F386028

General Info

Members Datasets Scaffolds Average Seq Length
284 176 283 190

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100097079|Ga0070673_1000970793
Length 221
Sequence VKQSSASLGVLRGEFFLLFSSKQLPNHPNGYPTMRKLTVFNQISLDGRFTDAKGDMSWAHRPNDDTEWNEFVAGNAGSGGTLVFGRVTYQMMASYWPTPAALQNTPDLARHMNELQKIVFSRTLKEASWQNTTLLKGDLASEVRALKNAPGSDMTILGSGSIVAQLAQAGLIDEFFVVVNPIAVGGGRTMFDGVNGPLTLRRTSVRSFANGNVVLAYAPTA

Samples

Sample ID Description Type Environment
1 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
129 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
147 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
171 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
172 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
173 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.52
Nodule 0
Rhizoplane 1.41
Rhizosphere 93.31
Stem 0
Stem Tuber 0
Unclassified 1.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilOldRDRAFT_c005830 3300000044 Bacteria 1036
2 rootH2_10194752 3300003320 Bacteria 2165
3 rootL2_10129666 3300003322 Bacteria 2595
4 rootL2_10337007 3300003322 Bacteria 3378
5 rootH1_10399629 3300003323 Bacteria 1287
6 Ga0055530_10065842 3300003791 Bacteria 794
7 Ga0070658_10003242 3300005327 Bacteria 13434
8 Ga0070658_10899026 3300005327 Unclassified 770
9 Ga0070683_100282893 3300005329 Unclassified 1578
10 Ga0070683_101007327 3300005329 Unclassified 800
11 Ga0068869_100906486 3300005334 Unclassified 763
12 Ga0070666_10055108 3300005335 Bacteria 2683
13 Ga0070666_10705275 3300005335 Bacteria 740
14 Ga0068868_100120963 3300005338 Bacteria 2135
15 Ga0070660_100027522 3300005339 Bacteria 4244
16 Ga0070692_10223485 3300005345 Bacteria 1114
17 Ga0070669_100088660 3300005353 Unclassified 2316
18 Ga0070669_100179539 3300005353 Bacteria 1655
19 Ga0070675_100004821 3300005354 Bacteria 10290
20 Ga0070671_100342825 3300005355 Bacteria 1275
21 Ga0070674_100249815 3300005356 Bacteria 1393
22 Ga0070673_100097079 3300005364 Unclassified 2419
23 Ga0070673_100184995 3300005364 Bacteria 1785
24 Ga0070667_100077635 3300005367 Bacteria 2836
25 Ga0070667_100856590 3300005367 Bacteria 845
26 Ga0070709_10127955 3300005434 Bacteria 1730
27 Ga0070714_100182693 3300005435 Bacteria 1909
28 Ga0070713_100944728 3300005436 Bacteria 830
29 Ga0070713_101586489 3300005436 Unclassified 635
30 Ga0070701_10047303 3300005438 Bacteria 2215
31 Ga0070705_100037604 3300005440 Bacteria 2732
32 Ga0070708_100072392 3300005445 Bacteria 3105
33 Ga0070708_100117158 3300005445 Bacteria 2453
34 Ga0070708_100222903 3300005445 Bacteria 1768
35 Ga0070708_101348873 3300005445 Bacteria 666
36 Ga0070662_100013130 3300005457 Bacteria 5506
37 Ga0068867_100145646 3300005459 Bacteria 1856
38 Ga0068867_100181235 3300005459 Unclassified 1675
39 Ga0070706_100027156 3300005467 Bacteria 5267
40 Ga0070706_100199875 3300005467 Bacteria 1867
41 Ga0070707_100009328 3300005468 Bacteria 9108
42 Ga0070698_100118140 3300005471 Bacteria 2613
43 Ga0070698_100127080 3300005471 Bacteria 2506
44 Ga0070698_100834889 3300005471 Unclassified 866
45 Ga0070699_100011764 3300005518 Bacteria 7552
46 Ga0070699_100017605 3300005518 Bacteria 6134
47 Ga0070699_100309052 3300005518 Bacteria 1419
48 Ga0070684_100199712 3300005535 Bacteria 1821
49 Ga0070697_100195528 3300005536 Bacteria 1717
50 Ga0070697_100388457 3300005536 Unclassified 1210
51 Ga0070697_100747800 3300005536 Unclassified 864
52 Ga0070697_100793115 3300005536 Bacteria 838
53 Ga0070672_100029681 3300005543 Bacteria 4103
54 Ga0070686_100825590 3300005544 Bacteria 749
55 Ga0070696_100341046 3300005546 Bacteria 1158
56 Ga0070696_100964904 3300005546 Bacteria 710
57 Ga0070693_100021491 3300005547 Bacteria 3419
58 Ga0070693_100216583 3300005547 Archaea 1252
59 Ga0070665_100869848 3300005548 Bacteria 914
60 Ga0070704_100606038 3300005549 Unclassified 963
61 Ga0070664_100286428 3300005564 Archaea 1486
62 Ga0070664_100325881 3300005564 Unclassified 1393
63 Ga0068854_100048565 3300005578 Unclassified 3028
64 Ga0068854_100893968 3300005578 Unclassified 780
65 Ga0068856_100022817 3300005614 Bacteria 6087
66 Ga0068856_100554052 3300005614 Bacteria 1171
67 Ga0070702_100796490 3300005615 Unclassified 730
68 Ga0068864_100293128 3300005618 Unclassified 1521
69 Ga0068866_10099764 3300005718 Bacteria 1600
70 Ga0068861_100408770 3300005719 Bacteria 1206
71 Ga0068863_100771437 3300005841 Unclassified 958
72 Ga0068858_100045242 3300005842 Bacteria 4078
73 Ga0068860_100306279 3300005843 Unclassified 1557
74 Ga0068860_100593751 3300005843 Archaea 1112
75 Ga0068862_100202754 3300005844 Bacteria 1789
76 Ga0081455_10003654 3300005937 Bacteria 17622
77 Ga0081455_10019745 3300005937 Bacteria 6365
78 Ga0081455_10189324 3300005937 Bacteria 1551
79 Ga0075363_100003451 3300006048 Bacteria 6721
80 Ga0070716_100807352 3300006173 Bacteria 727
81 Ga0075367_10118292 3300006178 Unclassified 1631
82 Ga0097621_100001100 3300006237 Bacteria 18890
83 Ga0097621_100009371 3300006237 Bacteria 7103
84 Ga0097621_100368723 3300006237 Archaea 1281
85 Ga0097621_101071747 3300006237 Archaea 756
86 Ga0068871_100000626 3300006358 Bacteria 24276
87 Ga0068871_100003379 3300006358 Bacteria 10966
88 Ga0068871_100100724 3300006358 Bacteria 2420
89 Ga0068871_100564614 3300006358 Archaea 1032
90 Ga0068871_101236840 3300006358 Archaea 701
91 Ga0075428_100000018 3300006844 Bacteria 147246
92 Ga0075430_100329759 3300006846 Bacteria 1261
93 Ga0075430_100366048 3300006846 Bacteria 1190
94 Ga0075431_100069197 3300006847 Bacteria 3642
95 Ga0075431_100129878 3300006847 Bacteria 2599
96 Ga0075431_100666742 3300006847 Bacteria 1020
97 Ga0075431_100757117 3300006847 Unclassified 946
98 Ga0075433_10125506 3300006852 Unclassified 2279
99 Ga0075433_10334823 3300006852 Bacteria 1338
100 Ga0075433_10337931 3300006852 Bacteria 1331
101 Ga0075433_10489496 3300006852 Bacteria 1083
102 Ga0075433_10672295 3300006852 Bacteria 908
103 Ga0075434_100038041 3300006871 Bacteria 4765
104 Ga0075434_100058909 3300006871 Bacteria 3817
105 Ga0075434_100070273 3300006871 Bacteria 3492
106 Ga0075434_100435774 3300006871 Unclassified 1332
107 Ga0075429_100121041 3300006880 Bacteria 2288
108 Ga0068865_100499858 3300006881 Archaea 1014
109 Ga0097620_101685893 3300006931 Bacteria 700
110 Ga0075435_100098975 3300007076 Bacteria 2414
111 Ga0105240_10529782 3300009093 Bacteria 1306
112 Ga0105240_10685007 3300009093 Bacteria 1120
113 Ga0111539_10000011 3300009094 Bacteria 356900
114 Ga0111539_10016518 3300009094 Bacteria 9152
115 Ga0111539_10026056 3300009094 Bacteria 7157
116 Ga0111539_10198009 3300009094 Bacteria 2343
117 Ga0105245_10001900 3300009098 Bacteria 18993
118 Ga0105245_10706586 3300009098 Bacteria 1042
119 Ga0105245_11036096 3300009098 Bacteria 866
120 Ga0114129_10065503 3300009147 Bacteria 5071
121 Ga0114129_10151322 3300009147 Unclassified 3176
122 Ga0114129_11602281 3300009147 Unclassified 797
123 Ga0105243_10019704 3300009148 Bacteria 5115
124 Ga0105242_10016755 3300009176 Bacteria 5702
125 Ga0105248_10057674 3300009177 Bacteria 4359
126 Ga0105248_10085853 3300009177 Bacteria 3541
127 Ga0105248_10268492 3300009177 Bacteria 1921
128 Ga0105237_10428607 3300009545 Unclassified 1328
129 Ga0105249_10186777 3300009553 Bacteria 2020
130 Ga0105249_10252600 3300009553 Bacteria 1749
131 Ga0105249_10271684 3300009553 Bacteria 1689
132 Ga0105239_10105833 3300010375 Bacteria 3116
133 Ga0105239_10175441 3300010375 Bacteria 2397
134 Ga0105239_10860475 3300010375 Archaea 1040
135 Ga0157373_10239307 3300013100 Bacteria 1283
136 Ga0157370_10011438 3300013104 Bacteria 9278
137 Ga0157369_10004312 3300013105 Bacteria 16803
138 Ga0157369_11048961 3300013105 Unclassified 834
139 Ga0157374_11525898 3300013296 Bacteria 692
140 Ga0157378_10000411 3300013297 Bacteria 42281
141 Ga0163162_10041893 3300013306 Bacteria 4581
142 Ga0163162_10147606 3300013306 Unclassified 2468
143 Ga0157372_10089000 3300013307 Bacteria 3507
144 Ga0157372_10275612 3300013307 Bacteria 1955
145 Ga0157375_10084054 3300013308 Bacteria 3230
146 Ga0157375_10693079 3300013308 Bacteria 1173
147 Ga0163163_10091905 3300014325 Bacteria 3049
148 Ga0157380_10206498 3300014326 Bacteria 1747
149 Ga0157379_10072538 3300014968 Bacteria 3080
150 Ga0157379_10353383 3300014968 Archaea 1346
151 Ga0157376_10083424 3300014969 Bacteria 2749
152 Ga0157376_10202110 3300014969 Bacteria 1829
153 Ga0157376_10414266 3300014969 Unclassified 1306
154 Ga0209050_1012143 3300025298 Bacteria 3988
155 Ga0209050_1030846 3300025298 Bacteria 1684
156 Ga0207642_10311204 3300025899 Bacteria 916
157 Ga0207680_10121827 3300025903 Unclassified 1707
158 Ga0207647_10423028 3300025904 Unclassified 749
159 Ga0207645_10396832 3300025907 Unclassified 927
160 Ga0207705_10039150 3300025909 Bacteria 3396
161 Ga0207705_10377959 3300025909 Unclassified 1094
162 Ga0207684_10006871 3300025910 Bacteria 10298
163 Ga0207684_10027719 3300025910 Bacteria 4825
164 Ga0207684_10068998 3300025910 Bacteria 3005
165 Ga0207695_10568257 3300025913 Bacteria 1015
166 Ga0207671_10000004 3300025914 Bacteria 1022356
167 Ga0207657_10014607 3300025919 Bacteria 7652
168 Ga0207646_10102663 3300025922 Bacteria 2564
169 Ga0207646_10691656 3300025922 Bacteria 912
170 Ga0207681_10023103 3300025923 Bacteria 3972
171 Ga0207681_10060671 3300025923 Bacteria 2597
172 Ga0207681_10154886 3300025923 Bacteria 1721
173 Ga0207681_10235726 3300025923 Bacteria 1422
174 Ga0207659_10092224 3300025926 Bacteria 2264
175 Ga0207687_10004490 3300025927 Bacteria 9285
176 Ga0207700_11316033 3300025928 Unclassified 644
177 Ga0207686_10052568 3300025934 Bacteria 2543
178 Ga0207686_10138472 3300025934 Bacteria 1679
179 Ga0207669_10021816 3300025937 Bacteria 3389
180 Ga0207691_10017477 3300025940 Bacteria 6800
181 Ga0207711_10261179 3300025941 Bacteria 1592
182 Ga0207661_10209842 3300025944 Unclassified 1716
183 Ga0207679_10007997 3300025945 Bacteria 6725
184 Ga0207667_10072259 3300025949 Bacteria 3586
185 Ga0207651_10067475 3300025960 Bacteria 2518
186 Ga0207712_10292731 3300025961 Bacteria 1333
187 Ga0207640_10040556 3300025981 Bacteria 2954
188 Ga0207640_10759803 3300025981 Unclassified 836
189 Ga0207677_10097218 3300026023 Bacteria 2157
190 Ga0207703_10080744 3300026035 Bacteria 2709
191 Ga0207702_10044635 3300026078 Bacteria 3726
192 Ga0207641_11510722 3300026088 Unclassified 673
193 Ga0207648_10029421 3300026089 Bacteria 4872
194 Ga0207676_10098965 3300026095 Bacteria 2413
195 Ga0207675_100236044 3300026118 Bacteria 1766
196 Ga0209969_1016498 3300027360 Bacteria 1084
197 Ga0209981_1019899 3300027378 Unclassified 955
198 Ga0210000_1002438 3300027462 Bacteria 2648
199 Ga0209995_1020939 3300027471 Bacteria 1083
200 Ga0209982_1002990 3300027552 Bacteria 2388
201 Ga0209983_1003341 3300027665 Bacteria 3438
202 Ga0209971_1002393 3300027682 Bacteria 4526
203 Ga0207428_10000023 3300027907 Bacteria 272062
204 Ga0207428_10008727 3300027907 Bacteria 9145
205 Ga0207428_10025403 3300027907 Bacteria 4959
206 Ga0207428_10112214 3300027907 Unclassified 2097
207 Ga0268264_10281941 3300028381 Unclassified 1557
208 Ga0268264_10544730 3300028381 Archaea 1137
209 Ga0265322_10001646 3300028654 Bacteria 7136
210 Ga0316181_1201779 3300030744 Bacteria 1218
211 Ga0265330_10055865 3300031235 Unclassified 1723
212 Ga0265332_10026247 3300031238 Bacteria 2555
213 Ga0265325_10113518 3300031241 Unclassified 1314
214 Ga0265329_10001593 3300031242 Bacteria 10868
215 Ga0265331_10112221 3300031250 Unclassified 1250
216 Ga0265327_10000598 3300031251 Bacteria 59988
217 Ga0265316_10149579 3300031344 Bacteria 1750
218 Ga0265316_10227734 3300031344 Bacteria 1373
219 Ga0307513_10052992 3300031456 Bacteria 4364
220 Ga0265342_10003112 3300031712 Bacteria 13866
221 Ga0307414_10011839 3300032004 Bacteria 5136
222 Ga0307414_10151484 3300032004 Unclassified 1830
223 Ga0307411_10514853 3300032005 Bacteria 1014
224 Ga0373931_0293440 3300035691 Unclassified 1002
225 Ga0373935_0618527 3300035692 Bacteria 793
226 Ga0373935_0909966 3300035692 Unclassified 652
227 Ga0373937_0074830 3300036401 Bacteria 3126
228 Ga0395900_1144043 3300037418 Unclassified 695
229 Ga0395901_1102414 3300038443 Unclassified 764
230 Ga0439431_0003635 3300041997 Bacteria 3402
231 Ga0439445_0019813 3300042004 Unclassified 1680
232 Ga0451577_0066805 3300042876 Bacteria 3206
233 Ga0453683_0020538 3300044673 Unclassified 4219
234 Ga0453684_0057846 3300044712 Bacteria 5013
235 Ga0453684_0861234 3300044712 Unclassified 973
236 Ga0451576_0825956 3300045051 Unclassified 973
237 Ga0495638_0000003 3300046460 Bacteria 888792
238 Ga0495656_0005011 3300046615 Unclassified 4562
239 Ga0495659_0003126 3300046664 Bacteria 5317
240 Ga0496109_0597487 3300048912 Bacteria 1040
241 Ga0496109_1092199 3300048912 Bacteria 735
242 Ga0496113_0392585 3300048916 Bacteria 1114
243 Ga0496114_0952897 3300048917 Archaea 741
244 Ga0501034_0015489 3300049571 Bacteria 7833
245 Ga0501067_0122835 3300049583 Bacteria 1445
246 Ga0501067_0130404 3300049583 Bacteria 1399
247 Ga0501075_0386147 3300049591 Bacteria 1067
248 Ga0501079_1087071 3300049741 Bacteria 630
249 nmdc:mga05p37_1005836_c1 3300050507 Bacteria 885
250 nmdc:mga05p37_116132_c1 3300050507 Unclassified 3289
251 nmdc:mga05p37_122397_c1 3300050507 Bacteria 3195
252 nmdc:mga05p37_425292_c1 3300050507 Unclassified 1544
253 nmdc:mga05p37_82222_c1 3300050507 Bacteria 3968
254 nmdc:mga09592_161268_c1 3300050508 Bacteria 1937
255 nmdc:mga09592_279003_c1 3300050508 Bacteria 1449
256 nmdc:mga09592_41731_c1 3300050508 Bacteria 3858
257 nmdc:mga0qj67_305873_c1 3300050509 Bacteria 1288
258 nmdc:mga0qj67_491052_c1 3300050509 Bacteria 987
259 nmdc:mga06r32_36212_c1 3300050510 Bacteria 4661
260 nmdc:mga06r32_489288_c1 3300050510 Unclassified 1208
261 nmdc:mga08y16_12_c1 3300050511 Bacteria 438455
262 nmdc:mga08y16_145356_c1 3300050511 Bacteria 2465
263 nmdc:mga08y16_449796_c1 3300050511 Unclassified 1314
264 nmdc:mga08y16_562904_c1 3300050511 Bacteria 1152
265 nmdc:mga0n895_1112764_c1 3300050512 Unclassified 767
266 nmdc:mga0n895_19442_c1 3300050512 Bacteria 6314
267 nmdc:mga0n895_526545_c1 3300050512 Bacteria 1189
268 nmdc:mga0n895_59547_c1 3300050512 Bacteria 3767
269 nmdc:mga0rr50_405283_c1 3300050513 Bacteria 1152
270 nmdc:mga0rr50_544984_c1 3300050513 Bacteria 988
271 nmdc:mga0rr50_661832_c1 3300050513 Unclassified 891
272 nmdc:mga0a205_104623_c1 3300050515 Bacteria 2730
273 nmdc:mga0a205_113752_c1 3300050515 Bacteria 2605
274 nmdc:mga0a205_234650_c1 3300050515 Bacteria 1717
275 nmdc:mga0a205_566774_c1 3300050515 Bacteria 990
276 nmdc:mga0a205_643571_c1 3300050515 Bacteria 912
277 nmdc:mga0a205_65279_c1 3300050515 Unclassified 3516
278 Ga0500643_000014 3300053087 Bacteria 318249
279 Ga0500595_127317 3300053119 Bacteria 718
280 Ga0500564_291037 3300053138 Unclassified 630
281 Ga0500590_025068 3300053148 Bacteria 3097
282 Ga0500616_0000007 3300053153 Bacteria 836875
283 Ga0501084_0112885 3300054114 Unclassified 2284

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10016518 Ga0111539_100165186 180
2 3300042876 Ga0451577_0066805 Ga0451577_0066805_201_743 180
3 3300050511 nmdc:mga08y16_145356_c1 nmdc:mga08y16_145356_c1_1480_2022 180
4 3300009147 Ga0114129_11602281 Ga0114129_116022811 181
5 3300025914 Ga0207671_10000004 Ga0207671_1000000499 181
6 3300050508 nmdc:mga09592_41731_c1 nmdc:mga09592_41731_c1_2399_2944 181
7 3300050513 nmdc:mga0rr50_544984_c1 nmdc:mga0rr50_544984_c1_45_590 181
8 3300006237 Ga0097621_100009371 Ga0097621_1000093712 182
9 3300006358 Ga0068871_100000626 Ga0068871_10000062614 182
10 3300006358 Ga0068871_100100724 Ga0068871_1001007242 182
11 3300014969 Ga0157376_10083424 Ga0157376_100834245 182
12 3300014969 Ga0157376_10414266 Ga0157376_104142662 182
13 3300035691 Ga0373931_0293440 Ga0373931_0293440_14_562 182
14 3300045051 Ga0451576_0825956 Ga0451576_0825956_86_634 182
15 3300049583 Ga0501067_0130404 Ga0501067_0130404_806_1354 182
16 3300003323 rootH1_10399629 rootH1_103996292 183
17 3300005353 Ga0070669_100179539 Ga0070669_1001795391 183
18 3300025923 Ga0207681_10060671 Ga0207681_100606711 183
19 3300026095 Ga0207676_10098965 Ga0207676_100989652 183
20 iso_pu_bacteria 8015556637 8015558754 183
21 3300003320 rootH2_10194752 rootH2_101947523 184
22 3300003791 Ga0055530_10065842 Ga0055530_100658421 184
23 3300025298 Ga0209050_1012143 Ga0209050_10121432 184
24 3300025298 Ga0209050_1030846 Ga0209050_10308463 184
25 3300031456 Ga0307513_10052992 Ga0307513_100529923 184
26 3300041997 Ga0439431_0003635 Ga0439431_0003635_235_792 184
27 3300042004 Ga0439445_0019813 Ga0439445_0019813_82_639 184
28 3300046460 Ga0495638_0000003 Ga0495638_0000003_664071_664655 184
29 3300049571 Ga0501034_0015489 Ga0501034_0015489_5761_6318 184
30 3300053153 Ga0500616_0000007 Ga0500616_0000007_107586_108179 184
31 3300003322 rootL2_10337007 rootL2_103370075 185
32 3300005335 Ga0070666_10055108 Ga0070666_100551083 185
33 3300005338 Ga0068868_100120963 Ga0068868_1001209632 185
34 3300005367 Ga0070667_100077635 Ga0070667_1000776351 185
35 3300005547 Ga0070693_100021491 Ga0070693_1000214913 185
36 3300005578 Ga0068854_100048565 Ga0068854_1000485652 185
37 3300005614 Ga0068856_100554052 Ga0068856_1005540521 185
38 3300005615 Ga0070702_100796490 Ga0070702_1007964901 185
39 3300005842 Ga0068858_100045242 Ga0068858_1000452424 185
40 3300005843 Ga0068860_100306279 Ga0068860_1003062792 185
41 3300006237 Ga0097621_100001100 Ga0097621_10000110019 185
42 3300006358 Ga0068871_100003379 Ga0068871_10000337912 185
43 3300009098 Ga0105245_10001900 Ga0105245_1000190018 185
44 3300009176 Ga0105242_10016755 Ga0105242_100167552 185
45 3300009177 Ga0105248_10268492 Ga0105248_102684922 185
46 3300010375 Ga0105239_10105833 Ga0105239_101058333 185
47 3300013297 Ga0157378_10000411 Ga0157378_1000041114 185
48 3300013306 Ga0163162_10041893 Ga0163162_100418932 185
49 3300014969 Ga0157376_10202110 Ga0157376_102021103 185
50 3300025903 Ga0207680_10121827 Ga0207680_101218272 185
51 3300025927 Ga0207687_10004490 Ga0207687_100044905 185
52 3300025934 Ga0207686_10052568 Ga0207686_100525682 185
53 3300025981 Ga0207640_10040556 Ga0207640_100405563 185
54 3300026023 Ga0207677_10097218 Ga0207677_100972183 185
55 3300026035 Ga0207703_10080744 Ga0207703_100807442 185
56 3300028381 Ga0268264_10281941 Ga0268264_102819412 185
57 3300030744 Ga0316181_1201779 Ga0316181_12017792 185
58 3300032004 Ga0307414_10151484 Ga0307414_101514842 185
59 3300050512 nmdc:mga0n895_526545_c1 nmdc:mga0n895_526545_c1_223_780 185
60 3300053148 Ga0500590_025068 Ga0500590_025068_2065_2622 185
61 3300054114 Ga0501084_0112885 Ga0501084_0112885_270_827 185
62 3300005364 Ga0070673_100184995 Ga0070673_1001849952 186
63 3300006846 Ga0075430_100329759 Ga0075430_1003297592 186
64 3300013308 Ga0157375_10693079 Ga0157375_106930791 186
65 3300014325 Ga0163163_10091905 Ga0163163_100919052 186
66 3300025960 Ga0207651_10067475 Ga0207651_100674753 186
67 3300027360 Ga0209969_1016498 Ga0209969_10164982 186
68 3300027378 Ga0209981_1019899 Ga0209981_10198992 186
69 3300027462 Ga0210000_1002438 Ga0210000_10024382 186
70 3300027471 Ga0209995_1020939 Ga0209995_10209392 186
71 3300027552 Ga0209982_1002990 Ga0209982_10029902 186
72 3300027665 Ga0209983_1003341 Ga0209983_10033413 186
73 3300027682 Ga0209971_1002393 Ga0209971_10023932 186
74 3300036401 Ga0373937_0074830 Ga0373937_0074830_1316_1882 186
75 3300048912 Ga0496109_1092199 Ga0496109_1092199_157_720 186
76 3300049591 Ga0501075_0386147 Ga0501075_0386147_440_1012 186
77 3300050509 nmdc:mga0qj67_491052_c1 nmdc:mga0qj67_491052_c1_29_589 186
78 3300053087 Ga0500643_000014 Ga0500643_000014_121297_121857 186
79 3300005438 Ga0070701_10047303 Ga0070701_100473032 187
80 3300005445 Ga0070708_100117158 Ga0070708_1001171583 187
81 3300005548 Ga0070665_100869848 Ga0070665_1008698482 187
82 3300006048 Ga0075363_100003451 Ga0075363_1000034519 187
83 3300006178 Ga0075367_10118292 Ga0075367_101182922 187
84 3300025941 Ga0207711_10261179 Ga0207711_102611792 187
85 3300027907 Ga0207428_10025403 Ga0207428_100254032 187
86 3300044673 Ga0453683_0020538 Ga0453683_0020538_1404_1967 187
87 3300044712 Ga0453684_0057846 Ga0453684_0057846_507_1085 187
88 3300044712 Ga0453684_0861234 Ga0453684_0861234_348_911 187
89 3300053119 Ga0500595_127317 Ga0500595_127317_47_613 187
90 3300000044 ARSoilOldRDRAFT_c005830 ARSoilOldRDRAFT_0058302 188
91 3300003322 rootL2_10129666 rootL2_101296663 188
92 3300005327 Ga0070658_10003242 Ga0070658_100032428 188
93 3300005327 Ga0070658_10899026 Ga0070658_108990261 188
94 3300005329 Ga0070683_100282893 Ga0070683_1002828932 188
95 3300005329 Ga0070683_101007327 Ga0070683_1010073271 188
96 3300005334 Ga0068869_100906486 Ga0068869_1009064862 188
97 3300005335 Ga0070666_10705275 Ga0070666_107052751 188
98 3300005339 Ga0070660_100027522 Ga0070660_1000275222 188
99 3300005345 Ga0070692_10223485 Ga0070692_102234852 188
100 3300005353 Ga0070669_100088660 Ga0070669_1000886603 188
101 3300005354 Ga0070675_100004821 Ga0070675_1000048213 188
102 3300005355 Ga0070671_100342825 Ga0070671_1003428252 188
103 3300005356 Ga0070674_100249815 Ga0070674_1002498151 188
104 3300005364 Ga0070673_100097079 Ga0070673_1000970793 188
105 3300005367 Ga0070667_100856590 Ga0070667_1008565901 188
106 3300005434 Ga0070709_10127955 Ga0070709_101279551 188
107 3300005435 Ga0070714_100182693 Ga0070714_1001826931 188
108 3300005436 Ga0070713_100944728 Ga0070713_1009447281 188
109 3300005436 Ga0070713_101586489 Ga0070713_1015864891 188
110 3300005440 Ga0070705_100037604 Ga0070705_1000376044 188
111 3300005445 Ga0070708_100072392 Ga0070708_1000723924 188
112 3300005445 Ga0070708_100222903 Ga0070708_1002229031 188
113 3300005445 Ga0070708_101348873 Ga0070708_1013488731 188
114 3300005457 Ga0070662_100013130 Ga0070662_1000131306 188
115 3300005459 Ga0068867_100145646 Ga0068867_1001456462 188
116 3300005459 Ga0068867_100181235 Ga0068867_1001812352 188
117 3300005467 Ga0070706_100027156 Ga0070706_1000271563 188
118 3300005467 Ga0070706_100199875 Ga0070706_1001998752 188
119 3300005468 Ga0070707_100009328 Ga0070707_10000932811 188
120 3300005471 Ga0070698_100118140 Ga0070698_1001181403 188
121 3300005471 Ga0070698_100127080 Ga0070698_1001270804 188
122 3300005471 Ga0070698_100834889 Ga0070698_1008348892 188
123 3300005518 Ga0070699_100011764 Ga0070699_1000117646 188
124 3300005518 Ga0070699_100017605 Ga0070699_10001760511 188
125 3300005518 Ga0070699_100309052 Ga0070699_1003090522 188
126 3300005535 Ga0070684_100199712 Ga0070684_1001997121 188
127 3300005536 Ga0070697_100195528 Ga0070697_1001955282 188
128 3300005536 Ga0070697_100388457 Ga0070697_1003884572 188
129 3300005536 Ga0070697_100747800 Ga0070697_1007478001 188
130 3300005536 Ga0070697_100793115 Ga0070697_1007931151 188
131 3300005543 Ga0070672_100029681 Ga0070672_1000296818 188
132 3300005544 Ga0070686_100825590 Ga0070686_1008255901 188
133 3300005546 Ga0070696_100341046 Ga0070696_1003410462 188
134 3300005546 Ga0070696_100964904 Ga0070696_1009649041 188
135 3300005547 Ga0070693_100216583 Ga0070693_1002165831 188
136 3300005549 Ga0070704_100606038 Ga0070704_1006060382 188
137 3300005564 Ga0070664_100286428 Ga0070664_1002864282 188
138 3300005564 Ga0070664_100325881 Ga0070664_1003258812 188
139 3300005578 Ga0068854_100893968 Ga0068854_1008939682 188
140 3300005614 Ga0068856_100022817 Ga0068856_1000228175 188
141 3300005618 Ga0068864_100293128 Ga0068864_1002931282 188
142 3300005718 Ga0068866_10099764 Ga0068866_100997642 188
143 3300005719 Ga0068861_100408770 Ga0068861_1004087702 188
144 3300005841 Ga0068863_100771437 Ga0068863_1007714372 188
145 3300005843 Ga0068860_100593751 Ga0068860_1005937511 188
146 3300005844 Ga0068862_100202754 Ga0068862_1002027543 188
147 3300005937 Ga0081455_10003654 Ga0081455_1000365416 188
148 3300005937 Ga0081455_10019745 Ga0081455_100197455 188
149 3300005937 Ga0081455_10189324 Ga0081455_101893242 188
150 3300006173 Ga0070716_100807352 Ga0070716_1008073521 188
151 3300006237 Ga0097621_100368723 Ga0097621_1003687232 188
152 3300006237 Ga0097621_101071747 Ga0097621_1010717471 188
153 3300006358 Ga0068871_100564614 Ga0068871_1005646141 188
154 3300006358 Ga0068871_101236840 Ga0068871_1012368401 188
155 3300006844 Ga0075428_100000018 Ga0075428_10000001824 188
156 3300006846 Ga0075430_100366048 Ga0075430_1003660482 188
157 3300006847 Ga0075431_100069197 Ga0075431_1000691973 188
158 3300006847 Ga0075431_100129878 Ga0075431_1001298782 188
159 3300006847 Ga0075431_100666742 Ga0075431_1006667421 188
160 3300006847 Ga0075431_100757117 Ga0075431_1007571172 188
161 3300006852 Ga0075433_10125506 Ga0075433_101255063 188
162 3300006852 Ga0075433_10334823 Ga0075433_103348232 188
163 3300006852 Ga0075433_10337931 Ga0075433_103379312 188
164 3300006852 Ga0075433_10489496 Ga0075433_104894961 188
165 3300006852 Ga0075433_10672295 Ga0075433_106722952 188
166 3300006871 Ga0075434_100038041 Ga0075434_1000380413 188
167 3300006871 Ga0075434_100058909 Ga0075434_1000589092 188
168 3300006871 Ga0075434_100070273 Ga0075434_1000702733 188
169 3300006871 Ga0075434_100435774 Ga0075434_1004357741 188
170 3300006880 Ga0075429_100121041 Ga0075429_1001210412 188
171 3300006881 Ga0068865_100499858 Ga0068865_1004998582 188
172 3300006931 Ga0097620_101685893 Ga0097620_1016858931 188
173 3300007076 Ga0075435_100098975 Ga0075435_1000989752 188
174 3300009093 Ga0105240_10529782 Ga0105240_105297822 188
175 3300009093 Ga0105240_10685007 Ga0105240_106850072 188
176 3300009094 Ga0111539_10000011 Ga0111539_10000011301 188
177 3300009094 Ga0111539_10026056 Ga0111539_100260565 188
178 3300009094 Ga0111539_10198009 Ga0111539_101980093 188
179 3300009098 Ga0105245_10706586 Ga0105245_107065862 188
180 3300009098 Ga0105245_11036096 Ga0105245_110360961 188
181 3300009147 Ga0114129_10065503 Ga0114129_100655035 188
182 3300009147 Ga0114129_10151322 Ga0114129_101513225 188
183 3300009148 Ga0105243_10019704 Ga0105243_100197046 188
184 3300009177 Ga0105248_10057674 Ga0105248_100576744 188
185 3300009177 Ga0105248_10085853 Ga0105248_100858533 188
186 3300009545 Ga0105237_10428607 Ga0105237_104286072 188
187 3300009553 Ga0105249_10186777 Ga0105249_101867772 188
188 3300009553 Ga0105249_10252600 Ga0105249_102526003 188
189 3300009553 Ga0105249_10271684 Ga0105249_102716843 188
190 3300010375 Ga0105239_10175441 Ga0105239_101754411 188
191 3300010375 Ga0105239_10860475 Ga0105239_108604751 188
192 3300013100 Ga0157373_10239307 Ga0157373_102393072 188
193 3300013104 Ga0157370_10011438 Ga0157370_100114383 188
194 3300013105 Ga0157369_10004312 Ga0157369_1000431214 188
195 3300013105 Ga0157369_11048961 Ga0157369_110489611 188
196 3300013296 Ga0157374_11525898 Ga0157374_115258981 188
197 3300013306 Ga0163162_10147606 Ga0163162_101476062 188
198 3300013307 Ga0157372_10089000 Ga0157372_100890003 188
199 3300013307 Ga0157372_10275612 Ga0157372_102756122 188
200 3300013308 Ga0157375_10084054 Ga0157375_100840541 188
201 3300014326 Ga0157380_10206498 Ga0157380_102064982 188
202 3300014968 Ga0157379_10072538 Ga0157379_100725383 188
203 3300014968 Ga0157379_10353383 Ga0157379_103533832 188
204 3300025899 Ga0207642_10311204 Ga0207642_103112042 188
205 3300025904 Ga0207647_10423028 Ga0207647_104230281 188
206 3300025907 Ga0207645_10396832 Ga0207645_103968322 188
207 3300025909 Ga0207705_10039150 Ga0207705_100391502 188
208 3300025909 Ga0207705_10377959 Ga0207705_103779592 188
209 3300025910 Ga0207684_10006871 Ga0207684_100068712 188
210 3300025910 Ga0207684_10027719 Ga0207684_100277194 188
211 3300025910 Ga0207684_10068998 Ga0207684_100689983 188
212 3300025913 Ga0207695_10568257 Ga0207695_105682572 188
213 3300025919 Ga0207657_10014607 Ga0207657_100146073 188
214 3300025922 Ga0207646_10102663 Ga0207646_101026632 188
215 3300025922 Ga0207646_10691656 Ga0207646_106916562 188
216 3300025923 Ga0207681_10023103 Ga0207681_100231034 188
217 3300025923 Ga0207681_10154886 Ga0207681_101548862 188
218 3300025923 Ga0207681_10235726 Ga0207681_102357262 188
219 3300025926 Ga0207659_10092224 Ga0207659_100922241 188
220 3300025928 Ga0207700_11316033 Ga0207700_113160331 188
221 3300025934 Ga0207686_10138472 Ga0207686_101384723 188
222 3300025937 Ga0207669_10021816 Ga0207669_100218163 188
223 3300025940 Ga0207691_10017477 Ga0207691_100174775 188
224 3300025944 Ga0207661_10209842 Ga0207661_102098422 188
225 3300025945 Ga0207679_10007997 Ga0207679_100079976 188
226 3300025949 Ga0207667_10072259 Ga0207667_100722592 188
227 3300025961 Ga0207712_10292731 Ga0207712_102927312 188
228 3300025981 Ga0207640_10759803 Ga0207640_107598032 188
229 3300026078 Ga0207702_10044635 Ga0207702_100446353 188
230 3300026088 Ga0207641_11510722 Ga0207641_115107221 188
231 3300026089 Ga0207648_10029421 Ga0207648_100294217 188
232 3300026118 Ga0207675_100236044 Ga0207675_1002360443 188
233 3300027907 Ga0207428_10000023 Ga0207428_1000002322 188
234 3300027907 Ga0207428_10008727 Ga0207428_100087272 188
235 3300027907 Ga0207428_10112214 Ga0207428_101122141 188
236 3300028381 Ga0268264_10544730 Ga0268264_105447302 188
237 3300028654 Ga0265322_10001646 Ga0265322_100016463 188
238 3300031235 Ga0265330_10055865 Ga0265330_100558652 188
239 3300031238 Ga0265332_10026247 Ga0265332_100262472 188
240 3300031241 Ga0265325_10113518 Ga0265325_101135183 188
241 3300031242 Ga0265329_10001593 Ga0265329_100015938 188
242 3300031250 Ga0265331_10112221 Ga0265331_101122211 188
243 3300031251 Ga0265327_10000598 Ga0265327_1000059843 188
244 3300031344 Ga0265316_10149579 Ga0265316_101495792 188
245 3300031344 Ga0265316_10227734 Ga0265316_102277342 188
246 3300031712 Ga0265342_10003112 Ga0265342_100031121 188
247 3300032004 Ga0307414_10011839 Ga0307414_100118393 188
248 3300032005 Ga0307411_10514853 Ga0307411_105148532 188
249 3300035692 Ga0373935_0618527 Ga0373935_0618527_16_582 188
250 3300035692 Ga0373935_0909966 Ga0373935_0909966_10_576 188
251 3300037418 Ga0395900_1144043 Ga0395900_1144043_54_620 188
252 3300038443 Ga0395901_1102414 Ga0395901_1102414_29_595 188
253 3300046615 Ga0495656_0005011 Ga0495656_0005011_3905_4471 188
254 3300046664 Ga0495659_0003126 Ga0495659_0003126_710_1276 188
255 3300048912 Ga0496109_0597487 Ga0496109_0597487_140_706 188
256 3300048916 Ga0496113_0392585 Ga0496113_0392585_128_694 188
257 3300048917 Ga0496114_0952897 Ga0496114_0952897_124_690 188
258 3300049583 Ga0501067_0122835 Ga0501067_0122835_803_1369 188
259 3300049741 Ga0501079_1087071 Ga0501079_1087071_14_583 188
260 3300050507 nmdc:mga05p37_1005836_c1 nmdc:mga05p37_1005836_c1_188_769 188
261 3300050507 nmdc:mga05p37_116132_c1 nmdc:mga05p37_116132_c1_926_1495 188
262 3300050507 nmdc:mga05p37_122397_c1 nmdc:mga05p37_122397_c1_1091_1657 188
263 3300050507 nmdc:mga05p37_425292_c1 nmdc:mga05p37_425292_c1_164_730 188
264 3300050507 nmdc:mga05p37_82222_c1 nmdc:mga05p37_82222_c1_992_1558 188
265 3300050508 nmdc:mga09592_161268_c1 nmdc:mga09592_161268_c1_856_1425 188
266 3300050508 nmdc:mga09592_279003_c1 nmdc:mga09592_279003_c1_224_805 188
267 3300050509 nmdc:mga0qj67_305873_c1 nmdc:mga0qj67_305873_c1_341_922 188
268 3300050510 nmdc:mga06r32_36212_c1 nmdc:mga06r32_36212_c1_2117_2683 188
269 3300050510 nmdc:mga06r32_489288_c1 nmdc:mga06r32_489288_c1_13_579 188
270 3300050511 nmdc:mga08y16_12_c1 nmdc:mga08y16_12_c1_337480_338061 188
271 3300050511 nmdc:mga08y16_449796_c1 nmdc:mga08y16_449796_c1_573_1139 188
272 3300050511 nmdc:mga08y16_562904_c1 nmdc:mga08y16_562904_c1_40_621 188
273 3300050512 nmdc:mga0n895_1112764_c1 nmdc:mga0n895_1112764_c1_68_691 188
274 3300050512 nmdc:mga0n895_19442_c1 nmdc:mga0n895_19442_c1_5275_5856 188
275 3300050512 nmdc:mga0n895_59547_c1 nmdc:mga0n895_59547_c1_2883_3464 188
276 3300050513 nmdc:mga0rr50_405283_c1 nmdc:mga0rr50_405283_c1_98_664 188
277 3300050513 nmdc:mga0rr50_661832_c1 nmdc:mga0rr50_661832_c1_232_855 188
278 3300050515 nmdc:mga0a205_104623_c1 nmdc:mga0a205_104623_c1_1515_2096 188
279 3300050515 nmdc:mga0a205_113752_c1 nmdc:mga0a205_113752_c1_369_992 188
280 3300050515 nmdc:mga0a205_234650_c1 nmdc:mga0a205_234650_c1_590_1156 188
281 3300050515 nmdc:mga0a205_566774_c1 nmdc:mga0a205_566774_c1_317_883 188
282 3300050515 nmdc:mga0a205_643571_c1 nmdc:mga0a205_643571_c1_165_746 188
283 3300050515 nmdc:mga0a205_65279_c1 nmdc:mga0a205_65279_c1_971_1537 188
284 3300053138 Ga0500564_291037 Ga0500564_291037_45_611 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

35

214

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8368 2 187
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8299 3 187
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8209 3 187
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8182 1 187
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8139 1 187
ID Description Score Start End Superfamily
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8354 2 184 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8306 2 184 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8099 1 187 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8081 3 188 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8055 1 187 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A7Y5G0Q8-F1-model_v4 Dihydrofolate reductase 0.9782 1 188 GO:0008703
GO:0009231
AF-A0A1B9SPR1-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9768 1 187 GO:0008703
GO:0009231
AF-A0A7Y5G0Q8-F1-model_v4 Dihydrofolate reductase 0.973 1 188 GO:0008703
GO:0009231
AF-A0A0H4P8U0-F1-model_v4 Dihydrofolate reductase 0.9719 1 188 GO:0008703
GO:0009231
AF-A0A1B9SPR1-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9716 1 187 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
93.43 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map