F385749

General Info

Members Datasets Scaffolds Average Seq Length
283 243 226 131

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0530961|Ga0466966_0530961_162_605
Length 147
Sequence LKVAAPNPADKRDGRRSQVELPNAIEVVTLFVEDIGEAKDFYAKVFEPDVVYQDEVSCVLRFTGAMVNLLQASQAPQLVRPAAVAPAASGARVLLTIKVADTDAVCAELRTRGVALLNGPIDRPWGRRTAAFADPSGHVWEIAQDLA

Samples

Sample ID Description Type Environment
1 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
2 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
3 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
4 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
5 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
6 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
7 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
8 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
9 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
10 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
11 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
12 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
13 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
14 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
15 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
16 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
17 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
18 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
19 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
20 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
21 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
22 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
23 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
24 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
25 2791355267 Rhizobium sp. L18 Isolate Nodule
26 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
27 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
28 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
29 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
30 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
31 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
32 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
33 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
34 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
35 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
36 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
37 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
38 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
39 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
40 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
41 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
42 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
43 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
44 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
45 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
46 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
47 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
48 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
49 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
50 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
51 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
52 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
53 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
54 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
55 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
56 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
57 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
58 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
59 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
60 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
61 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
62 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
63 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
127 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
128 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
129 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
132 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
133 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
134 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
135 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
136 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
137 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
138 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
139 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
140 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
141 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
164 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
198 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
201 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
211 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
212 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
213 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
214 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
215 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
216 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
217 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
218 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
219 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
220 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
221 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
222 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
223 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
224 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
225 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
228 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
229 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
233 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
234 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
235 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
236 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
237 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
238 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
239 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
240 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
241 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
242 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
243 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.86
Metatranscriptomes 0
Isolates 20.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.67
Nodule 14.84
Rhizoplane 2.47
Rhizosphere 44.88
Stem 0
Stem Tuber 0
Unclassified 14.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10068237 3300003320 Bacteria 3383
2 rootH2_10069274 3300003320 Bacteria 4633
3 rootL2_10160066 3300003322 Bacteria 1937
4 rootH1_10241296 3300003323 Bacteria 3588
5 JGI25160J50197_1001671 3300003354 Bacteria 10835
6 JGI25161J50226_1002537 3300003374 Bacteria 4621
7 Ga0055529_1008870 3300003763 Bacteria 1331
8 Ga0055524_1024692 3300003775 Bacteria 1899
9 Ga0055528_1001028 3300003790 Bacteria 18438
10 Ga0055528_1013882 3300003790 Bacteria 3022
11 Ga0055543_1000888 3300004625 Bacteria 14212
12 Ga0065165_1111600 3300005262 Bacteria 672
13 Ga0070676_10150308 3300005328 Bacteria 1490
14 Ga0068869_100775959 3300005334 Bacteria 822
15 Ga0068868_100556609 3300005338 Unclassified 1011
16 Ga0070668_100484931 3300005347 Bacteria 1068
17 Ga0070671_101359819 3300005355 Unclassified 627
18 Ga0070713_100166570 3300005436 Bacteria 1971
19 Ga0070678_101761248 3300005456 Unclassified 584
20 Ga0070706_100571523 3300005467 Bacteria 1051
21 Ga0070672_100800522 3300005543 Bacteria 829
22 Ga0068852_100607539 3300005616 Unclassified 1098
23 Ga0068851_10653933 3300005834 Unclassified 644
24 Ga0068863_100679899 3300005841 Bacteria 1022
25 Ga0068858_100421230 3300005842 Bacteria 1284
26 Ga0068862_102020001 3300005844 Bacteria 587
27 Ga0075363_100132006 3300006048 Bacteria 1401
28 Ga0075367_10809941 3300006178 Bacteria 597
29 Ga0075366_10290323 3300006195 Bacteria 1000
30 Ga0075370_10078740 3300006353 Bacteria 1893
31 Ga0075370_10261149 3300006353 Bacteria 1027
32 Ga0105247_11101740 3300009101 Unclassified 626
33 Ga0105243_11230425 3300009148 Bacteria 763
34 Ga0105241_10029365 3300009174 Bacteria 4102
35 Ga0105248_10778895 3300009177 Bacteria 1079
36 Ga0105249_11092361 3300009553 Bacteria 868
37 Ga0157369_10374645 3300013105 Bacteria 1478
38 Ga0157372_10563911 3300013307 Bacteria 1327
39 Ga0163163_10249978 3300014325 Unclassified 1823
40 Ga0157377_11421358 3300014745 Unclassified 548
41 Ga0163161_11632615 3300017792 Bacteria 569
42 Ga0213872_10211941 3300021361 Bacteria 827
43 Ga0213871_10325402 3300021441 Unclassified 500
44 Ga0209148_1000428 3300025254 Bacteria 46613
45 Ga0209129_1009893 3300025258 Bacteria 2446
46 Ga0209233_1007473 3300025261 Bacteria 3459
47 Ga0209455_1002286 3300025272 Bacteria 7540
48 Ga0209673_1000020 3300025273 Bacteria 430653
49 Ga0209673_1010619 3300025273 Bacteria 3863
50 Ga0209130_1034416 3300025284 Bacteria 1020
51 Ga0209025_1067089 3300025294 Bacteria 1298
52 Ga0209564_1001600 3300025295 Bacteria 22075
53 Ga0209564_1011821 3300025295 Bacteria 3873
54 Ga0209758_1002506 3300025297 Bacteria 18639
55 Ga0209256_1001851 3300025299 Bacteria 19603
56 Ga0209256_1097313 3300025299 Bacteria 615
57 Ga0207426_1000210 3300025302 Bacteria 138932
58 Ga0207680_11294567 3300025903 Bacteria 518
59 Ga0207645_10209523 3300025907 Bacteria 1284
60 Ga0207654_10027050 3300025911 Bacteria 3114
61 Ga0207700_10926775 3300025928 Bacteria 780
62 Ga0207709_10631241 3300025935 Bacteria 851
63 Ga0207669_11650992 3300025937 Bacteria 547
64 Ga0207669_11935346 3300025937 Unclassified 504
65 Ga0207691_10627055 3300025940 Bacteria 909
66 Ga0207689_10594118 3300025942 Bacteria 931
67 Ga0207712_11621233 3300025961 Bacteria 580
68 Ga0207668_10445265 3300025972 Bacteria 1104
69 Ga0207703_10742271 3300026035 Unclassified 935
70 Ga0207641_10289439 3300026088 Unclassified 1544
71 Ga0207698_12169284 3300026142 Unclassified 569
72 Ga0268266_10012737 3300028379 Bacteria 7268
73 Ga0307517_10266360 3300028786 Bacteria 990
74 Ga0307513_10039783 3300031456 Bacteria 5208
75 Ga0307513_10040653 3300031456 Bacteria 5140
76 Ga0307516_10514627 3300031730 Unclassified 851
77 Ga0307414_10492107 3300032004 Bacteria 1083
78 Ga0436364_1434657 3300037853 Bacteria 1038
79 Ga0436360_0277880 3300039438 Bacteria 1109
80 Ga0436361_0331793 3300039447 Bacteria 1980
81 Ga0436363_0359440 3300039450 Bacteria 4308
82 Ga0436362_0904943 3300039453 Unclassified 1197
83 Ga0451791_0060515 3300041451 Bacteria 822
84 Ga0451791_0592931 3300041451 Bacteria 2333
85 Ga0451793_0724565 3300041452 Bacteria 2847
86 Ga0451797_0818756 3300041453 Bacteria 2210
87 Ga0451802_0296305 3300041460 Bacteria 1351
88 Ga0451807_2157490 3300041486 Bacteria 1809
89 Ga0451833_0193256 3300041491 Bacteria 3745
90 Ga0451835_0109845 3300041492 Bacteria 6709
91 Ga0451837_0320845 3300041494 Bacteria 916
92 Ga0451837_1086665 3300041494 Bacteria 1965
93 Ga0451839_0222449 3300041496 Bacteria 2690
94 Ga0451841_0609258 3300041498 Bacteria 4696
95 Ga0451841_0874236 3300041498 Unclassified 1924
96 Ga0451845_0326146 3300041501 Bacteria 2956
97 Ga0451847_0151691 3300041503 Bacteria 3282
98 Ga0451849_0507688 3300041505 Bacteria 1329
99 Ga0451851_0101840 3300041507 Bacteria 3363
100 Ga0451851_0809650 3300041507 Bacteria 715
101 Ga0451843_0026892 3300041509 Bacteria 2337
102 Ga0451855_0203354 3300041511 Bacteria 2206
103 Ga0451853_0019065 3300041512 Bacteria 9159
104 Ga0451853_1246325 3300041512 Bacteria 993
105 Ga0451853_2594000 3300041512 Bacteria 1964
106 Ga0439432_017190 3300042006 Bacteria 2430
107 Ga0439449_0012206 3300042007 Bacteria 3230
108 Ga0439434_0084117 3300042435 Bacteria 1012
109 Ga0466966_0530961 3300044684 Bacteria 708
110 Ga0466963_0976496 3300044694 Bacteria 596
111 Ga0466964_0080827 3300044706 Bacteria 1395
112 Ga0466960_0065492 3300044901 Bacteria 1795
113 Ga0466959_0067439 3300045049 Bacteria 2594
114 Ga0466958_0126017 3300045836 Bacteria 1606
115 Ga0466967_0183341 3300045976 Bacteria 1975
116 Ga0495617_040775 3300046452 Bacteria 1552
117 Ga0495592_0682391 3300046454 Bacteria 619
118 Ga0495603_0523076 3300046455 Bacteria 679
119 Ga0495590_0362610 3300046457 Bacteria 552
120 Ga0495629_0563516 3300046459 Bacteria 764
121 Ga0495638_0008949 3300046460 Bacteria 7060
122 Ga0495638_0011462 3300046460 Bacteria 6108
123 Ga0495638_0025553 3300046460 Bacteria 3836
124 Ga0495651_0198222 3300046462 Bacteria 1407
125 Ga0495650_0017681 3300046471 Bacteria 3567
126 Ga0495650_0068675 3300046471 Bacteria 1397
127 Ga0495605_0151809 3300046474 Bacteria 1033
128 Ga0495585_0028786 3300046492 Bacteria 3165
129 Ga0495596_0036716 3300046500 Bacteria 1940
130 Ga0495607_0020545 3300046501 Bacteria 4172
131 Ga0495607_0025219 3300046501 Bacteria 3700
132 Ga0495606_0017625 3300046507 Bacteria 5390
133 Ga0495606_0499650 3300046507 Bacteria 614
134 Ga0495610_0054284 3300046512 Bacteria 1936
135 Ga0495610_0056945 3300046512 Bacteria 1877
136 Ga0495616_0325353 3300046513 Bacteria 645
137 Ga0495620_0016009 3300046515 Bacteria 3773
138 Ga0495620_0039686 3300046515 Bacteria 2078
139 Ga0495631_0299367 3300046518 Bacteria 684
140 Ga0495632_0010977 3300046519 Bacteria 5314
141 Ga0495643_0007926 3300046522 Bacteria 6778
142 Ga0495648_0009350 3300046524 Bacteria 7609
143 Ga0495652_0051517 3300046529 Bacteria 3515
144 Ga0495654_0015901 3300046530 Bacteria 3988
145 Ga0495654_0292099 3300046530 Bacteria 668
146 Ga0495640_0004122 3300046533 Bacteria 11633
147 Ga0495609_0069654 3300046538 Bacteria 1546
148 Ga0495609_0110559 3300046538 Bacteria 1186
149 Ga0495597_0018582 3300046542 Bacteria 3261
150 Ga0495633_0021072 3300046558 Bacteria 3265
151 Ga0495656_0029102 3300046615 Bacteria 2221
152 Ga0495656_0354451 3300046615 Bacteria 761
153 Ga0495668_0041903 3300046616 Bacteria 2549
154 Ga0495634_0090821 3300046642 Unclassified 1983
155 Ga0495625_0165727 3300046660 Bacteria 1477
156 Ga0495661_0051790 3300046665 Bacteria 2477
157 Ga0495661_0071955 3300046665 Bacteria 2019
158 Ga0495588_0202723 3300046674 Bacteria 1048
159 Ga0495657_0179900 3300046675 Bacteria 1298
160 Ga0495613_0693974 3300046689 Bacteria 670
161 Ga0495670_0032462 3300046691 Bacteria 2597
162 Ga0495670_0084380 3300046691 Bacteria 1621
163 Ga0495671_0092107 3300046692 Bacteria 1483
164 Ga0495671_0170725 3300046692 Bacteria 1057
165 Ga0495649_0081878 3300046694 Bacteria 1725
166 Ga0495589_0056468 3300046794 Bacteria 1933
167 Ga0495600_0128826 3300046809 Bacteria 1645
168 Ga0495660_0043830 3300046810 Bacteria 2464
169 Ga0495604_0021907 3300047317 Bacteria 5101
170 Ga0495676_0705654 3300047321 Bacteria 652
171 Ga0495683_0078734 3300047323 Bacteria 1610
172 Ga0495687_048849 3300047443 Bacteria 1812
173 Ga0495685_239117 3300047447 Bacteria 577
174 Ga0495681_0054732 3300047470 Bacteria 1863
175 Ga0495686_0027115 3300047472 Bacteria 3742
176 Ga0495686_0176758 3300047472 Bacteria 1239
177 Ga0495615_0047816 3300048090 Bacteria 1091
178 Ga0495626_0115074 3300048091 Bacteria 1161
179 Ga0496109_0531203 3300048912 Unclassified 1110
180 Ga0496117_0243282 3300048920 Bacteria 986
181 Ga0496118_0132028 3300048921 Bacteria 1601
182 Ga0496119_0256229 3300048922 Bacteria 880
183 Ga0495678_071604 3300049459 Bacteria 1269
184 Ga0501080_1039786 3300049742 Bacteria 709
185 nmdc:mga03683_545458_c1 3300050489 Bacteria 564
186 nmdc:mga07m45_87756_c1 3300050496 Bacteria 1780
187 Ga0500610_0320847 3300053079 Bacteria 672
188 Ga0495655_0182702 3300053083 Bacteria 677
189 Ga0500578_0016660 3300053086 Bacteria 4721
190 Ga0500578_0022037 3300053086 Bacteria 4090
191 Ga0500643_018908 3300053087 Bacteria 2278
192 Ga0500643_037809 3300053087 Bacteria 1435
193 Ga0500583_0006508 3300053092 Bacteria 4028
194 Ga0500583_0205398 3300053092 Bacteria 979
195 Ga0500651_0002281 3300053093 Bacteria 10062
196 Ga0500650_0253436 3300053098 Bacteria 789
197 Ga0500555_002832 3300053103 Bacteria 4979
198 Ga0500555_138770 3300053103 Bacteria 600
199 Ga0500569_000530 3300053109 Bacteria 6356
200 Ga0500569_041219 3300053109 Bacteria 1353
201 Ga0500572_022639 3300053111 Bacteria 1678
202 Ga0500594_0152900 3300053118 Bacteria 742
203 Ga0500595_035467 3300053119 Unclassified 1642
204 Ga0500642_0000022 3300053130 Bacteria 135196
205 Ga0500642_0039458 3300053130 Bacteria 2030
206 Ga0500655_038043 3300053133 Bacteria 939
207 Ga0500658_0000451 3300053134 Bacteria 17503
208 Ga0500659_0162574 3300053135 Bacteria 1103
209 Ga0500568_0036353 3300053139 Bacteria 2004
210 Ga0500577_0019174 3300053142 Bacteria 2214
211 Ga0500577_0045611 3300053142 Bacteria 1621
212 Ga0500577_0124868 3300053142 Bacteria 1074
213 Ga0500588_0057184 3300053146 Bacteria 1237
214 Ga0500604_0001385 3300053151 Bacteria 6750
215 Ga0500604_0105644 3300053151 Bacteria 931
216 Ga0500616_0059465 3300053153 Bacteria 1984
217 Ga0500622_0008774 3300053156 Bacteria 5630
218 Ga0500622_0075428 3300053156 Bacteria 1697
219 Ga0500627_0206111 3300053158 Bacteria 880
220 Ga0500627_0299253 3300053158 Bacteria 703
221 Ga0500633_0026667 3300053160 Bacteria 1821
222 Ga0500636_0003119 3300053177 Bacteria 9287
223 Ga0500609_007342 3300053731 Bacteria 1489
224 Ga0500609_018899 3300053731 Bacteria 939
225 Ga0500599_001471 3300053736 Bacteria 2713
226 Ga0466962_0032113 3300061719 Bacteria 2514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046665 Ga0495661_0071955 Ga0495661_0071955_780_1172 118
2 3300050489 nmdc:mga03683_545458_c1 nmdc:mga03683_545458_c1_10_366 118
3 iso_pu_bacteria 2513237084 2513571753 124
4 iso_pu_bacteria 2515154134 2515743867 124
5 iso_pu_bacteria 2517093000 2517099411 124
6 iso_pu_bacteria 2529292951 2530649967 124
7 iso_pu_bacteria 2582581283 2585168026 124
8 iso_pu_bacteria 2582581306 2585265338 124
9 iso_pu_bacteria 2585427528 2585539457 124
10 iso_pu_bacteria 2585427593 2585837411 124
11 iso_pu_bacteria 2585427633 2585995178 124
12 iso_pu_bacteria 2643221689 2644500203 124
13 iso_pu_bacteria 2724679232 2725948092 124
14 iso_pu_bacteria 2765235942 2766064814 124
15 iso_pu_bacteria 2791355267 2793368405 124
16 iso_pu_bacteria 2802429636 2806066306 124
17 iso_pu_bacteria 2841864319 2841869491 124
18 iso_pu_bacteria 2842110456 2842117321 124
19 iso_pu_bacteria 2842341865 2842346202 124
20 iso_pu_bacteria 2842363717 2842368026 124
21 iso_pu_bacteria 2857516855 2857523778 124
22 iso_pu_bacteria 2933586486 2933593419 124
23 iso_pu_bacteria 8005570704 8005576586 124
24 iso_pu_bacteria 8023680758 8023685801 124
25 iso_pu_bacteria 8056375014 8056376442 124
26 iso_pu_bacteria 2523231067 2523468917 125
27 iso_pu_bacteria 2738543031 2739351181 125
28 iso_pu_bacteria 2791355092 2792627512 125
29 iso_pu_bacteria 2844315083 2844319271 125
30 iso_pu_bacteria 2903727486 2903731111 125
31 iso_pu_bacteria 2906602504 2906607380 125
32 iso_pu_bacteria 2510065019 2510137702 126
33 iso_pu_bacteria 2510461076 2510893466 126
34 iso_pu_bacteria 2513237085 2513575744 126
35 iso_pu_bacteria 2513237162 2514019083 126
36 iso_pu_bacteria 2515154113 2515633406 126
37 iso_pu_bacteria 2515154114 2515641713 126
38 iso_pu_bacteria 2515154116 2515659015 126
39 iso_pu_bacteria 2516653085 2517081201 126
40 iso_pu_bacteria 2585427526 2585526293 126
41 iso_pu_bacteria 2838686498 2838688220 126
42 iso_pu_bacteria 2838729681 2838732399 126
43 iso_pu_bacteria 2838742623 2838745183 126
44 iso_pu_bacteria 2841851746 2841851960 126
45 iso_pu_bacteria 2842156927 2842158964 126
46 iso_pu_bacteria 2842163707 2842166396 126
47 iso_pu_bacteria 2842180545 2842182578 126
48 iso_pu_bacteria 2842229732 2842232941 126
49 iso_pu_bacteria 2842243621 2842247357 126
50 iso_pu_bacteria 2842257432 2842261552 126
51 iso_pu_bacteria 2842271015 2842272830 126
52 iso_pu_bacteria 2842304105 2842307726 126
53 iso_pu_bacteria 2844454524 2844461728 126
54 iso_pu_bacteria 2933570622 2933574177 126
55 iso_pu_bacteria 2935901341 2935906298 126
56 iso_pu_bacteria 8005307578 8005311800 126
57 iso_pu_bacteria 8005563573 8005563874 126
58 iso_pu_bacteria 8018163183 8018163986 126
59 3300005467 Ga0070706_100571523 Ga0070706_1005715232 127
60 3300013105 Ga0157369_10374645 Ga0157369_103746452 127
61 3300032004 Ga0307414_10492107 Ga0307414_104921071 127
62 3300044901 Ga0466960_0065492 Ga0466960_0065492_880_1269 127
63 3300046454 Ga0495592_0682391 Ga0495592_0682391_12_407 127
64 3300046455 Ga0495603_0523076 Ga0495603_0523076_33_428 127
65 3300046459 Ga0495629_0563516 Ga0495629_0563516_46_441 127
66 3300046462 Ga0495651_0198222 Ga0495651_0198222_975_1370 127
67 3300046529 Ga0495652_0051517 Ga0495652_0051517_3049_3444 127
68 3300046533 Ga0495640_0004122 Ga0495640_0004122_11153_11548 127
69 3300046642 Ga0495634_0090821 Ga0495634_0090821_1514_1909 127
70 3300046675 Ga0495657_0179900 Ga0495657_0179900_68_463 127
71 3300046689 Ga0495613_0693974 Ga0495613_0693974_192_587 127
72 3300046809 Ga0495600_0128826 Ga0495600_0128826_82_477 127
73 3300047317 Ga0495604_0021907 Ga0495604_0021907_61_456 127
74 3300047321 Ga0495676_0705654 Ga0495676_0705654_79_474 127
75 3300053151 Ga0500604_0001385 Ga0500604_0001385_6310_6693 127
76 iso_pu_bacteria 2885409591 2885417315 127
77 3300003320 rootH2_10068237 rootH2_100682374 128
78 3300003320 rootH2_10069274 rootH2_100692742 128
79 3300003322 rootL2_10160066 rootL2_101600662 128
80 3300003323 rootH1_10241296 rootH1_102412963 128
81 3300003354 JGI25160J50197_1001671 JGI25160J50197_100167112 128
82 3300003374 JGI25161J50226_1002537 JGI25161J50226_10025373 128
83 3300003763 Ga0055529_1008870 Ga0055529_10088702 128
84 3300003775 Ga0055524_1024692 Ga0055524_10246923 128
85 3300003790 Ga0055528_1001028 Ga0055528_10010289 128
86 3300003790 Ga0055528_1013882 Ga0055528_10138822 128
87 3300004625 Ga0055543_1000888 Ga0055543_100088817 128
88 3300005262 Ga0065165_1111600 Ga0065165_11116001 128
89 3300005328 Ga0070676_10150308 Ga0070676_101503082 128
90 3300005334 Ga0068869_100775959 Ga0068869_1007759592 128
91 3300005338 Ga0068868_100556609 Ga0068868_1005566092 128
92 3300005347 Ga0070668_100484931 Ga0070668_1004849312 128
93 3300005355 Ga0070671_101359819 Ga0070671_1013598191 128
94 3300005436 Ga0070713_100166570 Ga0070713_1001665702 128
95 3300005456 Ga0070678_101761248 Ga0070678_1017612481 128
96 3300005543 Ga0070672_100800522 Ga0070672_1008005221 128
97 3300005616 Ga0068852_100607539 Ga0068852_1006075392 128
98 3300005834 Ga0068851_10653933 Ga0068851_106539332 128
99 3300005841 Ga0068863_100679899 Ga0068863_1006798993 128
100 3300005842 Ga0068858_100421230 Ga0068858_1004212302 128
101 3300005844 Ga0068862_102020001 Ga0068862_1020200011 128
102 3300006048 Ga0075363_100132006 Ga0075363_1001320062 128
103 3300006178 Ga0075367_10809941 Ga0075367_108099411 128
104 3300006195 Ga0075366_10290323 Ga0075366_102903232 128
105 3300006353 Ga0075370_10078740 Ga0075370_100787402 128
106 3300006353 Ga0075370_10261149 Ga0075370_102611492 128
107 3300009101 Ga0105247_11101740 Ga0105247_111017401 128
108 3300009148 Ga0105243_11230425 Ga0105243_112304252 128
109 3300009174 Ga0105241_10029365 Ga0105241_100293653 128
110 3300009177 Ga0105248_10778895 Ga0105248_107788952 128
111 3300009553 Ga0105249_11092361 Ga0105249_110923611 128
112 3300013307 Ga0157372_10563911 Ga0157372_105639113 128
113 3300014325 Ga0163163_10249978 Ga0163163_102499784 128
114 3300014745 Ga0157377_11421358 Ga0157377_114213581 128
115 3300017792 Ga0163161_11632615 Ga0163161_116326151 128
116 3300021361 Ga0213872_10211941 Ga0213872_102119412 128
117 3300021441 Ga0213871_10325402 Ga0213871_103254022 128
118 3300025254 Ga0209148_1000428 Ga0209148_100042838 128
119 3300025258 Ga0209129_1009893 Ga0209129_10098932 128
120 3300025261 Ga0209233_1007473 Ga0209233_10074731 128
121 3300025272 Ga0209455_1002286 Ga0209455_10022862 128
122 3300025273 Ga0209673_1000020 Ga0209673_100002015 128
123 3300025273 Ga0209673_1010619 Ga0209673_10106196 128
124 3300025284 Ga0209130_1034416 Ga0209130_10344162 128
125 3300025294 Ga0209025_1067089 Ga0209025_10670892 128
126 3300025295 Ga0209564_1001600 Ga0209564_100160015 128
127 3300025295 Ga0209564_1011821 Ga0209564_10118211 128
128 3300025297 Ga0209758_1002506 Ga0209758_100250613 128
129 3300025299 Ga0209256_1001851 Ga0209256_10018519 128
130 3300025299 Ga0209256_1097313 Ga0209256_10973132 128
131 3300025302 Ga0207426_1000210 Ga0207426_100021041 128
132 3300025903 Ga0207680_11294567 Ga0207680_112945671 128
133 3300025907 Ga0207645_10209523 Ga0207645_102095232 128
134 3300025911 Ga0207654_10027050 Ga0207654_100270502 128
135 3300025928 Ga0207700_10926775 Ga0207700_109267751 128
136 3300025935 Ga0207709_10631241 Ga0207709_106312412 128
137 3300025937 Ga0207669_11650992 Ga0207669_116509921 128
138 3300025937 Ga0207669_11935346 Ga0207669_119353461 128
139 3300025940 Ga0207691_10627055 Ga0207691_106270553 128
140 3300025942 Ga0207689_10594118 Ga0207689_105941182 128
141 3300025961 Ga0207712_11621233 Ga0207712_116212332 128
142 3300025972 Ga0207668_10445265 Ga0207668_104452652 128
143 3300026035 Ga0207703_10742271 Ga0207703_107422711 128
144 3300026088 Ga0207641_10289439 Ga0207641_102894391 128
145 3300026142 Ga0207698_12169284 Ga0207698_121692841 128
146 3300028379 Ga0268266_10012737 Ga0268266_1001273710 128
147 3300028786 Ga0307517_10266360 Ga0307517_102663602 128
148 3300031456 Ga0307513_10039783 Ga0307513_100397832 128
149 3300031456 Ga0307513_10040653 Ga0307513_100406533 128
150 3300031730 Ga0307516_10514627 Ga0307516_105146271 128
151 3300037853 Ga0436364_1434657 Ga0436364_1434657_412_801 128
152 3300039438 Ga0436360_0277880 Ga0436360_0277880_12_404 128
153 3300039447 Ga0436361_0331793 Ga0436361_0331793_804_1196 128
154 3300039450 Ga0436363_0359440 Ga0436363_0359440_543_932 128
155 3300039453 Ga0436362_0904943 Ga0436362_0904943_54_443 128
156 3300041451 Ga0451791_0060515 Ga0451791_0060515_161_553 128
157 3300041451 Ga0451791_0592931 Ga0451791_0592931_846_1244 128
158 3300041452 Ga0451793_0724565 Ga0451793_0724565_1642_2040 128
159 3300041453 Ga0451797_0818756 Ga0451797_0818756_1576_1974 128
160 3300041460 Ga0451802_0296305 Ga0451802_0296305_70_468 128
161 3300041486 Ga0451807_2157490 Ga0451807_2157490_665_1063 128
162 3300041491 Ga0451833_0193256 Ga0451833_0193256_1620_2036 128
163 3300041492 Ga0451835_0109845 Ga0451835_0109845_5923_6339 128
164 3300041494 Ga0451837_0320845 Ga0451837_0320845_207_605 128
165 3300041494 Ga0451837_1086665 Ga0451837_1086665_354_770 128
166 3300041496 Ga0451839_0222449 Ga0451839_0222449_1079_1495 128
167 3300041498 Ga0451841_0609258 Ga0451841_0609258_354_770 128
168 3300041498 Ga0451841_0874236 Ga0451841_0874236_1344_1742 128
169 3300041501 Ga0451845_0326146 Ga0451845_0326146_456_872 128
170 3300041503 Ga0451847_0151691 Ga0451847_0151691_2254_2670 128
171 3300041505 Ga0451849_0507688 Ga0451849_0507688_271_687 128
172 3300041507 Ga0451851_0101840 Ga0451851_0101840_2251_2667 128
173 3300041507 Ga0451851_0809650 Ga0451851_0809650_96_488 128
174 3300041509 Ga0451843_0026892 Ga0451843_0026892_1568_1984 128
175 3300041511 Ga0451855_0203354 Ga0451855_0203354_1503_1919 128
176 3300041512 Ga0451853_0019065 Ga0451853_0019065_6649_7047 128
177 3300041512 Ga0451853_1246325 Ga0451853_1246325_228_620 128
178 3300041512 Ga0451853_2594000 Ga0451853_2594000_353_769 128
179 3300042006 Ga0439432_017190 Ga0439432_017190_1101_1508 128
180 3300042007 Ga0439449_0012206 Ga0439449_0012206_2657_3064 128
181 3300042435 Ga0439434_0084117 Ga0439434_0084117_225_632 128
182 3300044684 Ga0466966_0530961 Ga0466966_0530961_162_605 128
183 3300044694 Ga0466963_0976496 Ga0466963_0976496_117_518 128
184 3300044706 Ga0466964_0080827 Ga0466964_0080827_616_1017 128
185 3300045049 Ga0466959_0067439 Ga0466959_0067439_109_552 128
186 3300045836 Ga0466958_0126017 Ga0466958_0126017_828_1271 128
187 3300045976 Ga0466967_0183341 Ga0466967_0183341_1420_1821 128
188 3300046452 Ga0495617_040775 Ga0495617_040775_1033_1449 128
189 3300046457 Ga0495590_0362610 Ga0495590_0362610_145_537 128
190 3300046460 Ga0495638_0008949 Ga0495638_0008949_5127_5519 128
191 3300046460 Ga0495638_0011462 Ga0495638_0011462_3195_3584 128
192 3300046460 Ga0495638_0025553 Ga0495638_0025553_1174_1575 128
193 3300046471 Ga0495650_0017681 Ga0495650_0017681_2535_2927 128
194 3300046471 Ga0495650_0068675 Ga0495650_0068675_451_852 128
195 3300046474 Ga0495605_0151809 Ga0495605_0151809_251_643 128
196 3300046492 Ga0495585_0028786 Ga0495585_0028786_2173_2589 128
197 3300046500 Ga0495596_0036716 Ga0495596_0036716_1534_1926 128
198 3300046501 Ga0495607_0020545 Ga0495607_0020545_435_827 128
199 3300046501 Ga0495607_0025219 Ga0495607_0025219_2934_3350 128
200 3300046507 Ga0495606_0017625 Ga0495606_0017625_2892_3284 128
201 3300046507 Ga0495606_0499650 Ga0495606_0499650_39_455 128
202 3300046512 Ga0495610_0054284 Ga0495610_0054284_132_524 128
203 3300046512 Ga0495610_0056945 Ga0495610_0056945_42_434 128
204 3300046513 Ga0495616_0325353 Ga0495616_0325353_233_625 128
205 3300046515 Ga0495620_0016009 Ga0495620_0016009_2971_3363 128
206 3300046515 Ga0495620_0039686 Ga0495620_0039686_1546_1962 128
207 3300046518 Ga0495631_0299367 Ga0495631_0299367_166_582 128
208 3300046519 Ga0495632_0010977 Ga0495632_0010977_1156_1548 128
209 3300046522 Ga0495643_0007926 Ga0495643_0007926_1136_1528 128
210 3300046524 Ga0495648_0009350 Ga0495648_0009350_683_1099 128
211 3300046530 Ga0495654_0015901 Ga0495654_0015901_2956_3348 128
212 3300046530 Ga0495654_0292099 Ga0495654_0292099_247_648 128
213 3300046538 Ga0495609_0069654 Ga0495609_0069654_307_723 128
214 3300046538 Ga0495609_0110559 Ga0495609_0110559_35_427 128
215 3300046542 Ga0495597_0018582 Ga0495597_0018582_1039_1431 128
216 3300046558 Ga0495633_0021072 Ga0495633_0021072_650_1066 128
217 3300046615 Ga0495656_0029102 Ga0495656_0029102_356_772 128
218 3300046615 Ga0495656_0354451 Ga0495656_0354451_11_403 128
219 3300046616 Ga0495668_0041903 Ga0495668_0041903_111_527 128
220 3300046660 Ga0495625_0165727 Ga0495625_0165727_696_1112 128
221 3300046665 Ga0495661_0051790 Ga0495661_0051790_1738_2154 128
222 3300046674 Ga0495588_0202723 Ga0495588_0202723_55_471 128
223 3300046691 Ga0495670_0032462 Ga0495670_0032462_194_610 128
224 3300046691 Ga0495670_0084380 Ga0495670_0084380_245_637 128
225 3300046692 Ga0495671_0092107 Ga0495671_0092107_254_670 128
226 3300046692 Ga0495671_0170725 Ga0495671_0170725_153_545 128
227 3300046694 Ga0495649_0081878 Ga0495649_0081878_938_1330 128
228 3300046794 Ga0495589_0056468 Ga0495589_0056468_809_1201 128
229 3300046810 Ga0495660_0043830 Ga0495660_0043830_1223_1615 128
230 3300047323 Ga0495683_0078734 Ga0495683_0078734_830_1222 128
231 3300047443 Ga0495687_048849 Ga0495687_048849_902_1294 128
232 3300047447 Ga0495685_239117 Ga0495685_239117_39_455 128
233 3300047470 Ga0495681_0054732 Ga0495681_0054732_1165_1581 128
234 3300047472 Ga0495686_0027115 Ga0495686_0027115_542_934 128
235 3300047472 Ga0495686_0176758 Ga0495686_0176758_568_984 128
236 3300048090 Ga0495615_0047816 Ga0495615_0047816_156_572 128
237 3300048091 Ga0495626_0115074 Ga0495626_0115074_239_631 128
238 3300048912 Ga0496109_0531203 Ga0496109_0531203_185_583 128
239 3300048920 Ga0496117_0243282 Ga0496117_0243282_174_566 128
240 3300048921 Ga0496118_0132028 Ga0496118_0132028_862_1254 128
241 3300048922 Ga0496119_0256229 Ga0496119_0256229_343_735 128
242 3300049459 Ga0495678_071604 Ga0495678_071604_150_542 128
243 3300049742 Ga0501080_1039786 Ga0501080_1039786_201_587 128
244 3300050496 nmdc:mga07m45_87756_c1 nmdc:mga07m45_87756_c1_254_640 128
245 3300053079 Ga0500610_0320847 Ga0500610_0320847_114_515 128
246 3300053083 Ga0495655_0182702 Ga0495655_0182702_243_659 128
247 3300053086 Ga0500578_0016660 Ga0500578_0016660_1197_1589 128
248 3300053086 Ga0500578_0022037 Ga0500578_0022037_2761_3162 128
249 3300053087 Ga0500643_018908 Ga0500643_018908_1035_1430 128
250 3300053087 Ga0500643_037809 Ga0500643_037809_321_722 128
251 3300053092 Ga0500583_0006508 Ga0500583_0006508_813_1214 128
252 3300053092 Ga0500583_0205398 Ga0500583_0205398_185_574 128
253 3300053093 Ga0500651_0002281 Ga0500651_0002281_803_1204 128
254 3300053098 Ga0500650_0253436 Ga0500650_0253436_55_456 128
255 3300053103 Ga0500555_002832 Ga0500555_002832_2112_2513 128
256 3300053103 Ga0500555_138770 Ga0500555_138770_39_440 128
257 3300053109 Ga0500569_000530 Ga0500569_000530_1933_2334 128
258 3300053109 Ga0500569_041219 Ga0500569_041219_830_1222 128
259 3300053111 Ga0500572_022639 Ga0500572_022639_44_430 128
260 3300053118 Ga0500594_0152900 Ga0500594_0152900_90_506 128
261 3300053119 Ga0500595_035467 Ga0500595_035467_492_884 128
262 3300053130 Ga0500642_0000022 Ga0500642_0000022_80662_81060 128
263 3300053130 Ga0500642_0039458 Ga0500642_0039458_70_471 128
264 3300053133 Ga0500655_038043 Ga0500655_038043_516_917 128
265 3300053134 Ga0500658_0000451 Ga0500658_0000451_13998_14390 128
266 3300053135 Ga0500659_0162574 Ga0500659_0162574_580_972 128
267 3300053139 Ga0500568_0036353 Ga0500568_0036353_1389_1790 128
268 3300053142 Ga0500577_0019174 Ga0500577_0019174_1368_1769 128
269 3300053142 Ga0500577_0045611 Ga0500577_0045611_144_545 128
270 3300053142 Ga0500577_0124868 Ga0500577_0124868_110_502 128
271 3300053146 Ga0500588_0057184 Ga0500588_0057184_565_966 128
272 3300053151 Ga0500604_0105644 Ga0500604_0105644_53_454 128
273 3300053153 Ga0500616_0059465 Ga0500616_0059465_396_788 128
274 3300053156 Ga0500622_0008774 Ga0500622_0008774_24_425 128
275 3300053156 Ga0500622_0075428 Ga0500622_0075428_897_1283 128
276 3300053158 Ga0500627_0206111 Ga0500627_0206111_352_753 128
277 3300053158 Ga0500627_0299253 Ga0500627_0299253_23_424 128
278 3300053160 Ga0500633_0026667 Ga0500633_0026667_1040_1441 128
279 3300053177 Ga0500636_0003119 Ga0500636_0003119_507_893 128
280 3300053731 Ga0500609_007342 Ga0500609_007342_1036_1437 128
281 3300053731 Ga0500609_018899 Ga0500609_018899_371_763 128
282 3300053736 Ga0500599_001471 Ga0500599_001471_627_1028 128
283 3300061719 Ga0466962_0032113 Ga0466962_0032113_1221_1664 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

142

0.93

PF12681

Glyoxalase_2

Glyoxalase-like domain

25

147

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mym-assembly1.cif.gz_A-2 crystal structure of a glyoxalase/ bleomycin resistance protein/ dioxygenase from nocardioides 0.8736 1 127
2i7r-assembly1.cif.gz_B conserved domain protein 0.862 6 126
4mym-assembly1.cif.gz_A-2 crystal structure of a glyoxalase/ bleomycin resistance protein/ dioxygenase from nocardioides 0.8613 1 127
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8482 8 127
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8371 1 128
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9288 74 123 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8802 75 127 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8793 74 128 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8619 75 124 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.861 74 123 3.30.720.110
ID Description Score Start End GO Terms
AF-W9G447-F1-model_v4 Glyoxalase 0.9736 9 124
AF-A0A0T1WP78-F1-model_v4 Glyoxalase 0.9682 1 128
AF-A0A7V9C6M1-F1-model_v4 VOC family protein 0.9649 1 124
AF-C6CZK0-F1-model_v4 deleted 0.9648 3 127
AF-A0A7Z0QFW3-F1-model_v4 VOC family protein 0.9642 1 128

Feature Viewer

pLDDT pTM Quality
91.15 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map