F385391
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 283 | 198 | 275 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100000443|Ga0070671_10000044316 |
| Length | 241 |
| Sequence | MTTVNSGAAAPTAGAAKMVESLLDPTAAVLDEIVAAGEPWMGVVRQGQRLRIVDVEGNQSVGALFYSAATMEERYSASDTVRAQGNLYLTTGARLLSNEGNVMLQIVADTCGRHDTLGGACSAESNTVRYALEKRHMHSCRDNFLLALARADCGLGKRDLSSNINFFMNVPVTPGGQLTVTDGISAAGRYVEMRAEMDVIVLISNCPQLNNPCNAYNPTPVRLLVWDAPADREPVQPARGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 4 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 5 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 6 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 7 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 99 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 101 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 103 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 104 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 105 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 106 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 107 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 108 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 109 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 110 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 111 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 112 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 113 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 116 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 117 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 118 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 119 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 121 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 122 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 124 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 125 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 126 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 127 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 128 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 129 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 130 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 131 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 132 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 133 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 134 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 135 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 136 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 137 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 138 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 139 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 140 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 141 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 154 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 156 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 157 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 158 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 159 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 160 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 184 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 185 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 188 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 189 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 190 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 191 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 192 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 193 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 194 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 195 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 196 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 197 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 198 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.11 |
| Metatranscriptomes | 1.06 |
| Isolates | 2.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.07 |
| Nodule | 1.41 |
| Rhizoplane | 3.18 |
| Rhizosphere | 81.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10025645 | 3300003203 | Bacteria | 2286 |
| 2 | Ga0055530_10004308 | 3300003791 | Bacteria | 7408 |
| 3 | Ga0055540_1000013 | 3300003792 | Bacteria | 262274 |
| 4 | Ga0065707_10083185 | 3300005295 | Bacteria | 10089 |
| 5 | Ga0070690_100105927 | 3300005330 | Bacteria | 1870 |
| 6 | Ga0070677_10003299 | 3300005333 | Bacteria | 5196 |
| 7 | Ga0070669_100533094 | 3300005353 | Bacteria | 977 |
| 8 | Ga0070675_100082810 | 3300005354 | Bacteria | 2677 |
| 9 | Ga0070671_100000443 | 3300005355 | Bacteria | 28787 |
| 10 | Ga0070674_100044342 | 3300005356 | Bacteria | 3031 |
| 11 | Ga0070674_100268366 | 3300005356 | Bacteria | 1347 |
| 12 | Ga0070673_100034356 | 3300005364 | Bacteria | 3836 |
| 13 | Ga0070659_100824516 | 3300005366 | Bacteria | 808 |
| 14 | Ga0070667_100004228 | 3300005367 | Bacteria | 12123 |
| 15 | Ga0070700_100097234 | 3300005441 | Bacteria | 1933 |
| 16 | Ga0068867_100001187 | 3300005459 | Bacteria | 17866 |
| 17 | Ga0070707_100781801 | 3300005468 | Bacteria | 918 |
| 18 | Ga0070699_100722884 | 3300005518 | Bacteria | 910 |
| 19 | Ga0068853_100038994 | 3300005539 | Bacteria | 4050 |
| 20 | Ga0068853_100164687 | 3300005539 | Bacteria | 2003 |
| 21 | Ga0070672_100009078 | 3300005543 | Bacteria | 6838 |
| 22 | Ga0070672_100018075 | 3300005543 | Bacteria | 5089 |
| 23 | Ga0070686_100115885 | 3300005544 | Bacteria | 1833 |
| 24 | Ga0070665_100176984 | 3300005548 | Bacteria | 2134 |
| 25 | Ga0070665_100254475 | 3300005548 | Bacteria | 1757 |
| 26 | Ga0068855_100332491 | 3300005563 | Bacteria | 1677 |
| 27 | Ga0068859_100021277 | 3300005617 | Bacteria | 6508 |
| 28 | Ga0068859_100481135 | 3300005617 | Bacteria | 1337 |
| 29 | Ga0068864_100125743 | 3300005618 | Bacteria | 2297 |
| 30 | Ga0068864_100855528 | 3300005618 | Bacteria | 896 |
| 31 | Ga0068861_100108786 | 3300005719 | Bacteria | 2218 |
| 32 | Ga0068870_10055574 | 3300005840 | Bacteria | 2109 |
| 33 | Ga0068863_100005373 | 3300005841 | Bacteria | 12631 |
| 34 | Ga0068863_100270068 | 3300005841 | Bacteria | 1646 |
| 35 | Ga0068858_100120289 | 3300005842 | Bacteria | 2455 |
| 36 | Ga0068860_100099934 | 3300005843 | Bacteria | 2767 |
| 37 | Ga0068860_100253912 | 3300005843 | Bacteria | 1713 |
| 38 | Ga0068862_100243550 | 3300005844 | Bacteria | 1636 |
| 39 | Ga0081455_10000032 | 3300005937 | Bacteria | 146266 |
| 40 | Ga0081539_10000007 | 3300005985 | Bacteria | 532790 |
| 41 | Ga0075366_10052418 | 3300006195 | Bacteria | 2424 |
| 42 | Ga0097621_100484059 | 3300006237 | Bacteria | 1119 |
| 43 | Ga0068865_100047839 | 3300006881 | Bacteria | 2941 |
| 44 | Ga0068865_100101054 | 3300006881 | Bacteria | 2111 |
| 45 | Ga0075436_100129562 | 3300006914 | Bacteria | 1769 |
| 46 | Ga0097620_100021279 | 3300006931 | Bacteria | 6508 |
| 47 | Ga0097620_100120303 | 3300006931 | Bacteria | 2692 |
| 48 | Ga0097620_100481127 | 3300006931 | Bacteria | 1337 |
| 49 | Ga0099794_10003712 | 3300007265 | Bacteria | 5877 |
| 50 | Ga0105240_10002720 | 3300009093 | Bacteria | 28041 |
| 51 | Ga0111539_10169745 | 3300009094 | Bacteria | 2549 |
| 52 | Ga0111539_11265748 | 3300009094 | Bacteria | 856 |
| 53 | Ga0105245_10700483 | 3300009098 | Bacteria | 1046 |
| 54 | Ga0105247_10007171 | 3300009101 | Bacteria | 6841 |
| 55 | Ga0105247_10036594 | 3300009101 | Bacteria | 2992 |
| 56 | Ga0114129_11357488 | 3300009147 | Bacteria | 879 |
| 57 | Ga0105243_10003213 | 3300009148 | Bacteria | 13372 |
| 58 | Ga0105248_10067308 | 3300009177 | Bacteria | 4021 |
| 59 | Ga0105248_10600597 | 3300009177 | Bacteria | 1242 |
| 60 | Ga0105238_10000544 | 3300009551 | Bacteria | 39382 |
| 61 | Ga0105238_10224246 | 3300009551 | Bacteria | 1856 |
| 62 | Ga0105249_10009196 | 3300009553 | Bacteria | 8642 |
| 63 | Ga0105239_10148325 | 3300010375 | Bacteria | 2617 |
| 64 | Ga0105239_10482706 | 3300010375 | Bacteria | 1408 |
| 65 | Ga0105246_10202554 | 3300011119 | Bacteria | 1544 |
| 66 | Ga0157373_10168267 | 3300013100 | Bacteria | 1542 |
| 67 | Ga0157373_10448207 | 3300013100 | Bacteria | 929 |
| 68 | Ga0163162_10010572 | 3300013306 | Bacteria | 8976 |
| 69 | Ga0157375_10031755 | 3300013308 | Bacteria | 4999 |
| 70 | Ga0163163_10077495 | 3300014325 | Bacteria | 3319 |
| 71 | Ga0163163_10265951 | 3300014325 | Bacteria | 1766 |
| 72 | Ga0157380_10000996 | 3300014326 | Bacteria | 18001 |
| 73 | Ga0157377_10000440 | 3300014745 | Bacteria | 17934 |
| 74 | Ga0157379_10102942 | 3300014968 | Bacteria | 2562 |
| 75 | Ga0163161_10178001 | 3300017792 | Bacteria | 1629 |
| 76 | Ga0209050_1000567 | 3300025298 | Bacteria | 60093 |
| 77 | Ga0209051_1000022 | 3300025303 | Bacteria | 474879 |
| 78 | Ga0209257_1000030 | 3300025304 | Bacteria | 689812 |
| 79 | Ga0207682_10000480 | 3300025893 | Bacteria | 18512 |
| 80 | Ga0207642_10426016 | 3300025899 | Bacteria | 799 |
| 81 | Ga0207710_10004066 | 3300025900 | Bacteria | 6434 |
| 82 | Ga0207710_10056208 | 3300025900 | Bacteria | 1775 |
| 83 | Ga0207643_10004036 | 3300025908 | Bacteria | 7901 |
| 84 | Ga0207695_10053723 | 3300025913 | Bacteria | 4211 |
| 85 | Ga0207695_10202993 | 3300025913 | Bacteria | 1896 |
| 86 | Ga0207695_10317761 | 3300025913 | Bacteria | 1447 |
| 87 | Ga0207662_10298757 | 3300025918 | Bacteria | 1070 |
| 88 | Ga0207657_10087295 | 3300025919 | Bacteria | 2610 |
| 89 | Ga0207681_10103127 | 3300025923 | Bacteria | 2061 |
| 90 | Ga0207694_10000709 | 3300025924 | Bacteria | 29966 |
| 91 | Ga0207659_10228920 | 3300025926 | Bacteria | 1498 |
| 92 | Ga0207659_10271674 | 3300025926 | Bacteria | 1383 |
| 93 | Ga0207644_10016867 | 3300025931 | Bacteria | 4920 |
| 94 | Ga0207709_10002374 | 3300025935 | Bacteria | 11875 |
| 95 | Ga0207704_10097183 | 3300025938 | Bacteria | 1952 |
| 96 | Ga0207665_10000312 | 3300025939 | Bacteria | 33656 |
| 97 | Ga0207691_10004266 | 3300025940 | Bacteria | 13882 |
| 98 | Ga0207691_10005404 | 3300025940 | Bacteria | 12330 |
| 99 | Ga0207711_10147148 | 3300025941 | Bacteria | 2123 |
| 100 | Ga0207711_10267324 | 3300025941 | Bacteria | 1573 |
| 101 | Ga0207711_10301396 | 3300025941 | Bacteria | 1478 |
| 102 | Ga0207667_10933590 | 3300025949 | Bacteria | 858 |
| 103 | Ga0207651_10044884 | 3300025960 | Bacteria | 2961 |
| 104 | Ga0207658_10221934 | 3300025986 | Bacteria | 1590 |
| 105 | Ga0207658_10903426 | 3300025986 | Bacteria | 804 |
| 106 | Ga0207703_10001917 | 3300026035 | Bacteria | 18430 |
| 107 | Ga0207639_10095910 | 3300026041 | Bacteria | 2385 |
| 108 | Ga0207678_10061114 | 3300026067 | Bacteria | 3240 |
| 109 | Ga0207641_10128585 | 3300026088 | Bacteria | 2271 |
| 110 | Ga0207648_10001627 | 3300026089 | Bacteria | 24609 |
| 111 | Ga0207648_10055641 | 3300026089 | Bacteria | 3453 |
| 112 | Ga0207674_10439836 | 3300026116 | Bacteria | 1260 |
| 113 | Ga0207675_100102529 | 3300026118 | Bacteria | 2696 |
| 114 | Ga0209588_1048168 | 3300027671 | Bacteria | 1379 |
| 115 | Ga0268266_10077202 | 3300028379 | Bacteria | 2895 |
| 116 | Ga0268266_10086189 | 3300028379 | Bacteria | 2745 |
| 117 | Ga0268265_10033764 | 3300028380 | Bacteria | 3723 |
| 118 | Ga0268265_10342506 | 3300028380 | Bacteria | 1362 |
| 119 | Ga0268264_10120788 | 3300028381 | Bacteria | 2309 |
| 120 | Ga0307515_10009286 | 3300028794 | Bacteria | 19029 |
| 121 | Ga0307515_10149443 | 3300028794 | Bacteria | 2451 |
| 122 | Ga0265338_10060628 | 3300028800 | Bacteria | 3322 |
| 123 | Ga0307511_10000450 | 3300030521 | Bacteria | 44241 |
| 124 | Ga0307511_10026705 | 3300030521 | Bacteria | 5290 |
| 125 | Ga0265760_10116424 | 3300031090 | Bacteria | 855 |
| 126 | Ga0265327_10001627 | 3300031251 | Bacteria | 27097 |
| 127 | Ga0307509_10000084 | 3300031507 | Bacteria | 131262 |
| 128 | Ga0307509_10006230 | 3300031507 | Bacteria | 16137 |
| 129 | Ga0307509_10148005 | 3300031507 | Bacteria | 2270 |
| 130 | Ga0307509_10254946 | 3300031507 | Bacteria | 1535 |
| 131 | Ga0307508_10147849 | 3300031616 | Bacteria | 1954 |
| 132 | Ga0316579_10031140 | 3300031691 | Bacteria | 2440 |
| 133 | Ga0316579_10031674 | 3300031691 | Bacteria | 2422 |
| 134 | Ga0316576_10166556 | 3300031727 | Bacteria | 1663 |
| 135 | Ga0316578_10090094 | 3300031728 | Bacteria | 1831 |
| 136 | Ga0316578_10108891 | 3300031728 | Bacteria | 1663 |
| 137 | Ga0316577_10022468 | 3300031733 | Bacteria | 3502 |
| 138 | Ga0316577_10033369 | 3300031733 | Bacteria | 2875 |
| 139 | Ga0307409_100569574 | 3300031995 | Bacteria | 1115 |
| 140 | Ga0316583_10059716 | 3300032133 | Bacteria | 1337 |
| 141 | Ga0316585_10006717 | 3300032137 | Bacteria | 3293 |
| 142 | Ga0316580_10012937 | 3300032139 | Bacteria | 2542 |
| 143 | Ga0316592_1004068 | 3300033524 | Bacteria | 2692 |
| 144 | Ga0316596_1001616 | 3300033541 | Bacteria | 4620 |
| 145 | Ga0373952_0087788 | 3300035092 | Bacteria | 803 |
| 146 | Ga0373936_0003187 | 3300035113 | Bacteria | 6148 |
| 147 | Ga0373936_0053775 | 3300035113 | Bacteria | 1633 |
| 148 | Ga0373936_0188591 | 3300035113 | Bacteria | 907 |
| 149 | Ga0316574_0002666 | 3300035398 | Bacteria | 9014 |
| 150 | Ga0316574_0008822 | 3300035398 | Bacteria | 5618 |
| 151 | Ga0316574_0018324 | 3300035398 | Bacteria | 4113 |
| 152 | Ga0316574_0047237 | 3300035398 | Bacteria | 2671 |
| 153 | Ga0373933_0071655 | 3300035724 | Bacteria | 2110 |
| 154 | Ga0373937_0040810 | 3300036401 | Bacteria | 4231 |
| 155 | Ga0316582_0053743 | 3300036647 | Bacteria | 2563 |
| 156 | Ga0316582_0102571 | 3300036647 | Bacteria | 1896 |
| 157 | Ga0316582_0202318 | 3300036647 | Bacteria | 1355 |
| 158 | Ga0316582_0383114 | 3300036647 | Bacteria | 968 |
| 159 | Ga0316584_0021083 | 3300036712 | Bacteria | 4731 |
| 160 | Ga0316584_0042693 | 3300036712 | Bacteria | 3380 |
| 161 | Ga0316584_0137509 | 3300036712 | Bacteria | 1823 |
| 162 | Ga0373925_0282622 | 3300037068 | Bacteria | 1337 |
| 163 | Ga0316581_0019802 | 3300037588 | Bacteria | 1965 |
| 164 | Ga0395901_0281082 | 3300038443 | Bacteria | 1729 |
| 165 | Ga0436361_0531081 | 3300039447 | Bacteria | 1846 |
| 166 | Ga0451798_0168380 | 3300041458 | Bacteria | 1565 |
| 167 | Ga0451804_0768091 | 3300041463 | Bacteria | 1206 |
| 168 | Ga0451807_1696238 | 3300041486 | Bacteria | 1476 |
| 169 | Ga0451807_2593976 | 3300041486 | Bacteria | 1144 |
| 170 | Ga0451853_0184284 | 3300041512 | Bacteria | 1669 |
| 171 | Ga0451853_1730347 | 3300041512 | Bacteria | 1287 |
| 172 | Ga0439432_062065 | 3300042006 | Bacteria | 1151 |
| 173 | Ga0451577_0015039 | 3300042876 | Bacteria | 7199 |
| 174 | Ga0466969_0004100 | 3300044656 | Bacteria | 7733 |
| 175 | Ga0466969_0016208 | 3300044656 | Bacteria | 3903 |
| 176 | Ga0453683_0010769 | 3300044673 | Bacteria | 6054 |
| 177 | Ga0466966_0013592 | 3300044684 | Bacteria | 5385 |
| 178 | Ga0466961_0372389 | 3300044693 | Bacteria | 868 |
| 179 | Ga0453684_0019449 | 3300044712 | Bacteria | 10340 |
| 180 | Ga0453684_0030569 | 3300044712 | Bacteria | 7604 |
| 181 | Ga0453684_0106964 | 3300044712 | Bacteria | 3407 |
| 182 | Ga0466971_0031996 | 3300044719 | Bacteria | 2357 |
| 183 | Ga0466970_0309092 | 3300044765 | Bacteria | 892 |
| 184 | Ga0466959_0009093 | 3300045049 | Bacteria | 7052 |
| 185 | Ga0466959_0025665 | 3300045049 | Bacteria | 4370 |
| 186 | Ga0451576_0005997 | 3300045051 | Bacteria | 15025 |
| 187 | Ga0495591_066271 | 3300046458 | Bacteria | 948 |
| 188 | Ga0495638_0007478 | 3300046460 | Bacteria | 7829 |
| 189 | Ga0495638_0129107 | 3300046460 | Bacteria | 1487 |
| 190 | Ga0495620_0080306 | 3300046515 | Bacteria | 1320 |
| 191 | Ga0495644_0203952 | 3300046523 | Bacteria | 763 |
| 192 | Ga0495667_0027657 | 3300046559 | Bacteria | 3819 |
| 193 | Ga0495668_0235708 | 3300046616 | Bacteria | 1002 |
| 194 | Ga0495611_0210775 | 3300046648 | Bacteria | 905 |
| 195 | Ga0495625_0012846 | 3300046660 | Bacteria | 6770 |
| 196 | Ga0495669_0174310 | 3300046684 | Bacteria | 1024 |
| 197 | Ga0495680_0147439 | 3300047322 | Bacteria | 1718 |
| 198 | Ga0495680_0182124 | 3300047322 | Bacteria | 1516 |
| 199 | Ga0495687_052006 | 3300047443 | Bacteria | 1735 |
| 200 | Ga0495687_101690 | 3300047443 | Bacteria | 1077 |
| 201 | Ga0495615_0027238 | 3300048090 | Bacteria | 1340 |
| 202 | Ga0496102_0003151 | 3300048905 | Bacteria | 13984 |
| 203 | Ga0496102_0253980 | 3300048905 | Bacteria | 1657 |
| 204 | Ga0496108_0021331 | 3300048911 | Bacteria | 5324 |
| 205 | Ga0496108_0182096 | 3300048911 | Bacteria | 1820 |
| 206 | Ga0496112_0221633 | 3300048915 | Bacteria | 1847 |
| 207 | Ga0496119_0208098 | 3300048922 | Bacteria | 1008 |
| 208 | Ga0496121_0002531 | 3300048924 | Bacteria | 27699 |
| 209 | Ga0496121_0051795 | 3300048924 | Bacteria | 3454 |
| 210 | Ga0496121_0074341 | 3300048924 | Bacteria | 2719 |
| 211 | Ga0496124_0000079 | 3300048927 | Bacteria | 212057 |
| 212 | Ga0496125_0014435 | 3300048928 | Bacteria | 7691 |
| 213 | Ga0496125_0097927 | 3300048928 | Bacteria | 2171 |
| 214 | Ga0501031_0019959 | 3300049568 | Bacteria | 4369 |
| 215 | Ga0501032_0025219 | 3300049569 | Bacteria | 4100 |
| 216 | Ga0501032_0027818 | 3300049569 | Bacteria | 3885 |
| 217 | Ga0501033_0003705 | 3300049570 | Bacteria | 12433 |
| 218 | Ga0501033_0023094 | 3300049570 | Bacteria | 4689 |
| 219 | Ga0501033_0047956 | 3300049570 | Bacteria | 3175 |
| 220 | Ga0501034_0010173 | 3300049571 | Bacteria | 9814 |
| 221 | Ga0501034_0040400 | 3300049571 | Bacteria | 4722 |
| 222 | Ga0501036_0053871 | 3300049572 | Bacteria | 3405 |
| 223 | Ga0501037_0006205 | 3300049573 | Bacteria | 8742 |
| 224 | Ga0501037_0085835 | 3300049573 | Bacteria | 2279 |
| 225 | Ga0501038_0083681 | 3300049574 | Bacteria | 2685 |
| 226 | Ga0501038_0129816 | 3300049574 | Bacteria | 2070 |
| 227 | Ga0501038_0147166 | 3300049574 | Bacteria | 1922 |
| 228 | Ga0501038_0183236 | 3300049574 | Bacteria | 1688 |
| 229 | Ga0501038_0389422 | 3300049574 | Bacteria | 1080 |
| 230 | Ga0501038_0443947 | 3300049574 | Bacteria | 998 |
| 231 | Ga0501039_0002030 | 3300049575 | Bacteria | 14993 |
| 232 | Ga0501040_0003041 | 3300049576 | Bacteria | 10876 |
| 233 | Ga0501043_0034319 | 3300049579 | Bacteria | 3990 |
| 234 | Ga0501043_0080310 | 3300049579 | Bacteria | 2562 |
| 235 | Ga0501043_0149113 | 3300049579 | Bacteria | 1830 |
| 236 | Ga0501043_0259349 | 3300049579 | Bacteria | 1337 |
| 237 | Ga0501046_0017429 | 3300049580 | Bacteria | 5994 |
| 238 | Ga0501046_0127152 | 3300049580 | Bacteria | 1935 |
| 239 | Ga0501046_0413141 | 3300049580 | Bacteria | 973 |
| 240 | Ga0501047_0089463 | 3300049581 | Bacteria | 2956 |
| 241 | Ga0501048_0017880 | 3300049582 | Bacteria | 5215 |
| 242 | Ga0501067_0166858 | 3300049583 | Bacteria | 1226 |
| 243 | Ga0501068_0098141 | 3300049584 | Bacteria | 1813 |
| 244 | Ga0501070_0368577 | 3300049586 | Bacteria | 1164 |
| 245 | Ga0501073_0210732 | 3300049589 | Bacteria | 1343 |
| 246 | Ga0501074_0068538 | 3300049590 | Bacteria | 2550 |
| 247 | Ga0501080_0787714 | 3300049742 | Bacteria | 834 |
| 248 | Ga0501083_0167825 | 3300049744 | Bacteria | 1435 |
| 249 | Ga0501035_0004547 | 3300049822 | Bacteria | 13165 |
| 250 | Ga0501035_0034245 | 3300049822 | Bacteria | 4616 |
| 251 | Ga0501035_0036093 | 3300049822 | Bacteria | 4481 |
| 252 | Ga0501035_0080880 | 3300049822 | Bacteria | 2868 |
| 253 | Ga0501044_0035098 | 3300049823 | Bacteria | 5253 |
| 254 | Ga0501044_0084409 | 3300049823 | Bacteria | 3210 |
| 255 | Ga0501044_0087273 | 3300049823 | Bacteria | 3151 |
| 256 | Ga0501044_0263190 | 3300049823 | Bacteria | 1662 |
| 257 | Ga0501044_0773999 | 3300049823 | Bacteria | 840 |
| 258 | Ga0501045_0004056 | 3300049824 | Bacteria | 10103 |
| 259 | nmdc:mga0k408_23194_c1 | 3300050493 | Bacteria | 3498 |
| 260 | nmdc:mga07m45_276966_c1 | 3300050496 | Bacteria | 976 |
| 261 | nmdc:mga08y16_207148_c1 | 3300050511 | Bacteria | 2031 |
| 262 | nmdc:mga08y16_384507_c1 | 3300050511 | Bacteria | 1438 |
| 263 | nmdc:mga08x19_52367_c1 | 3300050514 | Bacteria | 2625 |
| 264 | Ga0500583_0128632 | 3300053092 | Bacteria | 1255 |
| 265 | Ga0500651_0278808 | 3300053093 | Bacteria | 965 |
| 266 | Ga0500641_0053763 | 3300053096 | Bacteria | 1663 |
| 267 | Ga0500595_018133 | 3300053119 | Bacteria | 2580 |
| 268 | Ga0500658_0028634 | 3300053134 | Bacteria | 2163 |
| 269 | Ga0500616_0003475 | 3300053153 | Bacteria | 12008 |
| 270 | Ga0500622_0041152 | 3300053156 | Bacteria | 2405 |
| 271 | Ga0500630_098039 | 3300053159 | Bacteria | 1341 |
| 272 | Ga0500637_0004830 | 3300053178 | Bacteria | 6458 |
| 273 | Ga0500637_0009004 | 3300053178 | Bacteria | 5063 |
| 274 | Ga0500656_016844 | 3300053732 | Bacteria | 869 |
| 275 | Ga0500552_028149 | 3300053733 | Bacteria | 849 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049574 | Ga0501038_0183236 | Ga0501038_0183236_428_994 | 184 |
| 2 | 3300049583 | Ga0501067_0166858 | Ga0501067_0166858_638_1204 | 184 |
| 3 | 3300037068 | Ga0373925_0282622 | Ga0373925_0282622_706_1311 | 189 |
| 4 | 3300048090 | Ga0495615_0027238 | Ga0495615_0027238_23_592 | 189 |
| 5 | 3300005841 | Ga0068863_100270068 | Ga0068863_1002700682 | 197 |
| 6 | 3300049574 | Ga0501038_0147166 | Ga0501038_0147166_1288_1896 | 198 |
| 7 | 3300049824 | Ga0501045_0004056 | Ga0501045_0004056_9067_9678 | 199 |
| 8 | 3300049574 | Ga0501038_0083681 | Ga0501038_0083681_2039_2659 | 200 |
| 9 | 3300009098 | Ga0105245_10700483 | Ga0105245_107004832 | 201 |
| 10 | 3300026116 | Ga0207674_10439836 | Ga0207674_104398362 | 201 |
| 11 | 3300041463 | Ga0451804_0768091 | Ga0451804_0768091_250_873 | 201 |
| 12 | 3300041486 | Ga0451807_2593976 | Ga0451807_2593976_480_1103 | 201 |
| 13 | 3300046559 | Ga0495667_0027657 | Ga0495667_0027657_3185_3796 | 201 |
| 14 | 3300050511 | nmdc:mga08y16_207148_c1 | nmdc:mga08y16_207148_c1_1117_1722 | 201 |
| 15 | 3300028794 | Ga0307515_10149443 | Ga0307515_101494431 | 202 |
| 16 | 3300030521 | Ga0307511_10026705 | Ga0307511_100267052 | 202 |
| 17 | 3300053159 | Ga0500630_098039 | Ga0500630_098039_537_1169 | 202 |
| 18 | 3300005333 | Ga0070677_10003299 | Ga0070677_100032993 | 203 |
| 19 | 3300005354 | Ga0070675_100082810 | Ga0070675_1000828103 | 203 |
| 20 | 3300005356 | Ga0070674_100044342 | Ga0070674_1000443422 | 203 |
| 21 | 3300005364 | Ga0070673_100034356 | Ga0070673_1000343562 | 203 |
| 22 | 3300005441 | Ga0070700_100097234 | Ga0070700_1000972342 | 203 |
| 23 | 3300005543 | Ga0070672_100018075 | Ga0070672_1000180752 | 203 |
| 24 | 3300005548 | Ga0070665_100254475 | Ga0070665_1002544752 | 203 |
| 25 | 3300005617 | Ga0068859_100481135 | Ga0068859_1004811352 | 203 |
| 26 | 3300005618 | Ga0068864_100125743 | Ga0068864_1001257432 | 203 |
| 27 | 3300005840 | Ga0068870_10055574 | Ga0068870_100555742 | 203 |
| 28 | 3300006881 | Ga0068865_100101054 | Ga0068865_1001010542 | 203 |
| 29 | 3300006931 | Ga0097620_100481127 | Ga0097620_1004811272 | 203 |
| 30 | 3300009094 | Ga0111539_10169745 | Ga0111539_101697453 | 203 |
| 31 | 3300025893 | Ga0207682_10000480 | Ga0207682_1000048011 | 203 |
| 32 | 3300025908 | Ga0207643_10004036 | Ga0207643_100040362 | 203 |
| 33 | 3300025918 | Ga0207662_10298757 | Ga0207662_102987571 | 203 |
| 34 | 3300025923 | Ga0207681_10103127 | Ga0207681_101031272 | 203 |
| 35 | 3300025940 | Ga0207691_10004266 | Ga0207691_100042664 | 203 |
| 36 | 3300025960 | Ga0207651_10044884 | Ga0207651_100448842 | 203 |
| 37 | 3300026089 | Ga0207648_10055641 | Ga0207648_100556411 | 203 |
| 38 | 3300041512 | Ga0451853_1730347 | Ga0451853_1730347_94_708 | 203 |
| 39 | 3300046458 | Ga0495591_066271 | Ga0495591_066271_228_842 | 203 |
| 40 | 3300046460 | Ga0495638_0129107 | Ga0495638_0129107_460_1071 | 203 |
| 41 | 3300046515 | Ga0495620_0080306 | Ga0495620_0080306_186_797 | 203 |
| 42 | 3300046523 | Ga0495644_0203952 | Ga0495644_0203952_12_626 | 203 |
| 43 | 3300050511 | nmdc:mga08y16_384507_c1 | nmdc:mga08y16_384507_c1_411_1025 | 203 |
| 44 | 3300031507 | Ga0307509_10148005 | Ga0307509_101480053 | 205 |
| 45 | 3300005356 | Ga0070674_100268366 | Ga0070674_1002683662 | 206 |
| 46 | 3300017792 | Ga0163161_10178001 | Ga0163161_101780012 | 206 |
| 47 | 3300025899 | Ga0207642_10426016 | Ga0207642_104260162 | 206 |
| 48 | 3300025926 | Ga0207659_10228920 | Ga0207659_102289202 | 206 |
| 49 | 3300025941 | Ga0207711_10301396 | Ga0207711_103013962 | 206 |
| 50 | 3300026067 | Ga0207678_10061114 | Ga0207678_100611143 | 206 |
| 51 | 3300014968 | Ga0157379_10102942 | Ga0157379_101029422 | 207 |
| 52 | 3300046616 | Ga0495668_0235708 | Ga0495668_0235708_109_753 | 207 |
| 53 | 3300047443 | Ga0495687_052006 | Ga0495687_052006_834_1478 | 207 |
| 54 | 3300005539 | Ga0068853_100038994 | Ga0068853_1000389942 | 208 |
| 55 | 3300026041 | Ga0207639_10095910 | Ga0207639_100959102 | 208 |
| 56 | 3300031090 | Ga0265760_10116424 | Ga0265760_101164242 | 208 |
| 57 | 3300035113 | Ga0373936_0188591 | Ga0373936_0188591_207_845 | 208 |
| 58 | 3300041486 | Ga0451807_1696238 | Ga0451807_1696238_733_1359 | 208 |
| 59 | 3300041512 | Ga0451853_0184284 | Ga0451853_0184284_383_1009 | 208 |
| 60 | iso_pu_bacteria | 2501025502 | 2501085128 | 209 |
| 61 | iso_pu_bacteria | 2510917013 | 2511090556 | 209 |
| 62 | iso_pu_bacteria | 2513237082 | 2513552546 | 209 |
| 63 | iso_pu_bacteria | 2513237083 | 2513560718 | 209 |
| 64 | iso_pu_bacteria | 2600255067 | 2600811224 | 209 |
| 65 | iso_pu_bacteria | 2857357740 | 2857365235 | 209 |
| 66 | iso_pu_bacteria | 8003955200 | 8003958324 | 209 |
| 67 | 3300005295 | Ga0065707_10083185 | Ga0065707_100831853 | 210 |
| 68 | 3300009101 | Ga0105247_10036594 | Ga0105247_100365942 | 210 |
| 69 | 3300014326 | Ga0157380_10000996 | Ga0157380_100009964 | 210 |
| 70 | 3300025900 | Ga0207710_10056208 | Ga0207710_100562082 | 210 |
| 71 | 3300025938 | Ga0207704_10097183 | Ga0207704_100971833 | 210 |
| 72 | 3300035113 | Ga0373936_0053775 | Ga0373936_0053775_840_1493 | 210 |
| 73 | 3300046460 | Ga0495638_0007478 | Ga0495638_0007478_1719_2363 | 210 |
| 74 | 3300046660 | Ga0495625_0012846 | Ga0495625_0012846_759_1403 | 210 |
| 75 | 3300048924 | Ga0496121_0074341 | Ga0496121_0074341_947_1591 | 210 |
| 76 | 3300053178 | Ga0500637_0004830 | Ga0500637_0004830_5128_5781 | 210 |
| 77 | 3300005353 | Ga0070669_100533094 | Ga0070669_1005330941 | 211 |
| 78 | 3300005543 | Ga0070672_100009078 | Ga0070672_1000090782 | 211 |
| 79 | 3300006195 | Ga0075366_10052418 | Ga0075366_100524183 | 211 |
| 80 | 3300006881 | Ga0068865_100047839 | Ga0068865_1000478392 | 211 |
| 81 | 3300009177 | Ga0105248_10600597 | Ga0105248_106005972 | 211 |
| 82 | 3300013308 | Ga0157375_10031755 | Ga0157375_100317556 | 211 |
| 83 | 3300025940 | Ga0207691_10005404 | Ga0207691_100054049 | 211 |
| 84 | 3300025941 | Ga0207711_10147148 | Ga0207711_101471482 | 211 |
| 85 | 3300028794 | Ga0307515_10009286 | Ga0307515_100092862 | 211 |
| 86 | 3300028800 | Ga0265338_10060628 | Ga0265338_100606282 | 211 |
| 87 | 3300031691 | Ga0316579_10031674 | Ga0316579_100316743 | 211 |
| 88 | 3300031728 | Ga0316578_10090094 | Ga0316578_100900942 | 211 |
| 89 | 3300031733 | Ga0316577_10022468 | Ga0316577_100224682 | 211 |
| 90 | 3300032133 | Ga0316583_10059716 | Ga0316583_100597162 | 211 |
| 91 | 3300032139 | Ga0316580_10012937 | Ga0316580_100129373 | 211 |
| 92 | 3300035398 | Ga0316574_0008822 | Ga0316574_0008822_2726_3373 | 211 |
| 93 | 3300035398 | Ga0316574_0047237 | Ga0316574_0047237_1471_2118 | 211 |
| 94 | 3300044712 | Ga0453684_0030569 | Ga0453684_0030569_2302_2940 | 211 |
| 95 | 3300047443 | Ga0495687_101690 | Ga0495687_101690_16_672 | 211 |
| 96 | 3300048905 | Ga0496102_0003151 | Ga0496102_0003151_10533_11171 | 211 |
| 97 | 3300048924 | Ga0496121_0051795 | Ga0496121_0051795_1045_1695 | 211 |
| 98 | 3300048927 | Ga0496124_0000079 | Ga0496124_0000079_16983_17633 | 211 |
| 99 | 3300048928 | Ga0496125_0014435 | Ga0496125_0014435_5193_5843 | 211 |
| 100 | 3300049571 | Ga0501034_0010173 | Ga0501034_0010173_4155_4799 | 211 |
| 101 | 3300049590 | Ga0501074_0068538 | Ga0501074_0068538_942_1586 | 211 |
| 102 | 3300050493 | nmdc:mga0k408_23194_c1 | nmdc:mga0k408_23194_c1_2125_2778 | 211 |
| 103 | 3300050496 | nmdc:mga07m45_276966_c1 | nmdc:mga07m45_276966_c1_35_688 | 211 |
| 104 | iso_pu_bacteria | 2508501042 | 2508693015 | 211 |
| 105 | 3300003791 | Ga0055530_10004308 | Ga0055530_100043082 | 212 |
| 106 | 3300003792 | Ga0055540_1000013 | Ga0055540_1000013110 | 212 |
| 107 | 3300005366 | Ga0070659_100824516 | Ga0070659_1008245161 | 212 |
| 108 | 3300005468 | Ga0070707_100781801 | Ga0070707_1007818012 | 212 |
| 109 | 3300005518 | Ga0070699_100722884 | Ga0070699_1007228841 | 212 |
| 110 | 3300005548 | Ga0070665_100176984 | Ga0070665_1001769842 | 212 |
| 111 | 3300005563 | Ga0068855_100332491 | Ga0068855_1003324912 | 212 |
| 112 | 3300005843 | Ga0068860_100253912 | Ga0068860_1002539122 | 212 |
| 113 | 3300009093 | Ga0105240_10002720 | Ga0105240_1000272025 | 212 |
| 114 | 3300009551 | Ga0105238_10000544 | Ga0105238_1000054435 | 212 |
| 115 | 3300009551 | Ga0105238_10224246 | Ga0105238_102242462 | 212 |
| 116 | 3300010375 | Ga0105239_10148325 | Ga0105239_101483252 | 212 |
| 117 | 3300010375 | Ga0105239_10482706 | Ga0105239_104827061 | 212 |
| 118 | 3300013100 | Ga0157373_10448207 | Ga0157373_104482071 | 212 |
| 119 | 3300014325 | Ga0163163_10265951 | Ga0163163_102659512 | 212 |
| 120 | 3300025298 | Ga0209050_1000567 | Ga0209050_100056722 | 212 |
| 121 | 3300025303 | Ga0209051_1000022 | Ga0209051_1000022157 | 212 |
| 122 | 3300025304 | Ga0209257_1000030 | Ga0209257_1000030355 | 212 |
| 123 | 3300025913 | Ga0207695_10053723 | Ga0207695_100537232 | 212 |
| 124 | 3300025913 | Ga0207695_10202993 | Ga0207695_102029932 | 212 |
| 125 | 3300025913 | Ga0207695_10317761 | Ga0207695_103177612 | 212 |
| 126 | 3300025924 | Ga0207694_10000709 | Ga0207694_1000070911 | 212 |
| 127 | 3300025949 | Ga0207667_10933590 | Ga0207667_109335902 | 212 |
| 128 | 3300025986 | Ga0207658_10903426 | Ga0207658_109034261 | 212 |
| 129 | 3300028379 | Ga0268266_10086189 | Ga0268266_100861892 | 212 |
| 130 | 3300028381 | Ga0268264_10120788 | Ga0268264_101207882 | 212 |
| 131 | 3300031251 | Ga0265327_10001627 | Ga0265327_1000162713 | 212 |
| 132 | 3300031691 | Ga0316579_10031140 | Ga0316579_100311403 | 212 |
| 133 | 3300031727 | Ga0316576_10166556 | Ga0316576_101665562 | 212 |
| 134 | 3300031728 | Ga0316578_10108891 | Ga0316578_101088912 | 212 |
| 135 | 3300031733 | Ga0316577_10033369 | Ga0316577_100333692 | 212 |
| 136 | 3300031995 | Ga0307409_100569574 | Ga0307409_1005695742 | 212 |
| 137 | 3300032137 | Ga0316585_10006717 | Ga0316585_100067172 | 212 |
| 138 | 3300035398 | Ga0316574_0018324 | Ga0316574_0018324_2950_3597 | 212 |
| 139 | 3300036647 | Ga0316582_0053743 | Ga0316582_0053743_1476_2123 | 212 |
| 140 | 3300036647 | Ga0316582_0102571 | Ga0316582_0102571_187_834 | 212 |
| 141 | 3300036647 | Ga0316582_0383114 | Ga0316582_0383114_209_856 | 212 |
| 142 | 3300036712 | Ga0316584_0021083 | Ga0316584_0021083_1322_1969 | 212 |
| 143 | 3300036712 | Ga0316584_0042693 | Ga0316584_0042693_1867_2514 | 212 |
| 144 | 3300037588 | Ga0316581_0019802 | Ga0316581_0019802_927_1574 | 212 |
| 145 | 3300038443 | Ga0395901_0281082 | Ga0395901_0281082_402_1046 | 212 |
| 146 | 3300039447 | Ga0436361_0531081 | Ga0436361_0531081_341_994 | 212 |
| 147 | 3300046648 | Ga0495611_0210775 | Ga0495611_0210775_228_887 | 212 |
| 148 | 3300047322 | Ga0495680_0147439 | Ga0495680_0147439_880_1527 | 212 |
| 149 | 3300049569 | Ga0501032_0025219 | Ga0501032_0025219_2427_3086 | 212 |
| 150 | 3300049570 | Ga0501033_0023094 | Ga0501033_0023094_3103_3762 | 212 |
| 151 | 3300049570 | Ga0501033_0047956 | Ga0501033_0047956_966_1625 | 212 |
| 152 | 3300049573 | Ga0501037_0006205 | Ga0501037_0006205_7607_8266 | 212 |
| 153 | 3300049573 | Ga0501037_0085835 | Ga0501037_0085835_561_1220 | 212 |
| 154 | 3300049574 | Ga0501038_0129816 | Ga0501038_0129816_252_911 | 212 |
| 155 | 3300049574 | Ga0501038_0443947 | Ga0501038_0443947_286_945 | 212 |
| 156 | 3300049576 | Ga0501040_0003041 | Ga0501040_0003041_9810_10469 | 212 |
| 157 | 3300049579 | Ga0501043_0034319 | Ga0501043_0034319_613_1272 | 212 |
| 158 | 3300049579 | Ga0501043_0080310 | Ga0501043_0080310_1020_1679 | 212 |
| 159 | 3300049579 | Ga0501043_0149113 | Ga0501043_0149113_146_805 | 212 |
| 160 | 3300049579 | Ga0501043_0259349 | Ga0501043_0259349_350_1009 | 212 |
| 161 | 3300049580 | Ga0501046_0017429 | Ga0501046_0017429_2694_3353 | 212 |
| 162 | 3300049580 | Ga0501046_0413141 | Ga0501046_0413141_73_732 | 212 |
| 163 | 3300049581 | Ga0501047_0089463 | Ga0501047_0089463_835_1494 | 212 |
| 164 | 3300049582 | Ga0501048_0017880 | Ga0501048_0017880_329_988 | 212 |
| 165 | 3300049584 | Ga0501068_0098141 | Ga0501068_0098141_390_1049 | 212 |
| 166 | 3300049586 | Ga0501070_0368577 | Ga0501070_0368577_302_961 | 212 |
| 167 | 3300049589 | Ga0501073_0210732 | Ga0501073_0210732_661_1320 | 212 |
| 168 | 3300049742 | Ga0501080_0787714 | Ga0501080_0787714_35_694 | 212 |
| 169 | 3300049822 | Ga0501035_0036093 | Ga0501035_0036093_1295_1954 | 212 |
| 170 | 3300049822 | Ga0501035_0080880 | Ga0501035_0080880_1310_1969 | 212 |
| 171 | 3300049823 | Ga0501044_0035098 | Ga0501044_0035098_1757_2416 | 212 |
| 172 | 3300049823 | Ga0501044_0084409 | Ga0501044_0084409_2452_3111 | 212 |
| 173 | 3300049823 | Ga0501044_0087273 | Ga0501044_0087273_1329_1988 | 212 |
| 174 | 3300049823 | Ga0501044_0263190 | Ga0501044_0263190_259_918 | 212 |
| 175 | 3300049823 | Ga0501044_0773999 | Ga0501044_0773999_143_802 | 212 |
| 176 | 3300053119 | Ga0500595_018133 | Ga0500595_018133_1272_1916 | 212 |
| 177 | 3300005459 | Ga0068867_100001187 | Ga0068867_10000118710 | 213 |
| 178 | 3300009147 | Ga0114129_11357488 | Ga0114129_113574882 | 213 |
| 179 | 3300009148 | Ga0105243_10003213 | Ga0105243_100032134 | 213 |
| 180 | 3300025926 | Ga0207659_10271674 | Ga0207659_102716741 | 213 |
| 181 | 3300025935 | Ga0207709_10002374 | Ga0207709_100023748 | 213 |
| 182 | 3300026089 | Ga0207648_10001627 | Ga0207648_100016273 | 213 |
| 183 | 3300031507 | Ga0307509_10000084 | Ga0307509_1000008447 | 213 |
| 184 | 3300031507 | Ga0307509_10006230 | Ga0307509_100062304 | 213 |
| 185 | 3300033524 | Ga0316592_1004068 | Ga0316592_10040682 | 213 |
| 186 | 3300033541 | Ga0316596_1001616 | Ga0316596_10016166 | 213 |
| 187 | 3300035092 | Ga0373952_0087788 | Ga0373952_0087788_28_699 | 213 |
| 188 | 3300035398 | Ga0316574_0002666 | Ga0316574_0002666_1516_2166 | 213 |
| 189 | 3300035724 | Ga0373933_0071655 | Ga0373933_0071655_616_1266 | 213 |
| 190 | 3300036401 | Ga0373937_0040810 | Ga0373937_0040810_1067_1717 | 213 |
| 191 | 3300036647 | Ga0316582_0202318 | Ga0316582_0202318_404_1054 | 213 |
| 192 | 3300036712 | Ga0316584_0137509 | Ga0316584_0137509_911_1561 | 213 |
| 193 | 3300042876 | Ga0451577_0015039 | Ga0451577_0015039_3844_4494 | 213 |
| 194 | 3300044656 | Ga0466969_0004100 | Ga0466969_0004100_3971_4627 | 213 |
| 195 | 3300044656 | Ga0466969_0016208 | Ga0466969_0016208_2453_3109 | 213 |
| 196 | 3300044673 | Ga0453683_0010769 | Ga0453683_0010769_1096_1746 | 213 |
| 197 | 3300044684 | Ga0466966_0013592 | Ga0466966_0013592_1134_1790 | 213 |
| 198 | 3300044693 | Ga0466961_0372389 | Ga0466961_0372389_81_737 | 213 |
| 199 | 3300044712 | Ga0453684_0019449 | Ga0453684_0019449_5586_6236 | 213 |
| 200 | 3300044712 | Ga0453684_0106964 | Ga0453684_0106964_65_715 | 213 |
| 201 | 3300044719 | Ga0466971_0031996 | Ga0466971_0031996_248_928 | 213 |
| 202 | 3300044765 | Ga0466970_0309092 | Ga0466970_0309092_15_671 | 213 |
| 203 | 3300045049 | Ga0466959_0009093 | Ga0466959_0009093_5793_6449 | 213 |
| 204 | 3300045049 | Ga0466959_0025665 | Ga0466959_0025665_2624_3280 | 213 |
| 205 | 3300045051 | Ga0451576_0005997 | Ga0451576_0005997_4101_4751 | 213 |
| 206 | 3300047322 | Ga0495680_0182124 | Ga0495680_0182124_637_1287 | 213 |
| 207 | 3300049744 | Ga0501083_0167825 | Ga0501083_0167825_557_1204 | 213 |
| 208 | 3300053092 | Ga0500583_0128632 | Ga0500583_0128632_492_1151 | 213 |
| 209 | 3300053096 | Ga0500641_0053763 | Ga0500641_0053763_412_1071 | 213 |
| 210 | 3300053156 | Ga0500622_0041152 | Ga0500622_0041152_1050_1709 | 213 |
| 211 | 3300005330 | Ga0070690_100105927 | Ga0070690_1001059272 | 214 |
| 212 | 3300006914 | Ga0075436_100129562 | Ga0075436_1001295622 | 214 |
| 213 | 3300007265 | Ga0099794_10003712 | Ga0099794_100037122 | 214 |
| 214 | 3300009094 | Ga0111539_11265748 | Ga0111539_112657481 | 214 |
| 215 | 3300025939 | Ga0207665_10000312 | Ga0207665_1000031221 | 214 |
| 216 | 3300027671 | Ga0209588_1048168 | Ga0209588_10481682 | 214 |
| 217 | 3300041458 | Ga0451798_0168380 | Ga0451798_0168380_219_881 | 214 |
| 218 | 3300042006 | Ga0439432_062065 | Ga0439432_062065_108_791 | 214 |
| 219 | 3300048911 | Ga0496108_0021331 | Ga0496108_0021331_2024_2704 | 214 |
| 220 | 3300049568 | Ga0501031_0019959 | Ga0501031_0019959_3650_4321 | 214 |
| 221 | 3300049569 | Ga0501032_0027818 | Ga0501032_0027818_2366_3037 | 214 |
| 222 | 3300049570 | Ga0501033_0003705 | Ga0501033_0003705_11318_11989 | 214 |
| 223 | 3300049572 | Ga0501036_0053871 | Ga0501036_0053871_1028_1699 | 214 |
| 224 | 3300049575 | Ga0501039_0002030 | Ga0501039_0002030_11468_12139 | 214 |
| 225 | 3300049580 | Ga0501046_0127152 | Ga0501046_0127152_353_1024 | 214 |
| 226 | 3300049822 | Ga0501035_0004547 | Ga0501035_0004547_1018_1689 | 214 |
| 227 | 3300049822 | Ga0501035_0034245 | Ga0501035_0034245_1645_2313 | 214 |
| 228 | 3300050514 | nmdc:mga08x19_52367_c1 | nmdc:mga08x19_52367_c1_836_1495 | 214 |
| 229 | 3300014745 | Ga0157377_10000440 | Ga0157377_100004409 | 215 |
| 230 | 3300006237 | Ga0097621_100484059 | Ga0097621_1004840591 | 216 |
| 231 | 3300053733 | Ga0500552_028149 | Ga0500552_028149_173_832 | 216 |
| 232 | 3300030521 | Ga0307511_10000450 | Ga0307511_1000045028 | 217 |
| 233 | 3300031616 | Ga0307508_10147849 | Ga0307508_101478492 | 217 |
| 234 | 3300053178 | Ga0500637_0009004 | Ga0500637_0009004_1705_2400 | 217 |
| 235 | 3300005539 | Ga0068853_100164687 | Ga0068853_1001646873 | 218 |
| 236 | 3300005844 | Ga0068862_100243550 | Ga0068862_1002435502 | 218 |
| 237 | 3300013100 | Ga0157373_10168267 | Ga0157373_101682672 | 218 |
| 238 | 3300025919 | Ga0207657_10087295 | Ga0207657_100872953 | 218 |
| 239 | 3300028380 | Ga0268265_10342506 | Ga0268265_103425062 | 218 |
| 240 | 3300035113 | Ga0373936_0003187 | Ga0373936_0003187_4949_5620 | 218 |
| 241 | 3300049571 | Ga0501034_0040400 | Ga0501034_0040400_2918_3613 | 218 |
| 242 | 3300049574 | Ga0501038_0389422 | Ga0501038_0389422_292_987 | 218 |
| 243 | 3300009553 | Ga0105249_10009196 | Ga0105249_100091969 | 219 |
| 244 | 3300003203 | JGI25406J46586_10025645 | JGI25406J46586_100256452 | 220 |
| 245 | 3300005355 | Ga0070671_100000443 | Ga0070671_10000044316 | 220 |
| 246 | 3300005367 | Ga0070667_100004228 | Ga0070667_1000042288 | 220 |
| 247 | 3300005544 | Ga0070686_100115885 | Ga0070686_1001158852 | 220 |
| 248 | 3300005617 | Ga0068859_100021277 | Ga0068859_1000212773 | 220 |
| 249 | 3300005618 | Ga0068864_100855528 | Ga0068864_1008555282 | 220 |
| 250 | 3300005719 | Ga0068861_100108786 | Ga0068861_1001087863 | 220 |
| 251 | 3300005841 | Ga0068863_100005373 | Ga0068863_1000053732 | 220 |
| 252 | 3300005842 | Ga0068858_100120289 | Ga0068858_1001202893 | 220 |
| 253 | 3300005843 | Ga0068860_100099934 | Ga0068860_1000999342 | 220 |
| 254 | 3300005937 | Ga0081455_10000032 | Ga0081455_1000003295 | 220 |
| 255 | 3300005985 | Ga0081539_10000007 | Ga0081539_10000007275 | 220 |
| 256 | 3300006931 | Ga0097620_100021279 | Ga0097620_1000212793 | 220 |
| 257 | 3300006931 | Ga0097620_100120303 | Ga0097620_1001203032 | 220 |
| 258 | 3300009101 | Ga0105247_10007171 | Ga0105247_100071713 | 220 |
| 259 | 3300009177 | Ga0105248_10067308 | Ga0105248_100673082 | 220 |
| 260 | 3300011119 | Ga0105246_10202554 | Ga0105246_102025542 | 220 |
| 261 | 3300013306 | Ga0163162_10010572 | Ga0163162_100105722 | 220 |
| 262 | 3300014325 | Ga0163163_10077495 | Ga0163163_100774953 | 220 |
| 263 | 3300025900 | Ga0207710_10004066 | Ga0207710_100040663 | 220 |
| 264 | 3300025931 | Ga0207644_10016867 | Ga0207644_100168673 | 220 |
| 265 | 3300025941 | Ga0207711_10267324 | Ga0207711_102673242 | 220 |
| 266 | 3300025986 | Ga0207658_10221934 | Ga0207658_102219342 | 220 |
| 267 | 3300026035 | Ga0207703_10001917 | Ga0207703_100019172 | 220 |
| 268 | 3300026088 | Ga0207641_10128585 | Ga0207641_101285853 | 220 |
| 269 | 3300026118 | Ga0207675_100102529 | Ga0207675_1001025293 | 220 |
| 270 | 3300028379 | Ga0268266_10077202 | Ga0268266_100772023 | 220 |
| 271 | 3300028380 | Ga0268265_10033764 | Ga0268265_100337642 | 220 |
| 272 | 3300031507 | Ga0307509_10254946 | Ga0307509_102549462 | 220 |
| 273 | 3300046684 | Ga0495669_0174310 | Ga0495669_0174310_197_877 | 220 |
| 274 | 3300048905 | Ga0496102_0253980 | Ga0496102_0253980_760_1485 | 220 |
| 275 | 3300048911 | Ga0496108_0182096 | Ga0496108_0182096_97_822 | 220 |
| 276 | 3300048915 | Ga0496112_0221633 | Ga0496112_0221633_400_1125 | 220 |
| 277 | 3300048922 | Ga0496119_0208098 | Ga0496119_0208098_51_776 | 220 |
| 278 | 3300048924 | Ga0496121_0002531 | Ga0496121_0002531_4429_5154 | 220 |
| 279 | 3300048928 | Ga0496125_0097927 | Ga0496125_0097927_995_1720 | 220 |
| 280 | 3300053093 | Ga0500651_0278808 | Ga0500651_0278808_108_788 | 220 |
| 281 | 3300053134 | Ga0500658_0028634 | Ga0500658_0028634_1167_1847 | 220 |
| 282 | 3300053153 | Ga0500616_0003475 | Ga0500616_0003475_3867_4547 | 220 |
| 283 | 3300053732 | Ga0500656_016844 | Ga0500656_016844_169_849 | 220 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3oru-assembly1.cif.gz_A | crystal structure of a duf1989 family protein (tm1040_0329) from silicibacter sp. tm1040 at 1.11 a resolution | 0.8062 | 18 | 220 |
| 3di4-assembly1.cif.gz_B | crystal structure of a duf1989 family protein (spo0365) from silicibacter pomeroyi dss-3 at 1.60 a resolution | 0.8043 | 18 | 219 |
| 3oru-assembly1.cif.gz_A | crystal structure of a duf1989 family protein (tm1040_0329) from silicibacter sp. tm1040 at 1.11 a resolution | 0.7409 | 18 | 220 |
| 3di4-assembly1.cif.gz_B | crystal structure of a duf1989 family protein (spo0365) from silicibacter pomeroyi dss-3 at 1.60 a resolution | 0.7396 | 18 | 219 |
| 4c0h-assembly1.cif.gz_B | extended interface between pcf11p and clp1p and structural basis for atp loss in gly135arg point mutant | 0.5423 | 28 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54N48_42_118_2.60.120.1030 | Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain | 0.6544 | 28 | 196 | 2.60.120.1030 |
| af_E7F3I6_19_100_2.60.120.1030 | Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain | 0.6127 | 28 | 195 | 2.60.120.1030 |
| 4c0bB01 | Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain | 0.6067 | 25 | 195 | 2.60.120.1030 |
| af_Q4DN69_1_81_2.60.120.1030 | Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain | 0.5924 | 23 | 216 | 2.60.120.1030 |
| af_Q54N48_42_118_2.60.120.1030 | Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain | 0.5814 | 28 | 196 | 2.60.120.1030 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A355JNQ3-F1-model_v4 | deleted | 0.9838 | 8 | 107 |
|
| AF-A0A3D4LXJ8-F1-model_v4 | deleted | 0.9684 | 55 | 108 |
|
| AF-A0A355JNQ3-F1-model_v4 | deleted | 0.9647 | 8 | 107 |
|
| AF-A0A7H4NJH7-F1-model_v4 | deleted | 0.9591 | 8 | 98 |
|
| AF-A0A4V1QZG3-F1-model_v4 | deleted | 0.9564 | 8 | 118 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar