F385391

General Info

Members Datasets Scaffolds Average Seq Length
283 198 275 218

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100000443|Ga0070671_10000044316
Length 241
Sequence MTTVNSGAAAPTAGAAKMVESLLDPTAAVLDEIVAAGEPWMGVVRQGQRLRIVDVEGNQSVGALFYSAATMEERYSASDTVRAQGNLYLTTGARLLSNEGNVMLQIVADTCGRHDTLGGACSAESNTVRYALEKRHMHSCRDNFLLALARADCGLGKRDLSSNINFFMNVPVTPGGQLTVTDGISAAGRYVEMRAEMDVIVLISNCPQLNNPCNAYNPTPVRLLVWDAPADREPVQPARGG

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
5 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
6 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
7 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
101 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
106 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
107 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
108 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
111 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
112 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
113 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
121 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
127 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
128 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
152 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
188 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
189 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
190 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
191 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
194 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
195 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
196 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
197 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
198 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.11
Metatranscriptomes 1.06
Isolates 2.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.07
Nodule 1.41
Rhizoplane 3.18
Rhizosphere 81.63
Stem 0
Stem Tuber 0
Unclassified 6.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10025645 3300003203 Bacteria 2286
2 Ga0055530_10004308 3300003791 Bacteria 7408
3 Ga0055540_1000013 3300003792 Bacteria 262274
4 Ga0065707_10083185 3300005295 Bacteria 10089
5 Ga0070690_100105927 3300005330 Bacteria 1870
6 Ga0070677_10003299 3300005333 Bacteria 5196
7 Ga0070669_100533094 3300005353 Bacteria 977
8 Ga0070675_100082810 3300005354 Bacteria 2677
9 Ga0070671_100000443 3300005355 Bacteria 28787
10 Ga0070674_100044342 3300005356 Bacteria 3031
11 Ga0070674_100268366 3300005356 Bacteria 1347
12 Ga0070673_100034356 3300005364 Bacteria 3836
13 Ga0070659_100824516 3300005366 Bacteria 808
14 Ga0070667_100004228 3300005367 Bacteria 12123
15 Ga0070700_100097234 3300005441 Bacteria 1933
16 Ga0068867_100001187 3300005459 Bacteria 17866
17 Ga0070707_100781801 3300005468 Bacteria 918
18 Ga0070699_100722884 3300005518 Bacteria 910
19 Ga0068853_100038994 3300005539 Bacteria 4050
20 Ga0068853_100164687 3300005539 Bacteria 2003
21 Ga0070672_100009078 3300005543 Bacteria 6838
22 Ga0070672_100018075 3300005543 Bacteria 5089
23 Ga0070686_100115885 3300005544 Bacteria 1833
24 Ga0070665_100176984 3300005548 Bacteria 2134
25 Ga0070665_100254475 3300005548 Bacteria 1757
26 Ga0068855_100332491 3300005563 Bacteria 1677
27 Ga0068859_100021277 3300005617 Bacteria 6508
28 Ga0068859_100481135 3300005617 Bacteria 1337
29 Ga0068864_100125743 3300005618 Bacteria 2297
30 Ga0068864_100855528 3300005618 Bacteria 896
31 Ga0068861_100108786 3300005719 Bacteria 2218
32 Ga0068870_10055574 3300005840 Bacteria 2109
33 Ga0068863_100005373 3300005841 Bacteria 12631
34 Ga0068863_100270068 3300005841 Bacteria 1646
35 Ga0068858_100120289 3300005842 Bacteria 2455
36 Ga0068860_100099934 3300005843 Bacteria 2767
37 Ga0068860_100253912 3300005843 Bacteria 1713
38 Ga0068862_100243550 3300005844 Bacteria 1636
39 Ga0081455_10000032 3300005937 Bacteria 146266
40 Ga0081539_10000007 3300005985 Bacteria 532790
41 Ga0075366_10052418 3300006195 Bacteria 2424
42 Ga0097621_100484059 3300006237 Bacteria 1119
43 Ga0068865_100047839 3300006881 Bacteria 2941
44 Ga0068865_100101054 3300006881 Bacteria 2111
45 Ga0075436_100129562 3300006914 Bacteria 1769
46 Ga0097620_100021279 3300006931 Bacteria 6508
47 Ga0097620_100120303 3300006931 Bacteria 2692
48 Ga0097620_100481127 3300006931 Bacteria 1337
49 Ga0099794_10003712 3300007265 Bacteria 5877
50 Ga0105240_10002720 3300009093 Bacteria 28041
51 Ga0111539_10169745 3300009094 Bacteria 2549
52 Ga0111539_11265748 3300009094 Bacteria 856
53 Ga0105245_10700483 3300009098 Bacteria 1046
54 Ga0105247_10007171 3300009101 Bacteria 6841
55 Ga0105247_10036594 3300009101 Bacteria 2992
56 Ga0114129_11357488 3300009147 Bacteria 879
57 Ga0105243_10003213 3300009148 Bacteria 13372
58 Ga0105248_10067308 3300009177 Bacteria 4021
59 Ga0105248_10600597 3300009177 Bacteria 1242
60 Ga0105238_10000544 3300009551 Bacteria 39382
61 Ga0105238_10224246 3300009551 Bacteria 1856
62 Ga0105249_10009196 3300009553 Bacteria 8642
63 Ga0105239_10148325 3300010375 Bacteria 2617
64 Ga0105239_10482706 3300010375 Bacteria 1408
65 Ga0105246_10202554 3300011119 Bacteria 1544
66 Ga0157373_10168267 3300013100 Bacteria 1542
67 Ga0157373_10448207 3300013100 Bacteria 929
68 Ga0163162_10010572 3300013306 Bacteria 8976
69 Ga0157375_10031755 3300013308 Bacteria 4999
70 Ga0163163_10077495 3300014325 Bacteria 3319
71 Ga0163163_10265951 3300014325 Bacteria 1766
72 Ga0157380_10000996 3300014326 Bacteria 18001
73 Ga0157377_10000440 3300014745 Bacteria 17934
74 Ga0157379_10102942 3300014968 Bacteria 2562
75 Ga0163161_10178001 3300017792 Bacteria 1629
76 Ga0209050_1000567 3300025298 Bacteria 60093
77 Ga0209051_1000022 3300025303 Bacteria 474879
78 Ga0209257_1000030 3300025304 Bacteria 689812
79 Ga0207682_10000480 3300025893 Bacteria 18512
80 Ga0207642_10426016 3300025899 Bacteria 799
81 Ga0207710_10004066 3300025900 Bacteria 6434
82 Ga0207710_10056208 3300025900 Bacteria 1775
83 Ga0207643_10004036 3300025908 Bacteria 7901
84 Ga0207695_10053723 3300025913 Bacteria 4211
85 Ga0207695_10202993 3300025913 Bacteria 1896
86 Ga0207695_10317761 3300025913 Bacteria 1447
87 Ga0207662_10298757 3300025918 Bacteria 1070
88 Ga0207657_10087295 3300025919 Bacteria 2610
89 Ga0207681_10103127 3300025923 Bacteria 2061
90 Ga0207694_10000709 3300025924 Bacteria 29966
91 Ga0207659_10228920 3300025926 Bacteria 1498
92 Ga0207659_10271674 3300025926 Bacteria 1383
93 Ga0207644_10016867 3300025931 Bacteria 4920
94 Ga0207709_10002374 3300025935 Bacteria 11875
95 Ga0207704_10097183 3300025938 Bacteria 1952
96 Ga0207665_10000312 3300025939 Bacteria 33656
97 Ga0207691_10004266 3300025940 Bacteria 13882
98 Ga0207691_10005404 3300025940 Bacteria 12330
99 Ga0207711_10147148 3300025941 Bacteria 2123
100 Ga0207711_10267324 3300025941 Bacteria 1573
101 Ga0207711_10301396 3300025941 Bacteria 1478
102 Ga0207667_10933590 3300025949 Bacteria 858
103 Ga0207651_10044884 3300025960 Bacteria 2961
104 Ga0207658_10221934 3300025986 Bacteria 1590
105 Ga0207658_10903426 3300025986 Bacteria 804
106 Ga0207703_10001917 3300026035 Bacteria 18430
107 Ga0207639_10095910 3300026041 Bacteria 2385
108 Ga0207678_10061114 3300026067 Bacteria 3240
109 Ga0207641_10128585 3300026088 Bacteria 2271
110 Ga0207648_10001627 3300026089 Bacteria 24609
111 Ga0207648_10055641 3300026089 Bacteria 3453
112 Ga0207674_10439836 3300026116 Bacteria 1260
113 Ga0207675_100102529 3300026118 Bacteria 2696
114 Ga0209588_1048168 3300027671 Bacteria 1379
115 Ga0268266_10077202 3300028379 Bacteria 2895
116 Ga0268266_10086189 3300028379 Bacteria 2745
117 Ga0268265_10033764 3300028380 Bacteria 3723
118 Ga0268265_10342506 3300028380 Bacteria 1362
119 Ga0268264_10120788 3300028381 Bacteria 2309
120 Ga0307515_10009286 3300028794 Bacteria 19029
121 Ga0307515_10149443 3300028794 Bacteria 2451
122 Ga0265338_10060628 3300028800 Bacteria 3322
123 Ga0307511_10000450 3300030521 Bacteria 44241
124 Ga0307511_10026705 3300030521 Bacteria 5290
125 Ga0265760_10116424 3300031090 Bacteria 855
126 Ga0265327_10001627 3300031251 Bacteria 27097
127 Ga0307509_10000084 3300031507 Bacteria 131262
128 Ga0307509_10006230 3300031507 Bacteria 16137
129 Ga0307509_10148005 3300031507 Bacteria 2270
130 Ga0307509_10254946 3300031507 Bacteria 1535
131 Ga0307508_10147849 3300031616 Bacteria 1954
132 Ga0316579_10031140 3300031691 Bacteria 2440
133 Ga0316579_10031674 3300031691 Bacteria 2422
134 Ga0316576_10166556 3300031727 Bacteria 1663
135 Ga0316578_10090094 3300031728 Bacteria 1831
136 Ga0316578_10108891 3300031728 Bacteria 1663
137 Ga0316577_10022468 3300031733 Bacteria 3502
138 Ga0316577_10033369 3300031733 Bacteria 2875
139 Ga0307409_100569574 3300031995 Bacteria 1115
140 Ga0316583_10059716 3300032133 Bacteria 1337
141 Ga0316585_10006717 3300032137 Bacteria 3293
142 Ga0316580_10012937 3300032139 Bacteria 2542
143 Ga0316592_1004068 3300033524 Bacteria 2692
144 Ga0316596_1001616 3300033541 Bacteria 4620
145 Ga0373952_0087788 3300035092 Bacteria 803
146 Ga0373936_0003187 3300035113 Bacteria 6148
147 Ga0373936_0053775 3300035113 Bacteria 1633
148 Ga0373936_0188591 3300035113 Bacteria 907
149 Ga0316574_0002666 3300035398 Bacteria 9014
150 Ga0316574_0008822 3300035398 Bacteria 5618
151 Ga0316574_0018324 3300035398 Bacteria 4113
152 Ga0316574_0047237 3300035398 Bacteria 2671
153 Ga0373933_0071655 3300035724 Bacteria 2110
154 Ga0373937_0040810 3300036401 Bacteria 4231
155 Ga0316582_0053743 3300036647 Bacteria 2563
156 Ga0316582_0102571 3300036647 Bacteria 1896
157 Ga0316582_0202318 3300036647 Bacteria 1355
158 Ga0316582_0383114 3300036647 Bacteria 968
159 Ga0316584_0021083 3300036712 Bacteria 4731
160 Ga0316584_0042693 3300036712 Bacteria 3380
161 Ga0316584_0137509 3300036712 Bacteria 1823
162 Ga0373925_0282622 3300037068 Bacteria 1337
163 Ga0316581_0019802 3300037588 Bacteria 1965
164 Ga0395901_0281082 3300038443 Bacteria 1729
165 Ga0436361_0531081 3300039447 Bacteria 1846
166 Ga0451798_0168380 3300041458 Bacteria 1565
167 Ga0451804_0768091 3300041463 Bacteria 1206
168 Ga0451807_1696238 3300041486 Bacteria 1476
169 Ga0451807_2593976 3300041486 Bacteria 1144
170 Ga0451853_0184284 3300041512 Bacteria 1669
171 Ga0451853_1730347 3300041512 Bacteria 1287
172 Ga0439432_062065 3300042006 Bacteria 1151
173 Ga0451577_0015039 3300042876 Bacteria 7199
174 Ga0466969_0004100 3300044656 Bacteria 7733
175 Ga0466969_0016208 3300044656 Bacteria 3903
176 Ga0453683_0010769 3300044673 Bacteria 6054
177 Ga0466966_0013592 3300044684 Bacteria 5385
178 Ga0466961_0372389 3300044693 Bacteria 868
179 Ga0453684_0019449 3300044712 Bacteria 10340
180 Ga0453684_0030569 3300044712 Bacteria 7604
181 Ga0453684_0106964 3300044712 Bacteria 3407
182 Ga0466971_0031996 3300044719 Bacteria 2357
183 Ga0466970_0309092 3300044765 Bacteria 892
184 Ga0466959_0009093 3300045049 Bacteria 7052
185 Ga0466959_0025665 3300045049 Bacteria 4370
186 Ga0451576_0005997 3300045051 Bacteria 15025
187 Ga0495591_066271 3300046458 Bacteria 948
188 Ga0495638_0007478 3300046460 Bacteria 7829
189 Ga0495638_0129107 3300046460 Bacteria 1487
190 Ga0495620_0080306 3300046515 Bacteria 1320
191 Ga0495644_0203952 3300046523 Bacteria 763
192 Ga0495667_0027657 3300046559 Bacteria 3819
193 Ga0495668_0235708 3300046616 Bacteria 1002
194 Ga0495611_0210775 3300046648 Bacteria 905
195 Ga0495625_0012846 3300046660 Bacteria 6770
196 Ga0495669_0174310 3300046684 Bacteria 1024
197 Ga0495680_0147439 3300047322 Bacteria 1718
198 Ga0495680_0182124 3300047322 Bacteria 1516
199 Ga0495687_052006 3300047443 Bacteria 1735
200 Ga0495687_101690 3300047443 Bacteria 1077
201 Ga0495615_0027238 3300048090 Bacteria 1340
202 Ga0496102_0003151 3300048905 Bacteria 13984
203 Ga0496102_0253980 3300048905 Bacteria 1657
204 Ga0496108_0021331 3300048911 Bacteria 5324
205 Ga0496108_0182096 3300048911 Bacteria 1820
206 Ga0496112_0221633 3300048915 Bacteria 1847
207 Ga0496119_0208098 3300048922 Bacteria 1008
208 Ga0496121_0002531 3300048924 Bacteria 27699
209 Ga0496121_0051795 3300048924 Bacteria 3454
210 Ga0496121_0074341 3300048924 Bacteria 2719
211 Ga0496124_0000079 3300048927 Bacteria 212057
212 Ga0496125_0014435 3300048928 Bacteria 7691
213 Ga0496125_0097927 3300048928 Bacteria 2171
214 Ga0501031_0019959 3300049568 Bacteria 4369
215 Ga0501032_0025219 3300049569 Bacteria 4100
216 Ga0501032_0027818 3300049569 Bacteria 3885
217 Ga0501033_0003705 3300049570 Bacteria 12433
218 Ga0501033_0023094 3300049570 Bacteria 4689
219 Ga0501033_0047956 3300049570 Bacteria 3175
220 Ga0501034_0010173 3300049571 Bacteria 9814
221 Ga0501034_0040400 3300049571 Bacteria 4722
222 Ga0501036_0053871 3300049572 Bacteria 3405
223 Ga0501037_0006205 3300049573 Bacteria 8742
224 Ga0501037_0085835 3300049573 Bacteria 2279
225 Ga0501038_0083681 3300049574 Bacteria 2685
226 Ga0501038_0129816 3300049574 Bacteria 2070
227 Ga0501038_0147166 3300049574 Bacteria 1922
228 Ga0501038_0183236 3300049574 Bacteria 1688
229 Ga0501038_0389422 3300049574 Bacteria 1080
230 Ga0501038_0443947 3300049574 Bacteria 998
231 Ga0501039_0002030 3300049575 Bacteria 14993
232 Ga0501040_0003041 3300049576 Bacteria 10876
233 Ga0501043_0034319 3300049579 Bacteria 3990
234 Ga0501043_0080310 3300049579 Bacteria 2562
235 Ga0501043_0149113 3300049579 Bacteria 1830
236 Ga0501043_0259349 3300049579 Bacteria 1337
237 Ga0501046_0017429 3300049580 Bacteria 5994
238 Ga0501046_0127152 3300049580 Bacteria 1935
239 Ga0501046_0413141 3300049580 Bacteria 973
240 Ga0501047_0089463 3300049581 Bacteria 2956
241 Ga0501048_0017880 3300049582 Bacteria 5215
242 Ga0501067_0166858 3300049583 Bacteria 1226
243 Ga0501068_0098141 3300049584 Bacteria 1813
244 Ga0501070_0368577 3300049586 Bacteria 1164
245 Ga0501073_0210732 3300049589 Bacteria 1343
246 Ga0501074_0068538 3300049590 Bacteria 2550
247 Ga0501080_0787714 3300049742 Bacteria 834
248 Ga0501083_0167825 3300049744 Bacteria 1435
249 Ga0501035_0004547 3300049822 Bacteria 13165
250 Ga0501035_0034245 3300049822 Bacteria 4616
251 Ga0501035_0036093 3300049822 Bacteria 4481
252 Ga0501035_0080880 3300049822 Bacteria 2868
253 Ga0501044_0035098 3300049823 Bacteria 5253
254 Ga0501044_0084409 3300049823 Bacteria 3210
255 Ga0501044_0087273 3300049823 Bacteria 3151
256 Ga0501044_0263190 3300049823 Bacteria 1662
257 Ga0501044_0773999 3300049823 Bacteria 840
258 Ga0501045_0004056 3300049824 Bacteria 10103
259 nmdc:mga0k408_23194_c1 3300050493 Bacteria 3498
260 nmdc:mga07m45_276966_c1 3300050496 Bacteria 976
261 nmdc:mga08y16_207148_c1 3300050511 Bacteria 2031
262 nmdc:mga08y16_384507_c1 3300050511 Bacteria 1438
263 nmdc:mga08x19_52367_c1 3300050514 Bacteria 2625
264 Ga0500583_0128632 3300053092 Bacteria 1255
265 Ga0500651_0278808 3300053093 Bacteria 965
266 Ga0500641_0053763 3300053096 Bacteria 1663
267 Ga0500595_018133 3300053119 Bacteria 2580
268 Ga0500658_0028634 3300053134 Bacteria 2163
269 Ga0500616_0003475 3300053153 Bacteria 12008
270 Ga0500622_0041152 3300053156 Bacteria 2405
271 Ga0500630_098039 3300053159 Bacteria 1341
272 Ga0500637_0004830 3300053178 Bacteria 6458
273 Ga0500637_0009004 3300053178 Bacteria 5063
274 Ga0500656_016844 3300053732 Bacteria 869
275 Ga0500552_028149 3300053733 Bacteria 849

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049574 Ga0501038_0183236 Ga0501038_0183236_428_994 184
2 3300049583 Ga0501067_0166858 Ga0501067_0166858_638_1204 184
3 3300037068 Ga0373925_0282622 Ga0373925_0282622_706_1311 189
4 3300048090 Ga0495615_0027238 Ga0495615_0027238_23_592 189
5 3300005841 Ga0068863_100270068 Ga0068863_1002700682 197
6 3300049574 Ga0501038_0147166 Ga0501038_0147166_1288_1896 198
7 3300049824 Ga0501045_0004056 Ga0501045_0004056_9067_9678 199
8 3300049574 Ga0501038_0083681 Ga0501038_0083681_2039_2659 200
9 3300009098 Ga0105245_10700483 Ga0105245_107004832 201
10 3300026116 Ga0207674_10439836 Ga0207674_104398362 201
11 3300041463 Ga0451804_0768091 Ga0451804_0768091_250_873 201
12 3300041486 Ga0451807_2593976 Ga0451807_2593976_480_1103 201
13 3300046559 Ga0495667_0027657 Ga0495667_0027657_3185_3796 201
14 3300050511 nmdc:mga08y16_207148_c1 nmdc:mga08y16_207148_c1_1117_1722 201
15 3300028794 Ga0307515_10149443 Ga0307515_101494431 202
16 3300030521 Ga0307511_10026705 Ga0307511_100267052 202
17 3300053159 Ga0500630_098039 Ga0500630_098039_537_1169 202
18 3300005333 Ga0070677_10003299 Ga0070677_100032993 203
19 3300005354 Ga0070675_100082810 Ga0070675_1000828103 203
20 3300005356 Ga0070674_100044342 Ga0070674_1000443422 203
21 3300005364 Ga0070673_100034356 Ga0070673_1000343562 203
22 3300005441 Ga0070700_100097234 Ga0070700_1000972342 203
23 3300005543 Ga0070672_100018075 Ga0070672_1000180752 203
24 3300005548 Ga0070665_100254475 Ga0070665_1002544752 203
25 3300005617 Ga0068859_100481135 Ga0068859_1004811352 203
26 3300005618 Ga0068864_100125743 Ga0068864_1001257432 203
27 3300005840 Ga0068870_10055574 Ga0068870_100555742 203
28 3300006881 Ga0068865_100101054 Ga0068865_1001010542 203
29 3300006931 Ga0097620_100481127 Ga0097620_1004811272 203
30 3300009094 Ga0111539_10169745 Ga0111539_101697453 203
31 3300025893 Ga0207682_10000480 Ga0207682_1000048011 203
32 3300025908 Ga0207643_10004036 Ga0207643_100040362 203
33 3300025918 Ga0207662_10298757 Ga0207662_102987571 203
34 3300025923 Ga0207681_10103127 Ga0207681_101031272 203
35 3300025940 Ga0207691_10004266 Ga0207691_100042664 203
36 3300025960 Ga0207651_10044884 Ga0207651_100448842 203
37 3300026089 Ga0207648_10055641 Ga0207648_100556411 203
38 3300041512 Ga0451853_1730347 Ga0451853_1730347_94_708 203
39 3300046458 Ga0495591_066271 Ga0495591_066271_228_842 203
40 3300046460 Ga0495638_0129107 Ga0495638_0129107_460_1071 203
41 3300046515 Ga0495620_0080306 Ga0495620_0080306_186_797 203
42 3300046523 Ga0495644_0203952 Ga0495644_0203952_12_626 203
43 3300050511 nmdc:mga08y16_384507_c1 nmdc:mga08y16_384507_c1_411_1025 203
44 3300031507 Ga0307509_10148005 Ga0307509_101480053 205
45 3300005356 Ga0070674_100268366 Ga0070674_1002683662 206
46 3300017792 Ga0163161_10178001 Ga0163161_101780012 206
47 3300025899 Ga0207642_10426016 Ga0207642_104260162 206
48 3300025926 Ga0207659_10228920 Ga0207659_102289202 206
49 3300025941 Ga0207711_10301396 Ga0207711_103013962 206
50 3300026067 Ga0207678_10061114 Ga0207678_100611143 206
51 3300014968 Ga0157379_10102942 Ga0157379_101029422 207
52 3300046616 Ga0495668_0235708 Ga0495668_0235708_109_753 207
53 3300047443 Ga0495687_052006 Ga0495687_052006_834_1478 207
54 3300005539 Ga0068853_100038994 Ga0068853_1000389942 208
55 3300026041 Ga0207639_10095910 Ga0207639_100959102 208
56 3300031090 Ga0265760_10116424 Ga0265760_101164242 208
57 3300035113 Ga0373936_0188591 Ga0373936_0188591_207_845 208
58 3300041486 Ga0451807_1696238 Ga0451807_1696238_733_1359 208
59 3300041512 Ga0451853_0184284 Ga0451853_0184284_383_1009 208
60 iso_pu_bacteria 2501025502 2501085128 209
61 iso_pu_bacteria 2510917013 2511090556 209
62 iso_pu_bacteria 2513237082 2513552546 209
63 iso_pu_bacteria 2513237083 2513560718 209
64 iso_pu_bacteria 2600255067 2600811224 209
65 iso_pu_bacteria 2857357740 2857365235 209
66 iso_pu_bacteria 8003955200 8003958324 209
67 3300005295 Ga0065707_10083185 Ga0065707_100831853 210
68 3300009101 Ga0105247_10036594 Ga0105247_100365942 210
69 3300014326 Ga0157380_10000996 Ga0157380_100009964 210
70 3300025900 Ga0207710_10056208 Ga0207710_100562082 210
71 3300025938 Ga0207704_10097183 Ga0207704_100971833 210
72 3300035113 Ga0373936_0053775 Ga0373936_0053775_840_1493 210
73 3300046460 Ga0495638_0007478 Ga0495638_0007478_1719_2363 210
74 3300046660 Ga0495625_0012846 Ga0495625_0012846_759_1403 210
75 3300048924 Ga0496121_0074341 Ga0496121_0074341_947_1591 210
76 3300053178 Ga0500637_0004830 Ga0500637_0004830_5128_5781 210
77 3300005353 Ga0070669_100533094 Ga0070669_1005330941 211
78 3300005543 Ga0070672_100009078 Ga0070672_1000090782 211
79 3300006195 Ga0075366_10052418 Ga0075366_100524183 211
80 3300006881 Ga0068865_100047839 Ga0068865_1000478392 211
81 3300009177 Ga0105248_10600597 Ga0105248_106005972 211
82 3300013308 Ga0157375_10031755 Ga0157375_100317556 211
83 3300025940 Ga0207691_10005404 Ga0207691_100054049 211
84 3300025941 Ga0207711_10147148 Ga0207711_101471482 211
85 3300028794 Ga0307515_10009286 Ga0307515_100092862 211
86 3300028800 Ga0265338_10060628 Ga0265338_100606282 211
87 3300031691 Ga0316579_10031674 Ga0316579_100316743 211
88 3300031728 Ga0316578_10090094 Ga0316578_100900942 211
89 3300031733 Ga0316577_10022468 Ga0316577_100224682 211
90 3300032133 Ga0316583_10059716 Ga0316583_100597162 211
91 3300032139 Ga0316580_10012937 Ga0316580_100129373 211
92 3300035398 Ga0316574_0008822 Ga0316574_0008822_2726_3373 211
93 3300035398 Ga0316574_0047237 Ga0316574_0047237_1471_2118 211
94 3300044712 Ga0453684_0030569 Ga0453684_0030569_2302_2940 211
95 3300047443 Ga0495687_101690 Ga0495687_101690_16_672 211
96 3300048905 Ga0496102_0003151 Ga0496102_0003151_10533_11171 211
97 3300048924 Ga0496121_0051795 Ga0496121_0051795_1045_1695 211
98 3300048927 Ga0496124_0000079 Ga0496124_0000079_16983_17633 211
99 3300048928 Ga0496125_0014435 Ga0496125_0014435_5193_5843 211
100 3300049571 Ga0501034_0010173 Ga0501034_0010173_4155_4799 211
101 3300049590 Ga0501074_0068538 Ga0501074_0068538_942_1586 211
102 3300050493 nmdc:mga0k408_23194_c1 nmdc:mga0k408_23194_c1_2125_2778 211
103 3300050496 nmdc:mga07m45_276966_c1 nmdc:mga07m45_276966_c1_35_688 211
104 iso_pu_bacteria 2508501042 2508693015 211
105 3300003791 Ga0055530_10004308 Ga0055530_100043082 212
106 3300003792 Ga0055540_1000013 Ga0055540_1000013110 212
107 3300005366 Ga0070659_100824516 Ga0070659_1008245161 212
108 3300005468 Ga0070707_100781801 Ga0070707_1007818012 212
109 3300005518 Ga0070699_100722884 Ga0070699_1007228841 212
110 3300005548 Ga0070665_100176984 Ga0070665_1001769842 212
111 3300005563 Ga0068855_100332491 Ga0068855_1003324912 212
112 3300005843 Ga0068860_100253912 Ga0068860_1002539122 212
113 3300009093 Ga0105240_10002720 Ga0105240_1000272025 212
114 3300009551 Ga0105238_10000544 Ga0105238_1000054435 212
115 3300009551 Ga0105238_10224246 Ga0105238_102242462 212
116 3300010375 Ga0105239_10148325 Ga0105239_101483252 212
117 3300010375 Ga0105239_10482706 Ga0105239_104827061 212
118 3300013100 Ga0157373_10448207 Ga0157373_104482071 212
119 3300014325 Ga0163163_10265951 Ga0163163_102659512 212
120 3300025298 Ga0209050_1000567 Ga0209050_100056722 212
121 3300025303 Ga0209051_1000022 Ga0209051_1000022157 212
122 3300025304 Ga0209257_1000030 Ga0209257_1000030355 212
123 3300025913 Ga0207695_10053723 Ga0207695_100537232 212
124 3300025913 Ga0207695_10202993 Ga0207695_102029932 212
125 3300025913 Ga0207695_10317761 Ga0207695_103177612 212
126 3300025924 Ga0207694_10000709 Ga0207694_1000070911 212
127 3300025949 Ga0207667_10933590 Ga0207667_109335902 212
128 3300025986 Ga0207658_10903426 Ga0207658_109034261 212
129 3300028379 Ga0268266_10086189 Ga0268266_100861892 212
130 3300028381 Ga0268264_10120788 Ga0268264_101207882 212
131 3300031251 Ga0265327_10001627 Ga0265327_1000162713 212
132 3300031691 Ga0316579_10031140 Ga0316579_100311403 212
133 3300031727 Ga0316576_10166556 Ga0316576_101665562 212
134 3300031728 Ga0316578_10108891 Ga0316578_101088912 212
135 3300031733 Ga0316577_10033369 Ga0316577_100333692 212
136 3300031995 Ga0307409_100569574 Ga0307409_1005695742 212
137 3300032137 Ga0316585_10006717 Ga0316585_100067172 212
138 3300035398 Ga0316574_0018324 Ga0316574_0018324_2950_3597 212
139 3300036647 Ga0316582_0053743 Ga0316582_0053743_1476_2123 212
140 3300036647 Ga0316582_0102571 Ga0316582_0102571_187_834 212
141 3300036647 Ga0316582_0383114 Ga0316582_0383114_209_856 212
142 3300036712 Ga0316584_0021083 Ga0316584_0021083_1322_1969 212
143 3300036712 Ga0316584_0042693 Ga0316584_0042693_1867_2514 212
144 3300037588 Ga0316581_0019802 Ga0316581_0019802_927_1574 212
145 3300038443 Ga0395901_0281082 Ga0395901_0281082_402_1046 212
146 3300039447 Ga0436361_0531081 Ga0436361_0531081_341_994 212
147 3300046648 Ga0495611_0210775 Ga0495611_0210775_228_887 212
148 3300047322 Ga0495680_0147439 Ga0495680_0147439_880_1527 212
149 3300049569 Ga0501032_0025219 Ga0501032_0025219_2427_3086 212
150 3300049570 Ga0501033_0023094 Ga0501033_0023094_3103_3762 212
151 3300049570 Ga0501033_0047956 Ga0501033_0047956_966_1625 212
152 3300049573 Ga0501037_0006205 Ga0501037_0006205_7607_8266 212
153 3300049573 Ga0501037_0085835 Ga0501037_0085835_561_1220 212
154 3300049574 Ga0501038_0129816 Ga0501038_0129816_252_911 212
155 3300049574 Ga0501038_0443947 Ga0501038_0443947_286_945 212
156 3300049576 Ga0501040_0003041 Ga0501040_0003041_9810_10469 212
157 3300049579 Ga0501043_0034319 Ga0501043_0034319_613_1272 212
158 3300049579 Ga0501043_0080310 Ga0501043_0080310_1020_1679 212
159 3300049579 Ga0501043_0149113 Ga0501043_0149113_146_805 212
160 3300049579 Ga0501043_0259349 Ga0501043_0259349_350_1009 212
161 3300049580 Ga0501046_0017429 Ga0501046_0017429_2694_3353 212
162 3300049580 Ga0501046_0413141 Ga0501046_0413141_73_732 212
163 3300049581 Ga0501047_0089463 Ga0501047_0089463_835_1494 212
164 3300049582 Ga0501048_0017880 Ga0501048_0017880_329_988 212
165 3300049584 Ga0501068_0098141 Ga0501068_0098141_390_1049 212
166 3300049586 Ga0501070_0368577 Ga0501070_0368577_302_961 212
167 3300049589 Ga0501073_0210732 Ga0501073_0210732_661_1320 212
168 3300049742 Ga0501080_0787714 Ga0501080_0787714_35_694 212
169 3300049822 Ga0501035_0036093 Ga0501035_0036093_1295_1954 212
170 3300049822 Ga0501035_0080880 Ga0501035_0080880_1310_1969 212
171 3300049823 Ga0501044_0035098 Ga0501044_0035098_1757_2416 212
172 3300049823 Ga0501044_0084409 Ga0501044_0084409_2452_3111 212
173 3300049823 Ga0501044_0087273 Ga0501044_0087273_1329_1988 212
174 3300049823 Ga0501044_0263190 Ga0501044_0263190_259_918 212
175 3300049823 Ga0501044_0773999 Ga0501044_0773999_143_802 212
176 3300053119 Ga0500595_018133 Ga0500595_018133_1272_1916 212
177 3300005459 Ga0068867_100001187 Ga0068867_10000118710 213
178 3300009147 Ga0114129_11357488 Ga0114129_113574882 213
179 3300009148 Ga0105243_10003213 Ga0105243_100032134 213
180 3300025926 Ga0207659_10271674 Ga0207659_102716741 213
181 3300025935 Ga0207709_10002374 Ga0207709_100023748 213
182 3300026089 Ga0207648_10001627 Ga0207648_100016273 213
183 3300031507 Ga0307509_10000084 Ga0307509_1000008447 213
184 3300031507 Ga0307509_10006230 Ga0307509_100062304 213
185 3300033524 Ga0316592_1004068 Ga0316592_10040682 213
186 3300033541 Ga0316596_1001616 Ga0316596_10016166 213
187 3300035092 Ga0373952_0087788 Ga0373952_0087788_28_699 213
188 3300035398 Ga0316574_0002666 Ga0316574_0002666_1516_2166 213
189 3300035724 Ga0373933_0071655 Ga0373933_0071655_616_1266 213
190 3300036401 Ga0373937_0040810 Ga0373937_0040810_1067_1717 213
191 3300036647 Ga0316582_0202318 Ga0316582_0202318_404_1054 213
192 3300036712 Ga0316584_0137509 Ga0316584_0137509_911_1561 213
193 3300042876 Ga0451577_0015039 Ga0451577_0015039_3844_4494 213
194 3300044656 Ga0466969_0004100 Ga0466969_0004100_3971_4627 213
195 3300044656 Ga0466969_0016208 Ga0466969_0016208_2453_3109 213
196 3300044673 Ga0453683_0010769 Ga0453683_0010769_1096_1746 213
197 3300044684 Ga0466966_0013592 Ga0466966_0013592_1134_1790 213
198 3300044693 Ga0466961_0372389 Ga0466961_0372389_81_737 213
199 3300044712 Ga0453684_0019449 Ga0453684_0019449_5586_6236 213
200 3300044712 Ga0453684_0106964 Ga0453684_0106964_65_715 213
201 3300044719 Ga0466971_0031996 Ga0466971_0031996_248_928 213
202 3300044765 Ga0466970_0309092 Ga0466970_0309092_15_671 213
203 3300045049 Ga0466959_0009093 Ga0466959_0009093_5793_6449 213
204 3300045049 Ga0466959_0025665 Ga0466959_0025665_2624_3280 213
205 3300045051 Ga0451576_0005997 Ga0451576_0005997_4101_4751 213
206 3300047322 Ga0495680_0182124 Ga0495680_0182124_637_1287 213
207 3300049744 Ga0501083_0167825 Ga0501083_0167825_557_1204 213
208 3300053092 Ga0500583_0128632 Ga0500583_0128632_492_1151 213
209 3300053096 Ga0500641_0053763 Ga0500641_0053763_412_1071 213
210 3300053156 Ga0500622_0041152 Ga0500622_0041152_1050_1709 213
211 3300005330 Ga0070690_100105927 Ga0070690_1001059272 214
212 3300006914 Ga0075436_100129562 Ga0075436_1001295622 214
213 3300007265 Ga0099794_10003712 Ga0099794_100037122 214
214 3300009094 Ga0111539_11265748 Ga0111539_112657481 214
215 3300025939 Ga0207665_10000312 Ga0207665_1000031221 214
216 3300027671 Ga0209588_1048168 Ga0209588_10481682 214
217 3300041458 Ga0451798_0168380 Ga0451798_0168380_219_881 214
218 3300042006 Ga0439432_062065 Ga0439432_062065_108_791 214
219 3300048911 Ga0496108_0021331 Ga0496108_0021331_2024_2704 214
220 3300049568 Ga0501031_0019959 Ga0501031_0019959_3650_4321 214
221 3300049569 Ga0501032_0027818 Ga0501032_0027818_2366_3037 214
222 3300049570 Ga0501033_0003705 Ga0501033_0003705_11318_11989 214
223 3300049572 Ga0501036_0053871 Ga0501036_0053871_1028_1699 214
224 3300049575 Ga0501039_0002030 Ga0501039_0002030_11468_12139 214
225 3300049580 Ga0501046_0127152 Ga0501046_0127152_353_1024 214
226 3300049822 Ga0501035_0004547 Ga0501035_0004547_1018_1689 214
227 3300049822 Ga0501035_0034245 Ga0501035_0034245_1645_2313 214
228 3300050514 nmdc:mga08x19_52367_c1 nmdc:mga08x19_52367_c1_836_1495 214
229 3300014745 Ga0157377_10000440 Ga0157377_100004409 215
230 3300006237 Ga0097621_100484059 Ga0097621_1004840591 216
231 3300053733 Ga0500552_028149 Ga0500552_028149_173_832 216
232 3300030521 Ga0307511_10000450 Ga0307511_1000045028 217
233 3300031616 Ga0307508_10147849 Ga0307508_101478492 217
234 3300053178 Ga0500637_0009004 Ga0500637_0009004_1705_2400 217
235 3300005539 Ga0068853_100164687 Ga0068853_1001646873 218
236 3300005844 Ga0068862_100243550 Ga0068862_1002435502 218
237 3300013100 Ga0157373_10168267 Ga0157373_101682672 218
238 3300025919 Ga0207657_10087295 Ga0207657_100872953 218
239 3300028380 Ga0268265_10342506 Ga0268265_103425062 218
240 3300035113 Ga0373936_0003187 Ga0373936_0003187_4949_5620 218
241 3300049571 Ga0501034_0040400 Ga0501034_0040400_2918_3613 218
242 3300049574 Ga0501038_0389422 Ga0501038_0389422_292_987 218
243 3300009553 Ga0105249_10009196 Ga0105249_100091969 219
244 3300003203 JGI25406J46586_10025645 JGI25406J46586_100256452 220
245 3300005355 Ga0070671_100000443 Ga0070671_10000044316 220
246 3300005367 Ga0070667_100004228 Ga0070667_1000042288 220
247 3300005544 Ga0070686_100115885 Ga0070686_1001158852 220
248 3300005617 Ga0068859_100021277 Ga0068859_1000212773 220
249 3300005618 Ga0068864_100855528 Ga0068864_1008555282 220
250 3300005719 Ga0068861_100108786 Ga0068861_1001087863 220
251 3300005841 Ga0068863_100005373 Ga0068863_1000053732 220
252 3300005842 Ga0068858_100120289 Ga0068858_1001202893 220
253 3300005843 Ga0068860_100099934 Ga0068860_1000999342 220
254 3300005937 Ga0081455_10000032 Ga0081455_1000003295 220
255 3300005985 Ga0081539_10000007 Ga0081539_10000007275 220
256 3300006931 Ga0097620_100021279 Ga0097620_1000212793 220
257 3300006931 Ga0097620_100120303 Ga0097620_1001203032 220
258 3300009101 Ga0105247_10007171 Ga0105247_100071713 220
259 3300009177 Ga0105248_10067308 Ga0105248_100673082 220
260 3300011119 Ga0105246_10202554 Ga0105246_102025542 220
261 3300013306 Ga0163162_10010572 Ga0163162_100105722 220
262 3300014325 Ga0163163_10077495 Ga0163163_100774953 220
263 3300025900 Ga0207710_10004066 Ga0207710_100040663 220
264 3300025931 Ga0207644_10016867 Ga0207644_100168673 220
265 3300025941 Ga0207711_10267324 Ga0207711_102673242 220
266 3300025986 Ga0207658_10221934 Ga0207658_102219342 220
267 3300026035 Ga0207703_10001917 Ga0207703_100019172 220
268 3300026088 Ga0207641_10128585 Ga0207641_101285853 220
269 3300026118 Ga0207675_100102529 Ga0207675_1001025293 220
270 3300028379 Ga0268266_10077202 Ga0268266_100772023 220
271 3300028380 Ga0268265_10033764 Ga0268265_100337642 220
272 3300031507 Ga0307509_10254946 Ga0307509_102549462 220
273 3300046684 Ga0495669_0174310 Ga0495669_0174310_197_877 220
274 3300048905 Ga0496102_0253980 Ga0496102_0253980_760_1485 220
275 3300048911 Ga0496108_0182096 Ga0496108_0182096_97_822 220
276 3300048915 Ga0496112_0221633 Ga0496112_0221633_400_1125 220
277 3300048922 Ga0496119_0208098 Ga0496119_0208098_51_776 220
278 3300048924 Ga0496121_0002531 Ga0496121_0002531_4429_5154 220
279 3300048928 Ga0496125_0097927 Ga0496125_0097927_995_1720 220
280 3300053093 Ga0500651_0278808 Ga0500651_0278808_108_788 220
281 3300053134 Ga0500658_0028634 Ga0500658_0028634_1167_1847 220
282 3300053153 Ga0500616_0003475 Ga0500616_0003475_3867_4547 220
283 3300053732 Ga0500656_016844 Ga0500656_016844_169_849 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09347

DUF1989

Domain of unknown function (DUF1989)

32

200

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oru-assembly1.cif.gz_A crystal structure of a duf1989 family protein (tm1040_0329) from silicibacter sp. tm1040 at 1.11 a resolution 0.8062 18 220
3di4-assembly1.cif.gz_B crystal structure of a duf1989 family protein (spo0365) from silicibacter pomeroyi dss-3 at 1.60 a resolution 0.8043 18 219
3oru-assembly1.cif.gz_A crystal structure of a duf1989 family protein (tm1040_0329) from silicibacter sp. tm1040 at 1.11 a resolution 0.7409 18 220
3di4-assembly1.cif.gz_B crystal structure of a duf1989 family protein (spo0365) from silicibacter pomeroyi dss-3 at 1.60 a resolution 0.7396 18 219
4c0h-assembly1.cif.gz_B extended interface between pcf11p and clp1p and structural basis for atp loss in gly135arg point mutant 0.5423 28 195
ID Description Score Start End Superfamily
af_Q54N48_42_118_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.6544 28 196 2.60.120.1030
af_E7F3I6_19_100_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.6127 28 195 2.60.120.1030
4c0bB01 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.6067 25 195 2.60.120.1030
af_Q4DN69_1_81_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.5924 23 216 2.60.120.1030
af_Q54N48_42_118_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.5814 28 196 2.60.120.1030
ID Description Score Start End GO Terms
AF-A0A355JNQ3-F1-model_v4 deleted 0.9838 8 107
AF-A0A3D4LXJ8-F1-model_v4 deleted 0.9684 55 108
AF-A0A355JNQ3-F1-model_v4 deleted 0.9647 8 107
AF-A0A7H4NJH7-F1-model_v4 deleted 0.9591 8 98
AF-A0A4V1QZG3-F1-model_v4 deleted 0.9564 8 118

Feature Viewer

pLDDT pTM Quality
83.53 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map