182
75 Ga0097620_100078955 3300006931 Unclassified 3331
76 Ga0097620_100110565 3300006931 Bacteria 2810
77 Ga0097620_100163277 3300006931 Bacteria 2307
78 Ga0075435_100030065 3300007076 Bacteria 4268
79 Ga0099794_10002595 3300007265 Bacteria 6708
80 Ga0099795_10006513 3300007788 Bacteria 3191
81 Ga0111539_10377306 3300009094 Bacteria 1651
82 Ga0105245_10003055 3300009098 Bacteria 14978
83 Ga0105245_10024385 3300009098 Bacteria 5311
84 Ga0105245_10309004 3300009098 Bacteria 1554
85 Ga0105243_10015695 3300009148 Bacteria 5727
86 Ga0105243_10018590 3300009148 Bacteria 5267
87 Ga0105242_10398510 3300009176 Bacteria 1284
88 Ga0105248_10015822 3300009177 Bacteria 8313
89 Ga0105248_10489907 3300009177 Bacteria 1386
90 Ga0105238_10730631 3300009551 Bacteria 1003
91 Ga0105249_10188002 3300009553 Bacteria 2014
92 Ga0099796_10015381 3300010159 Bacteria 2235
93 Ga0105246_10213703 3300011119 Bacteria 1507
94 Ga0157374_11255720 3300013296 Bacteria 762
95 Ga0157378_10107980 3300013297 Bacteria 2548
96 Ga0157378_10110001 3300013297 Bacteria 2525
97 Ga0157378_10196189 3300013297 Bacteria 1907
98 Ga0157375_10109585 3300013308 Bacteria 2857
99 Ga0163163_10373512 3300014325 Bacteria 1483
100 Ga0157380_11367465 3300014326 Bacteria 757
101 Ga0157379_10150976 3300014968 Bacteria 2095
102 Ga0157376_10091174 3300014969 Bacteria 2639
103 Ga0213872_10000641 3300021361 Bacteria 26449
104 Ga0213872_10018080 3300021361 Bacteria 3252
105 Ga0213872_10019924 3300021361 Bacteria 3089
106 Ga0207682_10000738 3300025893 Bacteria 15154
107 Ga0207680_10751876 3300025903 Bacteria 699
108 Ga0207643_10156267 3300025908 Bacteria 1370
109 Ga0207705_10497778 3300025909 Bacteria 946
110 Ga0207654_10632889 3300025911 Bacteria 765
111 Ga0207646_10081454 3300025922 Unclassified 2894
112 Ga0207646_10348624 3300025922 Bacteria 1338
113 Ga0207687_10224145 3300025927 Bacteria 1482
114 Ga0207706_10000537 3300025933 Bacteria 40249
115 Ga0207709_10014767 3300025935 Bacteria 4318
116 Ga0207709_11199130 3300025935 Bacteria 625
117 Ga0207670_10488806 3300025936 Bacteria 998
118 Ga0207670_11306238 3300025936 Bacteria 615
119 Ga0207669_10889918 3300025937 Bacteria 743
120 Ga0207665_10025456 3300025939 Bacteria 3905
121 Ga0207691_10968205 3300025940 Bacteria 711
122 Ga0207711_10060207 3300025941 Bacteria 3271
123 Ga0207689_10002924 3300025942 Bacteria 15766
124 Ga0207689_10004184 3300025942 Bacteria 13119
125 Ga0207667_10823252 3300025949 Bacteria 924
126 Ga0207667_11696468 3300025949 Bacteria 598
127 Ga0207651_10220493 3300025960 Bacteria 1533
128 Ga0207712_10014987 3300025961 Bacteria 4995
129 Ga0207668_10315172 3300025972 Bacteria 1296
130 Ga0207668_10544300 3300025972 Bacteria 1005
131 Ga0207640_10457623 3300025981 Bacteria 1053
132 Ga0207658_10371249 3300025986 Bacteria 1251
133 Ga0207703_10050461 3300026035 Bacteria 3368
134 Ga0207703_10072939 3300026035 Bacteria 2838
135 Ga0207703_10079149 3300026035 Bacteria 2733
136 Ga0207678_10248675 3300026067 Unclassified 1523
137 Ga0207708_10005891 3300026075 Bacteria 9065
138 Ga0207708_10146662 3300026075 Bacteria 1855
139 Ga0207648_10040274 3300026089 Bacteria 4107
140 Ga0207676_10670851 3300026095 Bacteria 1002
141 Ga0207675_100069419 3300026118 Bacteria 3294
142 Ga0207683_10173893 3300026121 Bacteria 1951
143 Ga0209588_1002062 3300027671 Bacteria 5427
144 Ga0209588_1048858 3300027671 Bacteria 1369
145 Ga0207428_10024198 3300027907 Bacteria 5101
146 Ga0268265_10084016 3300028380 Bacteria 2523
147 Ga0268265_10331172 3300028380 Bacteria 1383
148 Ga0268264_10001959 3300028381 Bacteria 18505
149 Ga0268264_10426432 3300028381 Bacteria 1280
150 Ga0268264_11149096 3300028381 Bacteria 785
151 Ga0307508_10000286 3300031616 Bacteria 62006
152 Ga0307405_10827449 3300031731 Bacteria 778
153 Ga0307415_100198818 3300032126 Bacteria 1589
154 Ga0307415_100811524 3300032126 Bacteria 855
155 Ga0373940_0210241 3300035088 Unclassified 643
156 Ga0373951_0138125 3300035091 Bacteria 675
157 Ga0373923_0000974 3300035111 Bacteria 7701
158 Ga0373932_0254361 3300035112 Bacteria 642
159 Ga0373936_0001443 3300035113 Bacteria 8631
160 Ga0373953_0000979 3300035117 Bacteria 8020
161 Ga0373956_0035784 3300035119 Bacteria 2190
162 Ga0373957_0014190 3300035120 Bacteria 2719
163 Ga0373946_0132713 3300035171 Bacteria 1147
164 Ga0373955_0001080 3300035172 Bacteria 11591
165 Ga0373924_0042023 3300035410 Bacteria 1874
166 Ga0373931_0184846 3300035691 Bacteria 1236
167 Ga0373935_0008847 3300035692 Bacteria 6025
168 Ga0373933_0057338 3300035724 Bacteria 2340
169 Ga0373937_0493227 3300036401 Bacteria 1163
170 Ga0316582_0233543 3300036647 Bacteria 1259
171 Ga0373925_0047292 3300037068 Bacteria 3202
172 Ga0436364_1056523 3300037853 Bacteria 594
173 Ga0436361_0143219 3300039447 Bacteria 2749
174 Ga0436361_0410735 3300039447 Bacteria 3260
175 Ga0436361_0470283 3300039447 Bacteria 12222
176 Ga0436361_0532694 3300039447 Bacteria 2424
177 Ga0436361_0661671 3300039447 Bacteria 3375
178 Ga0451577_0025970 3300042876 Bacteria 5308
179 Ga0451577_0104169 3300042876 Bacteria 2536
180 Ga0451577_0159086 3300042876 Bacteria 2034
181 Ga0451577_0374280 3300042876 Bacteria 1292
182 Ga0451577_0649922 3300042876 Bacteria 956
183 Ga0451577_0783678 3300042876 Bacteria 861
184 Ga0466977_0000910 3300044666 Bacteria 11170
185 Ga0466966_0169759 3300044684 Bacteria 1326
186 Ga0453684_0000074 3300044712 Bacteria 438364
187 Ga0453684_0003136 3300044712 Bacteria 38060
188 Ga0453684_0050748 3300044712 Bacteria 5452
189 Ga0453684_0190229 3300044712 Bacteria 2401
190 Ga0466957_0014097 3300044842 Bacteria 4650
191 Ga0466959_0184934 3300045049 Bacteria 1456
192 Ga0451576_0014511 3300045051 Bacteria 8764
193 Ga0451576_0018194 3300045051 Bacteria 7707
194 Ga0451576_0659960 3300045051 Bacteria 1099
195 Ga0451576_1251354 3300045051 Bacteria 774
196 Ga0466958_0168339 3300045836 Bacteria 1387
197 Ga0495592_0001874 3300046454 Bacteria 14796
198 Ga0495641_0008609 3300046461 Bacteria 6184
199 Ga0495580_0021469 3300046472 Bacteria 4763
200 Ga0495639_0008263 3300046475 Bacteria 4468
201 Ga0495662_0026967 3300046476 Bacteria 2775
202 Ga0495585_0050981 3300046492 Bacteria 2295
203 Ga0495608_0018959 3300046511 Bacteria 4741
204 Ga0495618_0081640 3300046514 Bacteria 2064
205 Ga0495628_0022275 3300046516 Bacteria 5205
206 Ga0495628_0078675 3300046516 Bacteria 2564
207 Ga0495630_0001826 3300046517 Bacteria 14854
208 Ga0495587_0030297 3300046536 Bacteria 3281
209 Ga0495667_0015556 3300046559 Bacteria 5143
210 Ga0495634_0372867 3300046642 Bacteria 851
211 Ga0495635_0156602 3300046663 Bacteria 1550
212 Ga0495657_0066076 3300046675 Bacteria 2376
213 Ga0495599_0028040 3300046678 Bacteria 3528
214 Ga0495647_0001692 3300046681 Bacteria 6831
215 Ga0495658_0004078 3300046683 Bacteria 7195
216 Ga0495669_0005498 3300046684 Bacteria 5289
217 Ga0495613_0033405 3300046689 Bacteria 3823
218 Ga0495624_0058214 3300046690 Bacteria 2428
219 Ga0495600_0004697 3300046809 Bacteria 8193
220 Ga0495581_0064530 3300047315 Bacteria 2116
221 Ga0495604_0040778 3300047317 Bacteria 3643
222 Ga0495674_0089429 3300047319 Bacteria 2632
223 Ga0495680_0021037 3300047322 Bacteria 5467
224 Ga0495675_0000830 3300047444 Bacteria 18920
225 Ga0495684_0012592 3300047471 Bacteria 6522
226 Ga0495684_0098073 3300047471 Bacteria 2216
227 Ga0496102_0199492 3300048905 Bacteria 1886
228 Ga0496105_1052002 3300048908 Bacteria 606
229 Ga0496108_0092485 3300048911 Bacteria 2572
230 Ga0496109_0197097 3300048912 Bacteria 1893
231 Ga0496110_0033796 3300048913 Bacteria 4426
232 Ga0496126_0005548 3300048929 Bacteria 14349
233 Ga0501290_000050 3300049513 Bacteria 15937
234 Ga0501300_004214 3300049523 Bacteria 2133
235 Ga0501315_000530 3300049531 Bacteria 2707
236 Ga0501031_0182927 3300049568 Bacteria 1369
237 Ga0501036_0336733 3300049572 Bacteria 1260
238 Ga0501040_0178700 3300049576 Bacteria 1504
239 Ga0501041_0040927 3300049577 Bacteria 2814
240 Ga0501042_0132141 3300049578 Bacteria 1799
241 Ga0501048_0072356 3300049582 Bacteria 2434
242 Ga0501071_0739894 3300049587 Unclassified 757
243 Ga0501074_0408534 3300049590 Bacteria 963
244 Ga0501075_0095099 3300049591 Bacteria 2261
245 Ga0501076_0025049 3300049592 Bacteria 4615
246 Ga0501076_0178853 3300049592 Bacteria 1729
247 Ga0501076_0711098 3300049592 Bacteria 829
248 Ga0501079_0148565 3300049741 Bacteria 1827
249 Ga0501079_0177778 3300049741 Bacteria 1660
250 Ga0501080_1041524 3300049742 Bacteria 708
251 Ga0501081_0050023 3300049743 Bacteria 2879
252 Ga0501081_0371035 3300049743 Bacteria 1057
253 Ga0501083_0017222 3300049744 Bacteria 5038
254 Ga0501268_075991 3300049765 Bacteria 687
255 Ga0501280_001033 3300049776 Bacteria 5719
256 Ga0501045_0121159 3300049824 Bacteria 1942
257 nmdc:mga03683_3_c1 3300050489 Bacteria 285872
258 nmdc:mga03n38_268_c1 3300050490 Bacteria 12320
259 nmdc:mga00v17_189116_c1 3300050491 Bacteria 1329
260 nmdc:mga00v17_66881_c1 3300050491 Bacteria 2219
261 nmdc:mga0k408_125528_c1 3300050493 Bacteria 1055
262 nmdc:mga0k408_20_c1 3300050493 Bacteria 109563
263 nmdc:mga0k408_486646_c1 3300050493 Bacteria 732
264 nmdc:mga06z11_98890_c1 3300050494 Bacteria 1597
265 nmdc:mga07m45_1_c1 3300050496 Bacteria 485809
266 nmdc:mga05p37_72043_c1 3300050507 Bacteria 4251
267 nmdc:mga09592_34360_c1 3300050508 Bacteria 4238
268 nmdc:mga0qj67_227657_c1 3300050509 Bacteria 1513
269 nmdc:mga06r32_182898_c1 3300050510 Bacteria 2082
270 nmdc:mga06r32_8424_c1 3300050510 Bacteria 9291
271 nmdc:mga08y16_428840_c1 3300050511 Bacteria 1351
272 nmdc:mga0n895_105208_c1 3300050512 Bacteria 2834
273 nmdc:mga0rr50_42636_c1 3300050513 Bacteria 3315
274 nmdc:mga08x19_179932_c1 3300050514 Bacteria 1443
275 nmdc:mga08x19_31669_c1 3300050514 Bacteria 3329
276 nmdc:mga08x19_36984_c1 3300050514 Bacteria 3095
277 nmdc:mga0sz30_1093_c1 3300050516 Bacteria 9751
278 Ga0495601_0004508 3300053077 Bacteria 8052
279 Ga0495612_0265278 3300053078 Bacteria 766
280 Ga0495595_0003382 3300053084 Bacteria 6336
281 Ga0500645_001967 3300053730 Bacteria 9706
282 Ga0501082_0298656 3300060353 Bacteria 1402
283 Ga0466962_0133964 3300061719 Bacteria 1198
284 2885428529 2885427238 Bacteria 2291351
285 Ga0068855_100635712
286 LJQas_1003186
287 rootL2_10027514
288 Ga0065704_10076463
289 Ga0065712_10167034
290 Ga0065712_10377497
291 Ga0065707_10294325
292 Ga0068869_100076367
293 Ga0068869_100398367
294 Ga0070666_10549529
295 Ga0068868_100403560
296 Ga0070660_100614003
297 Ga0070689_100455552
298 Ga0070689_101008183
299 Ga0070687_100300450
300 Ga0070668_100027998
301 Ga0070674_100514528
302 Ga0070667_100239221
303 Ga0070700_100109751
304 Ga0070700_100295900
305 Ga0070694_100352914
306 Ga0070662_100000593
307 Ga0068867_100065982
308 Ga0068867_100067948
309 Ga0070707_100153200
310 Ga0070679_100137213
311 Ga0070695_100422418
312 Ga0070695_100517585
313 Ga0070696_100239862
314 Ga0070696_100265669
315 Ga0070696_100590111
316 Ga0068854_100188598
317 Ga0070702_100541708
318 Ga0068859_100002973
319 Ga0068859_100078955
320 Ga0068859_100110563
321 Ga0068859_100163269
322 Ga0068864_100116791
323 Ga0068861_100190281
324 Ga0068861_100671456
325 Ga0068851_10503152
326 Ga0068870_10189491
327 Ga0068863_100056864
328 Ga0068858_100000170
329 Ga0068858_100009168
330 Ga0068858_100066148
331 Ga0068860_100054626
332 Ga0068862_100023251
333 Ga0068862_100039932
334 Ga0075363_100000507
335 Ga0075364_10076366
336 Ga0075364_10188877
337 Ga0075362_10000006
338 Ga0075362_10329007
339 Ga0075362_10356270
340 Ga0075367_10128863
341 Ga0075369_10004106
342 Ga0075366_10000166
343 Ga0075366_10117397
344 Ga0097621_100355059
345 Ga0097621_100824466
346 Ga0075370_10000012
347 Ga0075370_10202500
348 Ga0068871_100128178
349 Ga0075430_100243162
350 Ga0075431_100041274
351 Ga0075434_100048397
352 Ga0075434_100072145
353 Ga0075429_100015737
354 Ga0075429_100053775
355 Ga0075436_100031272
356 Ga0075436_100054916
357 Ga0075436_100086062
358 Ga0097620_100002973
359 Ga0097620_100078955
360 Ga0097620_100110565
361 Ga0097620_100163277
362 Ga0075435_100030065
363 Ga0099794_10002595
364 Ga0099795_10006513
365 Ga0111539_10377306
366 Ga0105245_10003055
367 Ga0105245_10024385
368 Ga0105245_10309004
369 Ga0105243_10015695
370 Ga0105243_10018590
371 Ga0105242_10398510
372 Ga0105248_10015822
373 Ga0105248_10489907
374 Ga0105238_10730631
375 Ga0105249_10188002
376 Ga0099796_10015381
377 Ga0105246_10213703
378 Ga0157374_11255720
379 Ga0157378_10107980
380 Ga0157378_10110001
381 Ga0157378_10196189
382 Ga0157375_10109585
383 Ga0163163_10373512
384 Ga0157380_11367465
385 Ga0157379_10150976
386 Ga0157376_10091174
387 Ga0213872_10000641
388 Ga0213872_10018080
389 Ga0213872_10019924
390 Ga0207682_10000738
391 Ga0207680_10751876
392 Ga0207643_10156267
393 Ga0207705_10497778
394 Ga0207654_10632889
395 Ga0207646_10081454
396 Ga0207646_10348624
397 Ga0207687_10224145
398 Ga0207706_10000537
399 Ga0207709_10014767
400 Ga0207709_11199130
401 Ga0207670_10488806
402 Ga0207670_11306238
403 Ga0207669_10889918
404 Ga0207665_10025456
405 Ga0207691_10968205
406 Ga0207711_10060207
407 Ga0207689_10002924
408 Ga0207689_10004184
409 Ga0207667_10823252
410 Ga0207667_11696468
411 Ga0207651_10220493
412 Ga0207712_10014987
413 Ga0207668_10315172
414 Ga0207668_10544300
415 Ga0207640_10457623
416 Ga0207658_10371249
417 Ga0207703_10050461
418 Ga0207703_10072939
419 Ga0207703_10079149
420 Ga0207678_10248675
421 Ga0207708_10005891
422 Ga0207708_10146662
423 Ga0207648_10040274
424 Ga0207676_10670851
425 Ga0207675_100069419
426 Ga0207683_10173893
427 Ga0209588_1002062
428 Ga0209588_1048858
429 Ga0207428_10024198
430 Ga0268265_10084016
431 Ga0268265_10331172
432 Ga0268264_10001959
433 Ga0268264_10426432
434 Ga0268264_11149096
435 Ga0307508_10000286
436 Ga0307405_10827449
437 Ga0307415_100198818
438 Ga0307415_100811524
439 Ga0373940_0210241
440 Ga0373951_0138125
441 Ga0373923_0000974
442 Ga0373932_0254361
443 Ga0373936_0001443
444 Ga0373953_0000979
445 Ga0373956_0035784
446 Ga0373957_0014190
447 Ga0373946_0132713
448 Ga0373955_0001080
449 Ga0373924_0042023
450 Ga0373931_0184846
451 Ga0373935_0008847
452 Ga0373933_0057338
453 Ga0373937_0493227
454 Ga0316582_0233543
455 Ga0373925_0047292
456 Ga0436364_1056523
457 Ga0436361_0143219
458 Ga0436361_0410735
459 Ga0436361_0470283
460 Ga0436361_0532694
461 Ga0436361_0661671
462 Ga0451577_0025970
463 Ga0451577_0104169
464 Ga0451577_0159086
465 Ga0451577_0374280
466 Ga0451577_0649922
467 Ga0451577_0783678
468 Ga0466977_0000910
469 Ga0466966_0169759
470 Ga0453684_0000074
471 Ga0453684_0003136
472 Ga0453684_0050748
473 Ga0453684_0190229
474 Ga0466957_0014097
475 Ga0466959_0184934
476 Ga0451576_0014511
477 Ga0451576_0018194
478 Ga0451576_0659960
479 Ga0451576_1251354
480 Ga0466958_0168339
481 Ga0495592_0001874
482 Ga0495641_0008609
483 Ga0495580_0021469
484 Ga0495639_0008263
485 Ga0495662_0026967
486 Ga0495585_0050981
487 Ga0495608_0018959
488 Ga0495618_0081640
489 Ga0495628_0022275
490 Ga0495628_0078675
491 Ga0495630_0001826
492 Ga0495587_0030297
493 Ga0495667_0015556
494 Ga0495634_0372867
495 Ga0495635_0156602
496 Ga0495657_0066076
497 Ga0495599_0028040
498 Ga0495647_0001692
499 Ga0495658_0004078
500 Ga0495669_0005498
501 Ga0495613_0033405
502 Ga0495624_0058214
503 Ga0495600_0004697
504 Ga0495581_0064530
505 Ga0495604_0040778
506 Ga0495674_0089429
507 Ga0495680_0021037
508 Ga0495675_0000830
509 Ga0495684_0012592
510 Ga0495684_0098073
511 Ga0496102_0199492
512 Ga0496105_1052002
513 Ga0496108_0092485
514 Ga0496109_0197097
515 Ga0496110_0033796
516 Ga0496126_0005548
517 Ga0501290_000050
518 Ga0501300_004214
519 Ga0501315_000530
520 Ga0501031_0182927
521 Ga0501036_0336733
522 Ga0501040_0178700
523 Ga0501041_0040927
524 Ga0501042_0132141
525 Ga0501048_0072356
526 Ga0501071_0739894
527 Ga0501074_0408534
528 Ga0501075_0095099
529 Ga0501076_0025049
530 Ga0501076_0178853
531 Ga0501076_0711098
532 Ga0501079_0148565
533 Ga0501079_0177778
534 Ga0501080_1041524
535 Ga0501081_0050023
536 Ga0501081_0371035
537 Ga0501083_0017222
538 Ga0501268_075991
539 Ga0501280_001033
540 Ga0501045_0121159
541 nmdc:mga03683_3_c1
542 nmdc:mga03n38_268_c1
543 nmdc:mga00v17_189116_c1
544 nmdc:mga00v17_66881_c1
545 nmdc:mga0k408_125528_c1
546 nmdc:mga0k408_20_c1
547 nmdc:mga0k408_486646_c1
548 nmdc:mga06z11_98890_c1
549 nmdc:mga07m45_1_c1
550 nmdc:mga05p37_72043_c1
551 nmdc:mga09592_34360_c1
552 nmdc:mga0qj67_227657_c1
553 nmdc:mga06r32_182898_c1
554 nmdc:mga06r32_8424_c1
555 nmdc:mga08y16_428840_c1
556 nmdc:mga0n895_105208_c1
557 nmdc:mga0rr50_42636_c1
558 nmdc:mga08x19_179932_c1
559 nmdc:mga08x19_31669_c1
560 nmdc:mga08x19_36984_c1
561 nmdc:mga0sz30_1093_c1
562 Ga0495601_0004508
563 Ga0495612_0265278
564 Ga0495595_0003382
565 Ga0500645_001967
566 Ga0501082_0298656
567 Ga0466962_0133964
568 2885428529

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

5

162

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j89-assembly1.cif.gz_A functional and structural aspects of poplar cytosolic and plastidial type a methionine sulfoxide reductases 0.9749 3 146
7e43-assembly2.cif.gz_A structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori 0.9616 2 146
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.9467 3 146
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9422 3 150
2l90-assembly1.cif.gz_A solution structure of murine myristoylated msra 0.9385 3 150
ID Description Score Start End Superfamily
af_B6TNT5_14_185_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.966 3 150 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.963 1 146 3.30.1060.10
af_Q5AD39_5_182_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9514 2 146 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9439 1 146 3.30.1060.10
af_P0A084_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9322 1 162 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A2A2K694-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9981 2 176 GO:0008113
AF-A0A383CBU7-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9967 4 101 GO:0008113
AF-A0A7C5I466-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9963 2 112 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A352DYT2-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9958 2 97 GO:0008113
AF-A0A359BCQ3-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9944 4 97 GO:0005737
GO:0008113
GO:0034599
GO:0036456

Map