F386028
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 284 | 176 | 283 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300005364|Ga0070673_100097079|Ga0070673_1000970793 |
| Length | 221 |
| Sequence | VKQSSASLGVLRGEFFLLFSSKQLPNHPNGYPTMRKLTVFNQISLDGRFTDAKGDMSWAHRPNDDTEWNEFVAGNAGSGGTLVFGRVTYQMMASYWPTPAALQNTPDLARHMNELQKIVFSRTLKEASWQNTTLLKGDLASEVRALKNAPGSDMTILGSGSIVAQLAQAGLIDEFFVVVNPIAVGGGRTMFDGVNGPLTLRRTSVRSFANGNVVLAYAPTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 129 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 130 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 131 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 133 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 134 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 135 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 136 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 137 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 138 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 139 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 140 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 141 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 142 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 143 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 145 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 146 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 147 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 148 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 149 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 150 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 151 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 152 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 157 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 158 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 171 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 172 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 173 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 174 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 175 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 8015556637 | Bdellovibrio reynosensis LBG001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.65 |
| Metatranscriptomes | 0 |
| Isolates | 0.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.52 |
| Nodule | 0 |
| Rhizoplane | 1.41 |
| Rhizosphere | 93.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARSoilOldRDRAFT_c005830 | 3300000044 | Bacteria | 1036 |
| 2 | rootH2_10194752 | 3300003320 | Bacteria | 2165 |
| 3 | rootL2_10129666 | 3300003322 | Bacteria | 2595 |
| 4 | rootL2_10337007 | 3300003322 | Bacteria | 3378 |
| 5 | rootH1_10399629 | 3300003323 | Bacteria | 1287 |
| 6 | Ga0055530_10065842 | 3300003791 | Bacteria | 794 |
| 7 | Ga0070658_10003242 | 3300005327 | Bacteria | 13434 |
| 8 | Ga0070658_10899026 | 3300005327 | Unclassified | 770 |
| 9 | Ga0070683_100282893 | 3300005329 | Unclassified | 1578 |
| 10 | Ga0070683_101007327 | 3300005329 | Unclassified | 800 |
| 11 | Ga0068869_100906486 | 3300005334 | Unclassified | 763 |
| 12 | Ga0070666_10055108 | 3300005335 | Bacteria | 2683 |
| 13 | Ga0070666_10705275 | 3300005335 | Bacteria | 740 |
| 14 | Ga0068868_100120963 | 3300005338 | Bacteria | 2135 |
| 15 | Ga0070660_100027522 | 3300005339 | Bacteria | 4244 |
| 16 | Ga0070692_10223485 | 3300005345 | Bacteria | 1114 |
| 17 | Ga0070669_100088660 | 3300005353 | Unclassified | 2316 |
| 18 | Ga0070669_100179539 | 3300005353 | Bacteria | 1655 |
| 19 | Ga0070675_100004821 | 3300005354 | Bacteria | 10290 |
| 20 | Ga0070671_100342825 | 3300005355 | Bacteria | 1275 |
| 21 | Ga0070674_100249815 | 3300005356 | Bacteria | 1393 |
| 22 | Ga0070673_100097079 | 3300005364 | Unclassified | 2419 |
| 23 | Ga0070673_100184995 | 3300005364 | Bacteria | 1785 |
| 24 | Ga0070667_100077635 | 3300005367 | Bacteria | 2836 |
| 25 | Ga0070667_100856590 | 3300005367 | Bacteria | 845 |
| 26 | Ga0070709_10127955 | 3300005434 | Bacteria | 1730 |
| 27 | Ga0070714_100182693 | 3300005435 | Bacteria | 1909 |
| 28 | Ga0070713_100944728 | 3300005436 | Bacteria | 830 |
| 29 | Ga0070713_101586489 | 3300005436 | Unclassified | 635 |
| 30 | Ga0070701_10047303 | 3300005438 | Bacteria | 2215 |
| 31 | Ga0070705_100037604 | 3300005440 | Bacteria | 2732 |
| 32 | Ga0070708_100072392 | 3300005445 | Bacteria | 3105 |
| 33 | Ga0070708_100117158 | 3300005445 | Bacteria | 2453 |
| 34 | Ga0070708_100222903 | 3300005445 | Bacteria | 1768 |
| 35 | Ga0070708_101348873 | 3300005445 | Bacteria | 666 |
| 36 | Ga0070662_100013130 | 3300005457 | Bacteria | 5506 |
| 37 | Ga0068867_100145646 | 3300005459 | Bacteria | 1856 |
| 38 | Ga0068867_100181235 | 3300005459 | Unclassified | 1675 |
| 39 | Ga0070706_100027156 | 3300005467 | Bacteria | 5267 |
| 40 | Ga0070706_100199875 | 3300005467 | Bacteria | 1867 |
| 41 | Ga0070707_100009328 | 3300005468 | Bacteria | 9108 |
| 42 | Ga0070698_100118140 | 3300005471 | Bacteria | 2613 |
| 43 | Ga0070698_100127080 | 3300005471 | Bacteria | 2506 |
| 44 | Ga0070698_100834889 | 3300005471 | Unclassified | 866 |
| 45 | Ga0070699_100011764 | 3300005518 | Bacteria | 7552 |
| 46 | Ga0070699_100017605 | 3300005518 | Bacteria | 6134 |
| 47 | Ga0070699_100309052 | 3300005518 | Bacteria | 1419 |
| 48 | Ga0070684_100199712 | 3300005535 | Bacteria | 1821 |
| 49 | Ga0070697_100195528 | 3300005536 | Bacteria | 1717 |
| 50 | Ga0070697_100388457 | 3300005536 | Unclassified | 1210 |
| 51 | Ga0070697_100747800 | 3300005536 | Unclassified | 864 |
| 52 | Ga0070697_100793115 | 3300005536 | Bacteria | 838 |
| 53 | Ga0070672_100029681 | 3300005543 | Bacteria | 4103 |
| 54 | Ga0070686_100825590 | 3300005544 | Bacteria | 749 |
| 55 | Ga0070696_100341046 | 3300005546 | Bacteria | 1158 |
| 56 | Ga0070696_100964904 | 3300005546 | Bacteria | 710 |
| 57 | Ga0070693_100021491 | 3300005547 | Bacteria | 3419 |
| 58 | Ga0070693_100216583 | 3300005547 | Archaea | 1252 |
| 59 | Ga0070665_100869848 | 3300005548 | Bacteria | 914 |
| 60 | Ga0070704_100606038 | 3300005549 | Unclassified | 963 |
| 61 | Ga0070664_100286428 | 3300005564 | Archaea | 1486 |
| 62 | Ga0070664_100325881 | 3300005564 | Unclassified | 1393 |
| 63 | Ga0068854_100048565 | 3300005578 | Unclassified | 3028 |
| 64 | Ga0068854_100893968 | 3300005578 | Unclassified | 780 |
| 65 | Ga0068856_100022817 | 3300005614 | Bacteria | 6087 |
| 66 | Ga0068856_100554052 | 3300005614 | Bacteria | 1171 |
| 67 | Ga0070702_100796490 | 3300005615 | Unclassified | 730 |
| 68 | Ga0068864_100293128 | 3300005618 | Unclassified | 1521 |
| 69 | Ga0068866_10099764 | 3300005718 | Bacteria | 1600 |
| 70 | Ga0068861_100408770 | 3300005719 | Bacteria | 1206 |
| 71 | Ga0068863_100771437 | 3300005841 | Unclassified | 958 |
| 72 | Ga0068858_100045242 | 3300005842 | Bacteria | 4078 |
| 73 | Ga0068860_100306279 | 3300005843 | Unclassified | 1557 |
| 74 | Ga0068860_100593751 | 3300005843 | Archaea | 1112 |
| 75 | Ga0068862_100202754 | 3300005844 | Bacteria | 1789 |
| 76 | Ga0081455_10003654 | 3300005937 | Bacteria | 17622 |
| 77 | Ga0081455_10019745 | 3300005937 | Bacteria | 6365 |
| 78 | Ga0081455_10189324 | 3300005937 | Bacteria | 1551 |
| 79 | Ga0075363_100003451 | 3300006048 | Bacteria | 6721 |
| 80 | Ga0070716_100807352 | 3300006173 | Bacteria | 727 |
| 81 | Ga0075367_10118292 | 3300006178 | Unclassified | 1631 |
| 82 | Ga0097621_100001100 | 3300006237 | Bacteria | 18890 |
| 83 | Ga0097621_100009371 | 3300006237 | Bacteria | 7103 |
| 84 | Ga0097621_100368723 | 3300006237 | Archaea | 1281 |
| 85 | Ga0097621_101071747 | 3300006237 | Archaea | 756 |
| 86 | Ga0068871_100000626 | 3300006358 | Bacteria | 24276 |
| 87 | Ga0068871_100003379 | 3300006358 | Bacteria | 10966 |
| 88 | Ga0068871_100100724 | 3300006358 | Bacteria | 2420 |
| 89 | Ga0068871_100564614 | 3300006358 | Archaea | 1032 |
| 90 | Ga0068871_101236840 | 3300006358 | Archaea | 701 |
| 91 | Ga0075428_100000018 | 3300006844 | Bacteria | 147246 |
| 92 | Ga0075430_100329759 | 3300006846 | Bacteria | 1261 |
| 93 | Ga0075430_100366048 | 3300006846 | Bacteria | 1190 |
| 94 | Ga0075431_100069197 | 3300006847 | Bacteria | 3642 |
| 95 | Ga0075431_100129878 | 3300006847 | Bacteria | 2599 |
| 96 | Ga0075431_100666742 | 3300006847 | Bacteria | 1020 |
| 97 | Ga0075431_100757117 | 3300006847 | Unclassified | 946 |
| 98 | Ga0075433_10125506 | 3300006852 | Unclassified | 2279 |
| 99 | Ga0075433_10334823 | 3300006852 | Bacteria | 1338 |
| 100 | Ga0075433_10337931 | 3300006852 | Bacteria | 1331 |
| 101 | Ga0075433_10489496 | 3300006852 | Bacteria | 1083 |
| 102 | Ga0075433_10672295 | 3300006852 | Bacteria | 908 |
| 103 | Ga0075434_100038041 | 3300006871 | Bacteria | 4765 |
| 104 | Ga0075434_100058909 | 3300006871 | Bacteria | 3817 |
| 105 | Ga0075434_100070273 | 3300006871 | Bacteria | 3492 |
| 106 | Ga0075434_100435774 | 3300006871 | Unclassified | 1332 |
| 107 | Ga0075429_100121041 | 3300006880 | Bacteria | 2288 |
| 108 | Ga0068865_100499858 | 3300006881 | Archaea | 1014 |
| 109 | Ga0097620_101685893 | 3300006931 | Bacteria | 700 |
| 110 | Ga0075435_100098975 | 3300007076 | Bacteria | 2414 |
| 111 | Ga0105240_10529782 | 3300009093 | Bacteria | 1306 |
| 112 | Ga0105240_10685007 | 3300009093 | Bacteria | 1120 |
| 113 | Ga0111539_10000011 | 3300009094 | Bacteria | 356900 |
| 114 | Ga0111539_10016518 | 3300009094 | Bacteria | 9152 |
| 115 | Ga0111539_10026056 | 3300009094 | Bacteria | 7157 |
| 116 | Ga0111539_10198009 | 3300009094 | Bacteria | 2343 |
| 117 | Ga0105245_10001900 | 3300009098 | Bacteria | 18993 |
| 118 | Ga0105245_10706586 | 3300009098 | Bacteria | 1042 |
| 119 | Ga0105245_11036096 | 3300009098 | Bacteria | 866 |
| 120 | Ga0114129_10065503 | 3300009147 | Bacteria | 5071 |
| 121 | Ga0114129_10151322 | 3300009147 | Unclassified | 3176 |
| 122 | Ga0114129_11602281 | 3300009147 | Unclassified | 797 |
| 123 | Ga0105243_10019704 | 3300009148 | Bacteria | 5115 |
| 124 | Ga0105242_10016755 | 3300009176 | Bacteria | 5702 |
| 125 | Ga0105248_10057674 | 3300009177 | Bacteria | 4359 |
| 126 | Ga0105248_10085853 | 3300009177 | Bacteria | 3541 |
| 127 | Ga0105248_10268492 | 3300009177 | Bacteria | 1921 |
| 128 | Ga0105237_10428607 | 3300009545 | Unclassified | 1328 |
| 129 | Ga0105249_10186777 | 3300009553 | Bacteria | 2020 |
| 130 | Ga0105249_10252600 | 3300009553 | Bacteria | 1749 |
| 131 | Ga0105249_10271684 | 3300009553 | Bacteria | 1689 |
| 132 | Ga0105239_10105833 | 3300010375 | Bacteria | 3116 |
| 133 | Ga0105239_10175441 | 3300010375 | Bacteria | 2397 |
| 134 | Ga0105239_10860475 | 3300010375 | Archaea | 1040 |
| 135 | Ga0157373_10239307 | 3300013100 | Bacteria | 1283 |
| 136 | Ga0157370_10011438 | 3300013104 | Bacteria | 9278 |
| 137 | Ga0157369_10004312 | 3300013105 | Bacteria | 16803 |
| 138 | Ga0157369_11048961 | 3300013105 | Unclassified | 834 |
| 139 | Ga0157374_11525898 | 3300013296 | Bacteria | 692 |
| 140 | Ga0157378_10000411 | 3300013297 | Bacteria | 42281 |
| 141 | Ga0163162_10041893 | 3300013306 | Bacteria | 4581 |
| 142 | Ga0163162_10147606 | 3300013306 | Unclassified | 2468 |
| 143 | Ga0157372_10089000 | 3300013307 | Bacteria | 3507 |
| 144 | Ga0157372_10275612 | 3300013307 | Bacteria | 1955 |
| 145 | Ga0157375_10084054 | 3300013308 | Bacteria | 3230 |
| 146 | Ga0157375_10693079 | 3300013308 | Bacteria | 1173 |
| 147 | Ga0163163_10091905 | 3300014325 | Bacteria | 3049 |
| 148 | Ga0157380_10206498 | 3300014326 | Bacteria | 1747 |
| 149 | Ga0157379_10072538 | 3300014968 | Bacteria | 3080 |
| 150 | Ga0157379_10353383 | 3300014968 | Archaea | 1346 |
| 151 | Ga0157376_10083424 | 3300014969 | Bacteria | 2749 |
| 152 | Ga0157376_10202110 | 3300014969 | Bacteria | 1829 |
| 153 | Ga0157376_10414266 | 3300014969 | Unclassified | 1306 |
| 154 | Ga0209050_1012143 | 3300025298 | Bacteria | 3988 |
| 155 | Ga0209050_1030846 | 3300025298 | Bacteria | 1684 |
| 156 | Ga0207642_10311204 | 3300025899 | Bacteria | 916 |
| 157 | Ga0207680_10121827 | 3300025903 | Unclassified | 1707 |
| 158 | Ga0207647_10423028 | 3300025904 | Unclassified | 749 |
| 159 | Ga0207645_10396832 | 3300025907 | Unclassified | 927 |
| 160 | Ga0207705_10039150 | 3300025909 | Bacteria | 3396 |
| 161 | Ga0207705_10377959 | 3300025909 | Unclassified | 1094 |
| 162 | Ga0207684_10006871 | 3300025910 | Bacteria | 10298 |
| 163 | Ga0207684_10027719 | 3300025910 | Bacteria | 4825 |
| 164 | Ga0207684_10068998 | 3300025910 | Bacteria | 3005 |
| 165 | Ga0207695_10568257 | 3300025913 | Bacteria | 1015 |
| 166 | Ga0207671_10000004 | 3300025914 | Bacteria | 1022356 |
| 167 | Ga0207657_10014607 | 3300025919 | Bacteria | 7652 |
| 168 | Ga0207646_10102663 | 3300025922 | Bacteria | 2564 |
| 169 | Ga0207646_10691656 | 3300025922 | Bacteria | 912 |
| 170 | Ga0207681_10023103 | 3300025923 | Bacteria | 3972 |
| 171 | Ga0207681_10060671 | 3300025923 | Bacteria | 2597 |
| 172 | Ga0207681_10154886 | 3300025923 | Bacteria | 1721 |
| 173 | Ga0207681_10235726 | 3300025923 | Bacteria | 1422 |
| 174 | Ga0207659_10092224 | 3300025926 | Bacteria | 2264 |
| 175 | Ga0207687_10004490 | 3300025927 | Bacteria | 9285 |
| 176 | Ga0207700_11316033 | 3300025928 | Unclassified | 644 |
| 177 | Ga0207686_10052568 | 3300025934 | Bacteria | 2543 |
| 178 | Ga0207686_10138472 | 3300025934 | Bacteria | 1679 |
| 179 | Ga0207669_10021816 | 3300025937 | Bacteria | 3389 |
| 180 | Ga0207691_10017477 | 3300025940 | Bacteria | 6800 |
| 181 | Ga0207711_10261179 | 3300025941 | Bacteria | 1592 |
| 182 | Ga0207661_10209842 | 3300025944 | Unclassified | 1716 |
| 183 | Ga0207679_10007997 | 3300025945 | Bacteria | 6725 |
| 184 | Ga0207667_10072259 | 3300025949 | Bacteria | 3586 |
| 185 | Ga0207651_10067475 | 3300025960 | Bacteria | 2518 |
| 186 | Ga0207712_10292731 | 3300025961 | Bacteria | 1333 |
| 187 | Ga0207640_10040556 | 3300025981 | Bacteria | 2954 |
| 188 | Ga0207640_10759803 | 3300025981 | Unclassified | 836 |
| 189 | Ga0207677_10097218 | 3300026023 | Bacteria | 2157 |
| 190 | Ga0207703_10080744 | 3300026035 | Bacteria | 2709 |
| 191 | Ga0207702_10044635 | 3300026078 | Bacteria | 3726 |
| 192 | Ga0207641_11510722 | 3300026088 | Unclassified | 673 |
| 193 | Ga0207648_10029421 | 3300026089 | Bacteria | 4872 |
| 194 | Ga0207676_10098965 | 3300026095 | Bacteria | 2413 |
| 195 | Ga0207675_100236044 | 3300026118 | Bacteria | 1766 |
| 196 | Ga0209969_1016498 | 3300027360 | Bacteria | 1084 |
| 197 | Ga0209981_1019899 | 3300027378 | Unclassified | 955 |
| 198 | Ga0210000_1002438 | 3300027462 | Bacteria | 2648 |
| 199 | Ga0209995_1020939 | 3300027471 | Bacteria | 1083 |
| 200 | Ga0209982_1002990 | 3300027552 | Bacteria | 2388 |
| 201 | Ga0209983_1003341 | 3300027665 | Bacteria | 3438 |
| 202 | Ga0209971_1002393 | 3300027682 | Bacteria | 4526 |
| 203 | Ga0207428_10000023 | 3300027907 | Bacteria | 272062 |
| 204 | Ga0207428_10008727 | 3300027907 | Bacteria | 9145 |
| 205 | Ga0207428_10025403 | 3300027907 | Bacteria | 4959 |
| 206 | Ga0207428_10112214 | 3300027907 | Unclassified | 2097 |
| 207 | Ga0268264_10281941 | 3300028381 | Unclassified | 1557 |
| 208 | Ga0268264_10544730 | 3300028381 | Archaea | 1137 |
| 209 | Ga0265322_10001646 | 3300028654 | Bacteria | 7136 |
| 210 | Ga0316181_1201779 | 3300030744 | Bacteria | 1218 |
| 211 | Ga0265330_10055865 | 3300031235 | Unclassified | 1723 |
| 212 | Ga0265332_10026247 | 3300031238 | Bacteria | 2555 |
| 213 | Ga0265325_10113518 | 3300031241 | Unclassified | 1314 |
| 214 | Ga0265329_10001593 | 3300031242 | Bacteria | 10868 |
| 215 | Ga0265331_10112221 | 3300031250 | Unclassified | 1250 |
| 216 | Ga0265327_10000598 | 3300031251 | Bacteria | 59988 |
| 217 | Ga0265316_10149579 | 3300031344 | Bacteria | 1750 |
| 218 | Ga0265316_10227734 | 3300031344 | Bacteria | 1373 |
| 219 | Ga0307513_10052992 | 3300031456 | Bacteria | 4364 |
| 220 | Ga0265342_10003112 | 3300031712 | Bacteria | 13866 |
| 221 | Ga0307414_10011839 | 3300032004 | Bacteria | 5136 |
| 222 | Ga0307414_10151484 | 3300032004 | Unclassified | 1830 |
| 223 | Ga0307411_10514853 | 3300032005 | Bacteria | 1014 |
| 224 | Ga0373931_0293440 | 3300035691 | Unclassified | 1002 |
| 225 | Ga0373935_0618527 | 3300035692 | Bacteria | 793 |
| 226 | Ga0373935_0909966 | 3300035692 | Unclassified | 652 |
| 227 | Ga0373937_0074830 | 3300036401 | Bacteria | 3126 |
| 228 | Ga0395900_1144043 | 3300037418 | Unclassified | 695 |
| 229 | Ga0395901_1102414 | 3300038443 | Unclassified | 764 |
| 230 | Ga0439431_0003635 | 3300041997 | Bacteria | 3402 |
| 231 | Ga0439445_0019813 | 3300042004 | Unclassified | 1680 |
| 232 | Ga0451577_0066805 | 3300042876 | Bacteria | 3206 |
| 233 | Ga0453683_0020538 | 3300044673 | Unclassified | 4219 |
| 234 | Ga0453684_0057846 | 3300044712 | Bacteria | 5013 |
| 235 | Ga0453684_0861234 | 3300044712 | Unclassified | 973 |
| 236 | Ga0451576_0825956 | 3300045051 | Unclassified | 973 |
| 237 | Ga0495638_0000003 | 3300046460 | Bacteria | 888792 |
| 238 | Ga0495656_0005011 | 3300046615 | Unclassified | 4562 |
| 239 | Ga0495659_0003126 | 3300046664 | Bacteria | 5317 |
| 240 | Ga0496109_0597487 | 3300048912 | Bacteria | 1040 |
| 241 | Ga0496109_1092199 | 3300048912 | Bacteria | 735 |
| 242 | Ga0496113_0392585 | 3300048916 | Bacteria | 1114 |
| 243 | Ga0496114_0952897 | 3300048917 | Archaea | 741 |
| 244 | Ga0501034_0015489 | 3300049571 | Bacteria | 7833 |
| 245 | Ga0501067_0122835 | 3300049583 | Bacteria | 1445 |
| 246 | Ga0501067_0130404 | 3300049583 | Bacteria | 1399 |
| 247 | Ga0501075_0386147 | 3300049591 | Bacteria | 1067 |
| 248 | Ga0501079_1087071 | 3300049741 | Bacteria | 630 |
| 249 | nmdc:mga05p37_1005836_c1 | 3300050507 | Bacteria | 885 |
| 250 | nmdc:mga05p37_116132_c1 | 3300050507 | Unclassified | 3289 |
| 251 | nmdc:mga05p37_122397_c1 | 3300050507 | Bacteria | 3195 |
| 252 | nmdc:mga05p37_425292_c1 | 3300050507 | Unclassified | 1544 |
| 253 | nmdc:mga05p37_82222_c1 | 3300050507 | Bacteria | 3968 |
| 254 | nmdc:mga09592_161268_c1 | 3300050508 | Bacteria | 1937 |
| 255 | nmdc:mga09592_279003_c1 | 3300050508 | Bacteria | 1449 |
| 256 | nmdc:mga09592_41731_c1 | 3300050508 | Bacteria | 3858 |
| 257 | nmdc:mga0qj67_305873_c1 | 3300050509 | Bacteria | 1288 |
| 258 | nmdc:mga0qj67_491052_c1 | 3300050509 | Bacteria | 987 |
| 259 | nmdc:mga06r32_36212_c1 | 3300050510 | Bacteria | 4661 |
| 260 | nmdc:mga06r32_489288_c1 | 3300050510 | Unclassified | 1208 |
| 261 | nmdc:mga08y16_12_c1 | 3300050511 | Bacteria | 438455 |
| 262 | nmdc:mga08y16_145356_c1 | 3300050511 | Bacteria | 2465 |
| 263 | nmdc:mga08y16_449796_c1 | 3300050511 | Unclassified | 1314 |
| 264 | nmdc:mga08y16_562904_c1 | 3300050511 | Bacteria | 1152 |
| 265 | nmdc:mga0n895_1112764_c1 | 3300050512 | Unclassified | 767 |
| 266 | nmdc:mga0n895_19442_c1 | 3300050512 | Bacteria | 6314 |
| 267 | nmdc:mga0n895_526545_c1 | 3300050512 | Bacteria | 1189 |
| 268 | nmdc:mga0n895_59547_c1 | 3300050512 | Bacteria | 3767 |
| 269 | nmdc:mga0rr50_405283_c1 | 3300050513 | Bacteria | 1152 |
| 270 | nmdc:mga0rr50_544984_c1 | 3300050513 | Bacteria | 988 |
| 271 | nmdc:mga0rr50_661832_c1 | 3300050513 | Unclassified | 891 |
| 272 | nmdc:mga0a205_104623_c1 | 3300050515 | Bacteria | 2730 |
| 273 | nmdc:mga0a205_113752_c1 | 3300050515 | Bacteria | 2605 |
| 274 | nmdc:mga0a205_234650_c1 | 3300050515 | Bacteria | 1717 |
| 275 | nmdc:mga0a205_566774_c1 | 3300050515 | Bacteria | 990 |
| 276 | nmdc:mga0a205_643571_c1 | 3300050515 | Bacteria | 912 |
| 277 | nmdc:mga0a205_65279_c1 | 3300050515 | Unclassified | 3516 |
| 278 | Ga0500643_000014 | 3300053087 | Bacteria | 318249 |
| 279 | Ga0500595_127317 | 3300053119 | Bacteria | 718 |
| 280 | Ga0500564_291037 | 3300053138 | Unclassified | 630 |
| 281 | Ga0500590_025068 | 3300053148 | Bacteria | 3097 |
| 282 | Ga0500616_0000007 | 3300053153 | Bacteria | 836875 |
| 283 | Ga0501084_0112885 | 3300054114 | Unclassified | 2284 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009094 | Ga0111539_10016518 | Ga0111539_100165186 | 180 |
| 2 | 3300042876 | Ga0451577_0066805 | Ga0451577_0066805_201_743 | 180 |
| 3 | 3300050511 | nmdc:mga08y16_145356_c1 | nmdc:mga08y16_145356_c1_1480_2022 | 180 |
| 4 | 3300009147 | Ga0114129_11602281 | Ga0114129_116022811 | 181 |
| 5 | 3300025914 | Ga0207671_10000004 | Ga0207671_1000000499 | 181 |
| 6 | 3300050508 | nmdc:mga09592_41731_c1 | nmdc:mga09592_41731_c1_2399_2944 | 181 |
| 7 | 3300050513 | nmdc:mga0rr50_544984_c1 | nmdc:mga0rr50_544984_c1_45_590 | 181 |
| 8 | 3300006237 | Ga0097621_100009371 | Ga0097621_1000093712 | 182 |
| 9 | 3300006358 | Ga0068871_100000626 | Ga0068871_10000062614 | 182 |
| 10 | 3300006358 | Ga0068871_100100724 | Ga0068871_1001007242 | 182 |
| 11 | 3300014969 | Ga0157376_10083424 | Ga0157376_100834245 | 182 |
| 12 | 3300014969 | Ga0157376_10414266 | Ga0157376_104142662 | 182 |
| 13 | 3300035691 | Ga0373931_0293440 | Ga0373931_0293440_14_562 | 182 |
| 14 | 3300045051 | Ga0451576_0825956 | Ga0451576_0825956_86_634 | 182 |
| 15 | 3300049583 | Ga0501067_0130404 | Ga0501067_0130404_806_1354 | 182 |
| 16 | 3300003323 | rootH1_10399629 | rootH1_103996292 | 183 |
| 17 | 3300005353 | Ga0070669_100179539 | Ga0070669_1001795391 | 183 |
| 18 | 3300025923 | Ga0207681_10060671 | Ga0207681_100606711 | 183 |
| 19 | 3300026095 | Ga0207676_10098965 | Ga0207676_100989652 | 183 |
| 20 | iso_pu_bacteria | 8015556637 | 8015558754 | 183 |
| 21 | 3300003320 | rootH2_10194752 | rootH2_101947523 | 184 |
| 22 | 3300003791 | Ga0055530_10065842 | Ga0055530_100658421 | 184 |
| 23 | 3300025298 | Ga0209050_1012143 | Ga0209050_10121432 | 184 |
| 24 | 3300025298 | Ga0209050_1030846 | Ga0209050_10308463 | 184 |
| 25 | 3300031456 | Ga0307513_10052992 | Ga0307513_100529923 | 184 |
| 26 | 3300041997 | Ga0439431_0003635 | Ga0439431_0003635_235_792 | 184 |
| 27 | 3300042004 | Ga0439445_0019813 | Ga0439445_0019813_82_639 | 184 |
| 28 | 3300046460 | Ga0495638_0000003 | Ga0495638_0000003_664071_664655 | 184 |
| 29 | 3300049571 | Ga0501034_0015489 | Ga0501034_0015489_5761_6318 | 184 |
| 30 | 3300053153 | Ga0500616_0000007 | Ga0500616_0000007_107586_108179 | 184 |
| 31 | 3300003322 | rootL2_10337007 | rootL2_103370075 | 185 |
| 32 | 3300005335 | Ga0070666_10055108 | Ga0070666_100551083 | 185 |
| 33 | 3300005338 | Ga0068868_100120963 | Ga0068868_1001209632 | 185 |
| 34 | 3300005367 | Ga0070667_100077635 | Ga0070667_1000776351 | 185 |
| 35 | 3300005547 | Ga0070693_100021491 | Ga0070693_1000214913 | 185 |
| 36 | 3300005578 | Ga0068854_100048565 | Ga0068854_1000485652 | 185 |
| 37 | 3300005614 | Ga0068856_100554052 | Ga0068856_1005540521 | 185 |
| 38 | 3300005615 | Ga0070702_100796490 | Ga0070702_1007964901 | 185 |
| 39 | 3300005842 | Ga0068858_100045242 | Ga0068858_1000452424 | 185 |
| 40 | 3300005843 | Ga0068860_100306279 | Ga0068860_1003062792 | 185 |
| 41 | 3300006237 | Ga0097621_100001100 | Ga0097621_10000110019 | 185 |
| 42 | 3300006358 | Ga0068871_100003379 | Ga0068871_10000337912 | 185 |
| 43 | 3300009098 | Ga0105245_10001900 | Ga0105245_1000190018 | 185 |
| 44 | 3300009176 | Ga0105242_10016755 | Ga0105242_100167552 | 185 |
| 45 | 3300009177 | Ga0105248_10268492 | Ga0105248_102684922 | 185 |
| 46 | 3300010375 | Ga0105239_10105833 | Ga0105239_101058333 | 185 |
| 47 | 3300013297 | Ga0157378_10000411 | Ga0157378_1000041114 | 185 |
| 48 | 3300013306 | Ga0163162_10041893 | Ga0163162_100418932 | 185 |
| 49 | 3300014969 | Ga0157376_10202110 | Ga0157376_102021103 | 185 |
| 50 | 3300025903 | Ga0207680_10121827 | Ga0207680_101218272 | 185 |
| 51 | 3300025927 | Ga0207687_10004490 | Ga0207687_100044905 | 185 |
| 52 | 3300025934 | Ga0207686_10052568 | Ga0207686_100525682 | 185 |
| 53 | 3300025981 | Ga0207640_10040556 | Ga0207640_100405563 | 185 |
| 54 | 3300026023 | Ga0207677_10097218 | Ga0207677_100972183 | 185 |
| 55 | 3300026035 | Ga0207703_10080744 | Ga0207703_100807442 | 185 |
| 56 | 3300028381 | Ga0268264_10281941 | Ga0268264_102819412 | 185 |
| 57 | 3300030744 | Ga0316181_1201779 | Ga0316181_12017792 | 185 |
| 58 | 3300032004 | Ga0307414_10151484 | Ga0307414_101514842 | 185 |
| 59 | 3300050512 | nmdc:mga0n895_526545_c1 | nmdc:mga0n895_526545_c1_223_780 | 185 |
| 60 | 3300053148 | Ga0500590_025068 | Ga0500590_025068_2065_2622 | 185 |
| 61 | 3300054114 | Ga0501084_0112885 | Ga0501084_0112885_270_827 | 185 |
| 62 | 3300005364 | Ga0070673_100184995 | Ga0070673_1001849952 | 186 |
| 63 | 3300006846 | Ga0075430_100329759 | Ga0075430_1003297592 | 186 |
| 64 | 3300013308 | Ga0157375_10693079 | Ga0157375_106930791 | 186 |
| 65 | 3300014325 | Ga0163163_10091905 | Ga0163163_100919052 | 186 |
| 66 | 3300025960 | Ga0207651_10067475 | Ga0207651_100674753 | 186 |
| 67 | 3300027360 | Ga0209969_1016498 | Ga0209969_10164982 | 186 |
| 68 | 3300027378 | Ga0209981_1019899 | Ga0209981_10198992 | 186 |
| 69 | 3300027462 | Ga0210000_1002438 | Ga0210000_10024382 | 186 |
| 70 | 3300027471 | Ga0209995_1020939 | Ga0209995_10209392 | 186 |
| 71 | 3300027552 | Ga0209982_1002990 | Ga0209982_10029902 | 186 |
| 72 | 3300027665 | Ga0209983_1003341 | Ga0209983_10033413 | 186 |
| 73 | 3300027682 | Ga0209971_1002393 | Ga0209971_10023932 | 186 |
| 74 | 3300036401 | Ga0373937_0074830 | Ga0373937_0074830_1316_1882 | 186 |
| 75 | 3300048912 | Ga0496109_1092199 | Ga0496109_1092199_157_720 | 186 |
| 76 | 3300049591 | Ga0501075_0386147 | Ga0501075_0386147_440_1012 | 186 |
| 77 | 3300050509 | nmdc:mga0qj67_491052_c1 | nmdc:mga0qj67_491052_c1_29_589 | 186 |
| 78 | 3300053087 | Ga0500643_000014 | Ga0500643_000014_121297_121857 | 186 |
| 79 | 3300005438 | Ga0070701_10047303 | Ga0070701_100473032 | 187 |
| 80 | 3300005445 | Ga0070708_100117158 | Ga0070708_1001171583 | 187 |
| 81 | 3300005548 | Ga0070665_100869848 | Ga0070665_1008698482 | 187 |
| 82 | 3300006048 | Ga0075363_100003451 | Ga0075363_1000034519 | 187 |
| 83 | 3300006178 | Ga0075367_10118292 | Ga0075367_101182922 | 187 |
| 84 | 3300025941 | Ga0207711_10261179 | Ga0207711_102611792 | 187 |
| 85 | 3300027907 | Ga0207428_10025403 | Ga0207428_100254032 | 187 |
| 86 | 3300044673 | Ga0453683_0020538 | Ga0453683_0020538_1404_1967 | 187 |
| 87 | 3300044712 | Ga0453684_0057846 | Ga0453684_0057846_507_1085 | 187 |
| 88 | 3300044712 | Ga0453684_0861234 | Ga0453684_0861234_348_911 | 187 |
| 89 | 3300053119 | Ga0500595_127317 | Ga0500595_127317_47_613 | 187 |
| 90 | 3300000044 | ARSoilOldRDRAFT_c005830 | ARSoilOldRDRAFT_0058302 | 188 |
| 91 | 3300003322 | rootL2_10129666 | rootL2_101296663 | 188 |
| 92 | 3300005327 | Ga0070658_10003242 | Ga0070658_100032428 | 188 |
| 93 | 3300005327 | Ga0070658_10899026 | Ga0070658_108990261 | 188 |
| 94 | 3300005329 | Ga0070683_100282893 | Ga0070683_1002828932 | 188 |
| 95 | 3300005329 | Ga0070683_101007327 | Ga0070683_1010073271 | 188 |
| 96 | 3300005334 | Ga0068869_100906486 | Ga0068869_1009064862 | 188 |
| 97 | 3300005335 | Ga0070666_10705275 | Ga0070666_107052751 | 188 |
| 98 | 3300005339 | Ga0070660_100027522 | Ga0070660_1000275222 | 188 |
| 99 | 3300005345 | Ga0070692_10223485 | Ga0070692_102234852 | 188 |
| 100 | 3300005353 | Ga0070669_100088660 | Ga0070669_1000886603 | 188 |
| 101 | 3300005354 | Ga0070675_100004821 | Ga0070675_1000048213 | 188 |
| 102 | 3300005355 | Ga0070671_100342825 | Ga0070671_1003428252 | 188 |
| 103 | 3300005356 | Ga0070674_100249815 | Ga0070674_1002498151 | 188 |
| 104 | 3300005364 | Ga0070673_100097079 | Ga0070673_1000970793 | 188 |
| 105 | 3300005367 | Ga0070667_100856590 | Ga0070667_1008565901 | 188 |
| 106 | 3300005434 | Ga0070709_10127955 | Ga0070709_101279551 | 188 |
| 107 | 3300005435 | Ga0070714_100182693 | Ga0070714_1001826931 | 188 |
| 108 | 3300005436 | Ga0070713_100944728 | Ga0070713_1009447281 | 188 |
| 109 | 3300005436 | Ga0070713_101586489 | Ga0070713_1015864891 | 188 |
| 110 | 3300005440 | Ga0070705_100037604 | Ga0070705_1000376044 | 188 |
| 111 | 3300005445 | Ga0070708_100072392 | Ga0070708_1000723924 | 188 |
| 112 | 3300005445 | Ga0070708_100222903 | Ga0070708_1002229031 | 188 |
| 113 | 3300005445 | Ga0070708_101348873 | Ga0070708_1013488731 | 188 |
| 114 | 3300005457 | Ga0070662_100013130 | Ga0070662_1000131306 | 188 |
| 115 | 3300005459 | Ga0068867_100145646 | Ga0068867_1001456462 | 188 |
| 116 | 3300005459 | Ga0068867_100181235 | Ga0068867_1001812352 | 188 |
| 117 | 3300005467 | Ga0070706_100027156 | Ga0070706_1000271563 | 188 |
| 118 | 3300005467 | Ga0070706_100199875 | Ga0070706_1001998752 | 188 |
| 119 | 3300005468 | Ga0070707_100009328 | Ga0070707_10000932811 | 188 |
| 120 | 3300005471 | Ga0070698_100118140 | Ga0070698_1001181403 | 188 |
| 121 | 3300005471 | Ga0070698_100127080 | Ga0070698_1001270804 | 188 |
| 122 | 3300005471 | Ga0070698_100834889 | Ga0070698_1008348892 | 188 |
| 123 | 3300005518 | Ga0070699_100011764 | Ga0070699_1000117646 | 188 |
| 124 | 3300005518 | Ga0070699_100017605 | Ga0070699_10001760511 | 188 |
| 125 | 3300005518 | Ga0070699_100309052 | Ga0070699_1003090522 | 188 |
| 126 | 3300005535 | Ga0070684_100199712 | Ga0070684_1001997121 | 188 |
| 127 | 3300005536 | Ga0070697_100195528 | Ga0070697_1001955282 | 188 |
| 128 | 3300005536 | Ga0070697_100388457 | Ga0070697_1003884572 | 188 |
| 129 | 3300005536 | Ga0070697_100747800 | Ga0070697_1007478001 | 188 |
| 130 | 3300005536 | Ga0070697_100793115 | Ga0070697_1007931151 | 188 |
| 131 | 3300005543 | Ga0070672_100029681 | Ga0070672_1000296818 | 188 |
| 132 | 3300005544 | Ga0070686_100825590 | Ga0070686_1008255901 | 188 |
| 133 | 3300005546 | Ga0070696_100341046 | Ga0070696_1003410462 | 188 |
| 134 | 3300005546 | Ga0070696_100964904 | Ga0070696_1009649041 | 188 |
| 135 | 3300005547 | Ga0070693_100216583 | Ga0070693_1002165831 | 188 |
| 136 | 3300005549 | Ga0070704_100606038 | Ga0070704_1006060382 | 188 |
| 137 | 3300005564 | Ga0070664_100286428 | Ga0070664_1002864282 | 188 |
| 138 | 3300005564 | Ga0070664_100325881 | Ga0070664_1003258812 | 188 |
| 139 | 3300005578 | Ga0068854_100893968 | Ga0068854_1008939682 | 188 |
| 140 | 3300005614 | Ga0068856_100022817 | Ga0068856_1000228175 | 188 |
| 141 | 3300005618 | Ga0068864_100293128 | Ga0068864_1002931282 | 188 |
| 142 | 3300005718 | Ga0068866_10099764 | Ga0068866_100997642 | 188 |
| 143 | 3300005719 | Ga0068861_100408770 | Ga0068861_1004087702 | 188 |
| 144 | 3300005841 | Ga0068863_100771437 | Ga0068863_1007714372 | 188 |
| 145 | 3300005843 | Ga0068860_100593751 | Ga0068860_1005937511 | 188 |
| 146 | 3300005844 | Ga0068862_100202754 | Ga0068862_1002027543 | 188 |
| 147 | 3300005937 | Ga0081455_10003654 | Ga0081455_1000365416 | 188 |
| 148 | 3300005937 | Ga0081455_10019745 | Ga0081455_100197455 | 188 |
| 149 | 3300005937 | Ga0081455_10189324 | Ga0081455_101893242 | 188 |
| 150 | 3300006173 | Ga0070716_100807352 | Ga0070716_1008073521 | 188 |
| 151 | 3300006237 | Ga0097621_100368723 | Ga0097621_1003687232 | 188 |
| 152 | 3300006237 | Ga0097621_101071747 | Ga0097621_1010717471 | 188 |
| 153 | 3300006358 | Ga0068871_100564614 | Ga0068871_1005646141 | 188 |
| 154 | 3300006358 | Ga0068871_101236840 | Ga0068871_1012368401 | 188 |
| 155 | 3300006844 | Ga0075428_100000018 | Ga0075428_10000001824 | 188 |
| 156 | 3300006846 | Ga0075430_100366048 | Ga0075430_1003660482 | 188 |
| 157 | 3300006847 | Ga0075431_100069197 | Ga0075431_1000691973 | 188 |
| 158 | 3300006847 | Ga0075431_100129878 | Ga0075431_1001298782 | 188 |
| 159 | 3300006847 | Ga0075431_100666742 | Ga0075431_1006667421 | 188 |
| 160 | 3300006847 | Ga0075431_100757117 | Ga0075431_1007571172 | 188 |
| 161 | 3300006852 | Ga0075433_10125506 | Ga0075433_101255063 | 188 |
| 162 | 3300006852 | Ga0075433_10334823 | Ga0075433_103348232 | 188 |
| 163 | 3300006852 | Ga0075433_10337931 | Ga0075433_103379312 | 188 |
| 164 | 3300006852 | Ga0075433_10489496 | Ga0075433_104894961 | 188 |
| 165 | 3300006852 | Ga0075433_10672295 | Ga0075433_106722952 | 188 |
| 166 | 3300006871 | Ga0075434_100038041 | Ga0075434_1000380413 | 188 |
| 167 | 3300006871 | Ga0075434_100058909 | Ga0075434_1000589092 | 188 |
| 168 | 3300006871 | Ga0075434_100070273 | Ga0075434_1000702733 | 188 |
| 169 | 3300006871 | Ga0075434_100435774 | Ga0075434_1004357741 | 188 |
| 170 | 3300006880 | Ga0075429_100121041 | Ga0075429_1001210412 | 188 |
| 171 | 3300006881 | Ga0068865_100499858 | Ga0068865_1004998582 | 188 |
| 172 | 3300006931 | Ga0097620_101685893 | Ga0097620_1016858931 | 188 |
| 173 | 3300007076 | Ga0075435_100098975 | Ga0075435_1000989752 | 188 |
| 174 | 3300009093 | Ga0105240_10529782 | Ga0105240_105297822 | 188 |
| 175 | 3300009093 | Ga0105240_10685007 | Ga0105240_106850072 | 188 |
| 176 | 3300009094 | Ga0111539_10000011 | Ga0111539_10000011301 | 188 |
| 177 | 3300009094 | Ga0111539_10026056 | Ga0111539_100260565 | 188 |
| 178 | 3300009094 | Ga0111539_10198009 | Ga0111539_101980093 | 188 |
| 179 | 3300009098 | Ga0105245_10706586 | Ga0105245_107065862 | 188 |
| 180 | 3300009098 | Ga0105245_11036096 | Ga0105245_110360961 | 188 |
| 181 | 3300009147 | Ga0114129_10065503 | Ga0114129_100655035 | 188 |
| 182 | 3300009147 | Ga0114129_10151322 | Ga0114129_101513225 | 188 |
| 183 | 3300009148 | Ga0105243_10019704 | Ga0105243_100197046 | 188 |
| 184 | 3300009177 | Ga0105248_10057674 | Ga0105248_100576744 | 188 |
| 185 | 3300009177 | Ga0105248_10085853 | Ga0105248_100858533 | 188 |
| 186 | 3300009545 | Ga0105237_10428607 | Ga0105237_104286072 | 188 |
| 187 | 3300009553 | Ga0105249_10186777 | Ga0105249_101867772 | 188 |
| 188 | 3300009553 | Ga0105249_10252600 | Ga0105249_102526003 | 188 |
| 189 | 3300009553 | Ga0105249_10271684 | Ga0105249_102716843 | 188 |
| 190 | 3300010375 | Ga0105239_10175441 | Ga0105239_101754411 | 188 |
| 191 | 3300010375 | Ga0105239_10860475 | Ga0105239_108604751 | 188 |
| 192 | 3300013100 | Ga0157373_10239307 | Ga0157373_102393072 | 188 |
| 193 | 3300013104 | Ga0157370_10011438 | Ga0157370_100114383 | 188 |
| 194 | 3300013105 | Ga0157369_10004312 | Ga0157369_1000431214 | 188 |
| 195 | 3300013105 | Ga0157369_11048961 | Ga0157369_110489611 | 188 |
| 196 | 3300013296 | Ga0157374_11525898 | Ga0157374_115258981 | 188 |
| 197 | 3300013306 | Ga0163162_10147606 | Ga0163162_101476062 | 188 |
| 198 | 3300013307 | Ga0157372_10089000 | Ga0157372_100890003 | 188 |
| 199 | 3300013307 | Ga0157372_10275612 | Ga0157372_102756122 | 188 |
| 200 | 3300013308 | Ga0157375_10084054 | Ga0157375_100840541 | 188 |
| 201 | 3300014326 | Ga0157380_10206498 | Ga0157380_102064982 | 188 |
| 202 | 3300014968 | Ga0157379_10072538 | Ga0157379_100725383 | 188 |
| 203 | 3300014968 | Ga0157379_10353383 | Ga0157379_103533832 | 188 |
| 204 | 3300025899 | Ga0207642_10311204 | Ga0207642_103112042 | 188 |
| 205 | 3300025904 | Ga0207647_10423028 | Ga0207647_104230281 | 188 |
| 206 | 3300025907 | Ga0207645_10396832 | Ga0207645_103968322 | 188 |
| 207 | 3300025909 | Ga0207705_10039150 | Ga0207705_100391502 | 188 |
| 208 | 3300025909 | Ga0207705_10377959 | Ga0207705_103779592 | 188 |
| 209 | 3300025910 | Ga0207684_10006871 | Ga0207684_100068712 | 188 |
| 210 | 3300025910 | Ga0207684_10027719 | Ga0207684_100277194 | 188 |
| 211 | 3300025910 | Ga0207684_10068998 | Ga0207684_100689983 | 188 |
| 212 | 3300025913 | Ga0207695_10568257 | Ga0207695_105682572 | 188 |
| 213 | 3300025919 | Ga0207657_10014607 | Ga0207657_100146073 | 188 |
| 214 | 3300025922 | Ga0207646_10102663 | Ga0207646_101026632 | 188 |
| 215 | 3300025922 | Ga0207646_10691656 | Ga0207646_106916562 | 188 |
| 216 | 3300025923 | Ga0207681_10023103 | Ga0207681_100231034 | 188 |
| 217 | 3300025923 | Ga0207681_10154886 | Ga0207681_101548862 | 188 |
| 218 | 3300025923 | Ga0207681_10235726 | Ga0207681_102357262 | 188 |
| 219 | 3300025926 | Ga0207659_10092224 | Ga0207659_100922241 | 188 |
| 220 | 3300025928 | Ga0207700_11316033 | Ga0207700_113160331 | 188 |
| 221 | 3300025934 | Ga0207686_10138472 | Ga0207686_101384723 | 188 |
| 222 | 3300025937 | Ga0207669_10021816 | Ga0207669_100218163 | 188 |
| 223 | 3300025940 | Ga0207691_10017477 | Ga0207691_100174775 | 188 |
| 224 | 3300025944 | Ga0207661_10209842 | Ga0207661_102098422 | 188 |
| 225 | 3300025945 | Ga0207679_10007997 | Ga0207679_100079976 | 188 |
| 226 | 3300025949 | Ga0207667_10072259 | Ga0207667_100722592 | 188 |
| 227 | 3300025961 | Ga0207712_10292731 | Ga0207712_102927312 | 188 |
| 228 | 3300025981 | Ga0207640_10759803 | Ga0207640_107598032 | 188 |
| 229 | 3300026078 | Ga0207702_10044635 | Ga0207702_100446353 | 188 |
| 230 | 3300026088 | Ga0207641_11510722 | Ga0207641_115107221 | 188 |
| 231 | 3300026089 | Ga0207648_10029421 | Ga0207648_100294217 | 188 |
| 232 | 3300026118 | Ga0207675_100236044 | Ga0207675_1002360443 | 188 |
| 233 | 3300027907 | Ga0207428_10000023 | Ga0207428_1000002322 | 188 |
| 234 | 3300027907 | Ga0207428_10008727 | Ga0207428_100087272 | 188 |
| 235 | 3300027907 | Ga0207428_10112214 | Ga0207428_101122141 | 188 |
| 236 | 3300028381 | Ga0268264_10544730 | Ga0268264_105447302 | 188 |
| 237 | 3300028654 | Ga0265322_10001646 | Ga0265322_100016463 | 188 |
| 238 | 3300031235 | Ga0265330_10055865 | Ga0265330_100558652 | 188 |
| 239 | 3300031238 | Ga0265332_10026247 | Ga0265332_100262472 | 188 |
| 240 | 3300031241 | Ga0265325_10113518 | Ga0265325_101135183 | 188 |
| 241 | 3300031242 | Ga0265329_10001593 | Ga0265329_100015938 | 188 |
| 242 | 3300031250 | Ga0265331_10112221 | Ga0265331_101122211 | 188 |
| 243 | 3300031251 | Ga0265327_10000598 | Ga0265327_1000059843 | 188 |
| 244 | 3300031344 | Ga0265316_10149579 | Ga0265316_101495792 | 188 |
| 245 | 3300031344 | Ga0265316_10227734 | Ga0265316_102277342 | 188 |
| 246 | 3300031712 | Ga0265342_10003112 | Ga0265342_100031121 | 188 |
| 247 | 3300032004 | Ga0307414_10011839 | Ga0307414_100118393 | 188 |
| 248 | 3300032005 | Ga0307411_10514853 | Ga0307411_105148532 | 188 |
| 249 | 3300035692 | Ga0373935_0618527 | Ga0373935_0618527_16_582 | 188 |
| 250 | 3300035692 | Ga0373935_0909966 | Ga0373935_0909966_10_576 | 188 |
| 251 | 3300037418 | Ga0395900_1144043 | Ga0395900_1144043_54_620 | 188 |
| 252 | 3300038443 | Ga0395901_1102414 | Ga0395901_1102414_29_595 | 188 |
| 253 | 3300046615 | Ga0495656_0005011 | Ga0495656_0005011_3905_4471 | 188 |
| 254 | 3300046664 | Ga0495659_0003126 | Ga0495659_0003126_710_1276 | 188 |
| 255 | 3300048912 | Ga0496109_0597487 | Ga0496109_0597487_140_706 | 188 |
| 256 | 3300048916 | Ga0496113_0392585 | Ga0496113_0392585_128_694 | 188 |
| 257 | 3300048917 | Ga0496114_0952897 | Ga0496114_0952897_124_690 | 188 |
| 258 | 3300049583 | Ga0501067_0122835 | Ga0501067_0122835_803_1369 | 188 |
| 259 | 3300049741 | Ga0501079_1087071 | Ga0501079_1087071_14_583 | 188 |
| 260 | 3300050507 | nmdc:mga05p37_1005836_c1 | nmdc:mga05p37_1005836_c1_188_769 | 188 |
| 261 | 3300050507 | nmdc:mga05p37_116132_c1 | nmdc:mga05p37_116132_c1_926_1495 | 188 |
| 262 | 3300050507 | nmdc:mga05p37_122397_c1 | nmdc:mga05p37_122397_c1_1091_1657 | 188 |
| 263 | 3300050507 | nmdc:mga05p37_425292_c1 | nmdc:mga05p37_425292_c1_164_730 | 188 |
| 264 | 3300050507 | nmdc:mga05p37_82222_c1 | nmdc:mga05p37_82222_c1_992_1558 | 188 |
| 265 | 3300050508 | nmdc:mga09592_161268_c1 | nmdc:mga09592_161268_c1_856_1425 | 188 |
| 266 | 3300050508 | nmdc:mga09592_279003_c1 | nmdc:mga09592_279003_c1_224_805 | 188 |
| 267 | 3300050509 | nmdc:mga0qj67_305873_c1 | nmdc:mga0qj67_305873_c1_341_922 | 188 |
| 268 | 3300050510 | nmdc:mga06r32_36212_c1 | nmdc:mga06r32_36212_c1_2117_2683 | 188 |
| 269 | 3300050510 | nmdc:mga06r32_489288_c1 | nmdc:mga06r32_489288_c1_13_579 | 188 |
| 270 | 3300050511 | nmdc:mga08y16_12_c1 | nmdc:mga08y16_12_c1_337480_338061 | 188 |
| 271 | 3300050511 | nmdc:mga08y16_449796_c1 | nmdc:mga08y16_449796_c1_573_1139 | 188 |
| 272 | 3300050511 | nmdc:mga08y16_562904_c1 | nmdc:mga08y16_562904_c1_40_621 | 188 |
| 273 | 3300050512 | nmdc:mga0n895_1112764_c1 | nmdc:mga0n895_1112764_c1_68_691 | 188 |
| 274 | 3300050512 | nmdc:mga0n895_19442_c1 | nmdc:mga0n895_19442_c1_5275_5856 | 188 |
| 275 | 3300050512 | nmdc:mga0n895_59547_c1 | nmdc:mga0n895_59547_c1_2883_3464 | 188 |
| 276 | 3300050513 | nmdc:mga0rr50_405283_c1 | nmdc:mga0rr50_405283_c1_98_664 | 188 |
| 277 | 3300050513 | nmdc:mga0rr50_661832_c1 | nmdc:mga0rr50_661832_c1_232_855 | 188 |
| 278 | 3300050515 | nmdc:mga0a205_104623_c1 | nmdc:mga0a205_104623_c1_1515_2096 | 188 |
| 279 | 3300050515 | nmdc:mga0a205_113752_c1 | nmdc:mga0a205_113752_c1_369_992 | 188 |
| 280 | 3300050515 | nmdc:mga0a205_234650_c1 | nmdc:mga0a205_234650_c1_590_1156 | 188 |
| 281 | 3300050515 | nmdc:mga0a205_566774_c1 | nmdc:mga0a205_566774_c1_317_883 | 188 |
| 282 | 3300050515 | nmdc:mga0a205_643571_c1 | nmdc:mga0a205_643571_c1_165_746 | 188 |
| 283 | 3300050515 | nmdc:mga0a205_65279_c1 | nmdc:mga0a205_65279_c1_971_1537 | 188 |
| 284 | 3300053138 | Ga0500564_291037 | Ga0500564_291037_45_611 | 188 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gd9-assembly1.cif.gz_B | crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution | 0.8368 | 2 | 187 |
| 1d1g-assembly1.cif.gz_B | dihydrofolate reductase from thermotoga maritima | 0.8299 | 3 | 187 |
| 1d1g-assembly1.cif.gz_B | dihydrofolate reductase from thermotoga maritima | 0.8209 | 3 | 187 |
| 3jtw-assembly1.cif.gz_A-2 | crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution | 0.8182 | 1 | 187 |
| 3jtw-assembly1.cif.gz_A-2 | crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution | 0.8139 | 1 | 187 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gd9B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8354 | 2 | 184 | 3.40.430.10 |
| 2gd9B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8306 | 2 | 184 | 3.40.430.10 |
| 3jtwB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8099 | 1 | 187 | 3.40.430.10 |
| 1cz3B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8081 | 3 | 188 | 3.40.430.10 |
| 3jtwB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8055 | 1 | 187 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5G0Q8-F1-model_v4 | Dihydrofolate reductase | 0.9782 | 1 | 188 |
GO:0008703
GO:0009231 |
| AF-A0A1B9SPR1-F1-model_v4 | Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein | 0.9768 | 1 | 187 |
GO:0008703
GO:0009231 |
| AF-A0A7Y5G0Q8-F1-model_v4 | Dihydrofolate reductase | 0.973 | 1 | 188 |
GO:0008703
GO:0009231 |
| AF-A0A0H4P8U0-F1-model_v4 | Dihydrofolate reductase | 0.9719 | 1 | 188 |
GO:0008703
GO:0009231 |
| AF-A0A1B9SPR1-F1-model_v4 | Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein | 0.9716 | 1 | 187 |
GO:0008703
GO:0009231 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar