F385322

General Info

Members Datasets Scaffolds Average Seq Length
283 173 566 224

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10039669|JGI25404J52841_100396691
Length 223
Sequence VGLFGFNKTAMVTPEEALPGRSNPMPVPARHEVLGGPLQPPYPAGTEVAEFALGCFWGAEKMFWQIPGVVTTAVGYEGGFTPNPTYEEVCSGRTGHAESVRVVFDPTKVSYSDLLKAFWESHNPTQGLRQGNDVGSQYRSVSVIFYNSPAQKAAAEESRTAYQKKLSEAGYGEITTEIVPAGEFYFAEDYHQQYLSDAKNPYGYCPDHGTGVSCPIGVVSADG

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
76 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
89 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
90 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
92 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
171 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
172 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
173 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.76
Metatranscriptomes 3.18
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0.35
Rhizoplane 6.71
Rhizosphere 89.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10039669 3300003659 Bacteria 997
2 Ga0070658_10002058 3300005327 Bacteria 16872
3 Ga0070680_100213053 3300005336 Bacteria 1630
4 Ga0070714_100000467 3300005435 Bacteria 29373
5 Ga0070714_100185847 3300005435 Bacteria 1893
6 Ga0070714_100939241 3300005435 Bacteria 840
7 Ga0070713_100053976 3300005436 Bacteria 3332
8 Ga0070713_100076683 3300005436 Bacteria 2840
9 Ga0070711_100154161 3300005439 Bacteria 1735
10 Ga0070705_100082694 3300005440 Bacteria 1976
11 Ga0070708_100046473 3300005445 Bacteria 3831
12 Ga0070708_100072624 3300005445 Bacteria 3100
13 Ga0070706_100008105 3300005467 Bacteria 9797
14 Ga0070706_100011755 3300005467 Bacteria 8123
15 Ga0070706_100025402 3300005467 Bacteria 5451
16 Ga0070706_100222099 3300005467 Bacteria 1763
17 Ga0070706_100360574 3300005467 Bacteria 1355
18 Ga0070707_100003685 3300005468 Bacteria 14453
19 Ga0070707_100016052 3300005468 Bacteria 7024
20 Ga0070707_100026788 3300005468 Bacteria 5477
21 Ga0070707_100146152 3300005468 Bacteria 2301
22 Ga0070698_100029901 3300005471 Bacteria 5652
23 Ga0070698_100057073 3300005471 Bacteria 3952
24 Ga0070699_100010757 3300005518 Bacteria 7919
25 Ga0070699_100511241 3300005518 Bacteria 1092
26 Ga0070699_100561320 3300005518 Bacteria 1039
27 Ga0070684_100002107 3300005535 Bacteria 14652
28 Ga0070684_100090128 3300005535 Bacteria 2726
29 Ga0070697_100118338 3300005536 Bacteria 2214
30 Ga0070665_100261144 3300005548 Bacteria 1733
31 Ga0070664_100027360 3300005564 Bacteria 4739
32 Ga0068856_100080192 3300005614 Bacteria 3237
33 Ga0068856_100218454 3300005614 Bacteria 1921
34 Ga0070702_100237737 3300005615 Bacteria 1228
35 Ga0068864_100010849 3300005618 Bacteria 7531
36 Ga0068864_100031832 3300005618 Bacteria 4477
37 Ga0068863_100056635 3300005841 Bacteria 3711
38 Ga0068858_100052939 3300005842 Bacteria 3756
39 Ga0068860_100265184 3300005843 Bacteria 1675
40 Ga0081540_1000693 3300005983 Bacteria 31415
41 Ga0081540_1001294 3300005983 Bacteria 21844
42 Ga0070717_10002483 3300006028 Bacteria 13020
43 Ga0070717_10029410 3300006028 Bacteria 4407
44 Ga0070717_10129796 3300006028 Bacteria 2166
45 Ga0070717_10147061 3300006028 Bacteria 2036
46 Ga0070717_10258540 3300006028 Bacteria 1540
47 Ga0070717_10344811 3300006028 Bacteria 1331
48 Ga0075364_10004518 3300006051 Bacteria 8015
49 Ga0070715_10021364 3300006163 Bacteria 2509
50 Ga0070715_10064417 3300006163 Bacteria 1619
51 Ga0070716_100037928 3300006173 Bacteria 2665
52 Ga0070716_100051256 3300006173 Bacteria 2345
53 Ga0097621_100022203 3300006237 Bacteria 4923
54 Ga0068871_100142674 3300006358 Bacteria 2038
55 Ga0075434_100011221 3300006871 Bacteria 8436
56 Ga0075434_100885010 3300006871 Bacteria 908
57 Ga0075436_100043138 3300006914 Bacteria 3110
58 Ga0075436_100483397 3300006914 Bacteria 904
59 Ga0075435_100147562 3300007076 Bacteria 1976
60 Ga0075435_100151659 3300007076 Bacteria 1949
61 Ga0111539_10168416 3300009094 Bacteria 2560
62 Ga0105247_10000020 3300009101 Bacteria 233167
63 Ga0105247_10214597 3300009101 Bacteria 1299
64 Ga0105242_10128630 3300009176 Bacteria 2183
65 Ga0105248_10001046 3300009177 Bacteria 30639
66 Ga0105248_10160590 3300009177 Bacteria 2535
67 Ga0157370_10645830 3300013104 Bacteria 967
68 Ga0157374_10051934 3300013296 Bacteria 3816
69 Ga0163162_10264692 3300013306 Bacteria 1851
70 Ga0157372_10526297 3300013307 Bacteria 1378
71 Ga0163163_10014895 3300014325 Bacteria 7164
72 Ga0163163_10064706 3300014325 Bacteria 3628
73 Ga0157379_10007982 3300014968 Bacteria 9181
74 Ga0157379_10008272 3300014968 Bacteria 9039
75 Ga0157379_10392595 3300014968 Bacteria 1274
76 Ga0157376_10032869 3300014969 Bacteria 4170
77 Ga0197907_10329644 3300020069 Bacteria 2408
78 Ga0197907_11001200 3300020069 Bacteria 852
79 Ga0206356_10994640 3300020070 Bacteria 1110
80 Ga0206349_1965794 3300020075 Bacteria 793
81 Ga0206350_10582962 3300020080 Bacteria 1248
82 Ga0206353_10320356 3300020082 Bacteria 846
83 Ga0224712_10002750 3300022467 Bacteria 4423
84 Ga0224712_10012439 3300022467 Bacteria 2678
85 Ga0224712_10071054 3300022467 Bacteria 1413
86 Ga0207692_10048689 3300025898 Bacteria 2135
87 Ga0207692_10095437 3300025898 Bacteria 1622
88 Ga0207710_10000011 3300025900 Bacteria 428560
89 Ga0207710_10108183 3300025900 Bacteria 1318
90 Ga0207685_10019639 3300025905 Bacteria 2231
91 Ga0207699_10018832 3300025906 Bacteria 3666
92 Ga0207699_10020860 3300025906 Bacteria 3520
93 Ga0207705_10002492 3300025909 Bacteria 14181
94 Ga0207705_10198084 3300025909 Bacteria 1521
95 Ga0207684_10011055 3300025910 Bacteria 7906
96 Ga0207684_10196726 3300025910 Bacteria 1739
97 Ga0207684_10271990 3300025910 Bacteria 1462
98 Ga0207693_10068611 3300025915 Bacteria 2775
99 Ga0207693_10159940 3300025915 Bacteria 1772
100 Ga0207663_10047750 3300025916 Bacteria 2645
101 Ga0207663_10080668 3300025916 Bacteria 2128
102 Ga0207660_10035687 3300025917 Bacteria 3454
103 Ga0207657_10086452 3300025919 Bacteria 2624
104 Ga0207652_10209568 3300025921 Bacteria 1755
105 Ga0207646_10003617 3300025922 Bacteria 17307
106 Ga0207646_10008639 3300025922 Bacteria 10184
107 Ga0207646_10010695 3300025922 Bacteria 8933
108 Ga0207646_10041424 3300025922 Bacteria 4140
109 Ga0207646_10053036 3300025922 Bacteria 3628
110 Ga0207646_10057501 3300025922 Bacteria 3474
111 Ga0207700_10079541 3300025928 Bacteria 2553
112 Ga0207700_10125808 3300025928 Bacteria 2085
113 Ga0207664_10000430 3300025929 Bacteria 29958
114 Ga0207664_10047759 3300025929 Bacteria 3364
115 Ga0207664_10059782 3300025929 Bacteria 3036
116 Ga0207664_10195961 3300025929 Bacteria 1741
117 Ga0207686_10226616 3300025934 Bacteria 1353
118 Ga0207665_10071963 3300025939 Bacteria 2361
119 Ga0207665_10091199 3300025939 Bacteria 2112
120 Ga0207711_10036657 3300025941 Bacteria 4162
121 Ga0207661_10004739 3300025944 Bacteria 9527
122 Ga0207679_10060903 3300025945 Bacteria 2807
123 Ga0207667_10361070 3300025949 Bacteria 1481
124 Ga0207667_10732583 3300025949 Bacteria 989
125 Ga0207667_10807591 3300025949 Bacteria 934
126 Ga0207702_10403770 3300026078 Bacteria 1318
127 Ga0207641_10057347 3300026088 Bacteria 3312
128 Ga0268266_10385798 3300028379 Bacteria 1322
129 Ga0268265_10707602 3300028380 Bacteria 974
130 Ga0265338_10001380 3300028800 Bacteria 39522
131 Ga0265338_10110930 3300028800 Bacteria 2210
132 Ga0265328_10012575 3300031239 Bacteria 3366
133 Ga0265340_10004359 3300031247 Bacteria 7928
134 Ga0265339_10013214 3300031249 Bacteria 5007
135 Ga0307513_10407909 3300031456 Bacteria 1092
136 Ga0307508_10004259 3300031616 Bacteria 14042
137 Ga0265342_10028745 3300031712 Bacteria 3459
138 Ga0307516_10117943 3300031730 Bacteria 2448
139 Ga0307413_10165216 3300031824 Bacteria 1560
140 Ga0307410_10027897 3300031852 Bacteria 3573
141 Ga0307409_100231603 3300031995 Bacteria 1675
142 Ga0307416_100379520 3300032002 Bacteria 1443
143 Ga0307414_10234984 3300032004 Bacteria 1514
144 Ga0307415_100118847 3300032126 Bacteria 1977
145 Ga0373938_0094560 3300034957 Bacteria 743
146 Ga0373928_0103151 3300035084 Bacteria 746
147 Ga0373923_0264872 3300035111 Bacteria 807
148 Ga0373932_0024080 3300035112 Bacteria 1635
149 Ga0373953_0001904 3300035117 Bacteria 6185
150 Ga0373954_0011058 3300035118 Bacteria 3994
151 Ga0373956_0000647 3300035119 Bacteria 14302
152 Ga0373957_0000047 3300035120 Bacteria 31450
153 Ga0373955_0000020 3300035172 Bacteria 63100
154 Ga0373955_0225271 3300035172 Bacteria 1121
155 Ga0373955_0248893 3300035172 Bacteria 1065
156 Ga0373924_0128618 3300035410 Bacteria 1101
157 Ga0373933_0000192 3300035724 Bacteria 40573
158 Ga0373933_0009616 3300035724 Bacteria 5281
159 Ga0373933_0129219 3300035724 Bacteria 1587
160 Ga0373933_0156354 3300035724 Bacteria 1446
161 Ga0373937_0000067 3300036401 Bacteria 94291
162 Ga0373937_0017230 3300036401 Bacteria 6431
163 Ga0373937_0038528 3300036401 Bacteria 4355
164 Ga0373937_0070731 3300036401 Bacteria 3218
165 Ga0373925_0009875 3300037068 Bacteria 6935
166 Ga0395898_0058453 3300037466 Bacteria 3753
167 Ga0395905_0411883 3300037471 Bacteria 1247
168 Ga0436364_0735260 3300037853 Bacteria 16919
169 Ga0395901_0184492 3300038443 Bacteria 2188
170 Ga0466966_0002655 3300044684 Bacteria 11713
171 Ga0466963_0017570 3300044694 Bacteria 4461
172 Ga0466968_0170477 3300044735 Bacteria 1008
173 Ga0466970_0028609 3300044765 Bacteria 2930
174 Ga0466957_0056009 3300044842 Bacteria 2410
175 Ga0466957_0281948 3300044842 Bacteria 1112
176 Ga0466959_0004929 3300045049 Bacteria 9041
177 Ga0466967_0023378 3300045976 Bacteria 5064
178 Ga0466967_0067976 3300045976 Bacteria 3180
179 Ga0466967_1058530 3300045976 Bacteria 808
180 Ga0495592_0000069 3300046454 Bacteria 94288
181 Ga0495592_0002328 3300046454 Bacteria 13417
182 Ga0495629_0004971 3300046459 Bacteria 9973
183 Ga0495641_0012217 3300046461 Bacteria 4820
184 Ga0495651_0000016 3300046462 Bacteria 125612
185 Ga0495651_0002503 3300046462 Bacteria 14207
186 Ga0495651_0003782 3300046462 Bacteria 11577
187 Ga0495651_0127689 3300046462 Bacteria 1860
188 Ga0495653_0002113 3300046463 Bacteria 15661
189 Ga0495653_0009555 3300046463 Bacteria 7934
190 Ga0495653_0010907 3300046463 Bacteria 7439
191 Ga0495582_0087706 3300046473 Bacteria 1732
192 Ga0495582_0422323 3300046473 Bacteria 769
193 Ga0495639_0023805 3300046475 Bacteria 2693
194 Ga0495662_0008724 3300046476 Bacteria 4985
195 Ga0495608_0000051 3300046511 Bacteria 94719
196 Ga0495608_0021577 3300046511 Bacteria 4419
197 Ga0495608_0033262 3300046511 Bacteria 3486
198 Ga0495618_0089489 3300046514 Bacteria 1968
199 Ga0495628_0000723 3300046516 Bacteria 30611
200 Ga0495628_0014019 3300046516 Bacteria 6729
201 Ga0495628_0596436 3300046516 Bacteria 789
202 Ga0495630_0051527 3300046517 Bacteria 3081
203 Ga0495652_0004286 3300046529 Bacteria 13676
204 Ga0495652_0007960 3300046529 Bacteria 9730
205 Ga0495652_0132982 3300046529 Bacteria 1966
206 Ga0495652_0435861 3300046529 Bacteria 920
207 Ga0495665_0009167 3300046531 Bacteria 5363
208 Ga0495640_0022051 3300046533 Bacteria 4663
209 Ga0495587_0000058 3300046536 Bacteria 94307
210 Ga0495587_0001406 3300046536 Bacteria 15995
211 Ga0495645_0009397 3300046543 Bacteria 6834
212 Ga0495645_0135372 3300046543 Bacteria 1724
213 Ga0495667_0000062 3300046559 Bacteria 94307
214 Ga0495667_0012060 3300046559 Bacteria 5852
215 Ga0495667_0076289 3300046559 Bacteria 2180
216 Ga0495634_0055170 3300046642 Bacteria 2657
217 Ga0495635_0004473 3300046663 Bacteria 9683
218 Ga0495635_0038735 3300046663 Bacteria 3299
219 Ga0495657_0000065 3300046675 Bacteria 94307
220 Ga0495657_0010126 3300046675 Bacteria 7103
221 Ga0495657_0036078 3300046675 Bacteria 3420
222 Ga0495599_0000045 3300046678 Bacteria 86086
223 Ga0495599_0004065 3300046678 Bacteria 8619
224 Ga0495623_0000051 3300046679 Bacteria 72814
225 Ga0495623_0008005 3300046679 Bacteria 6867
226 Ga0495646_0004909 3300046680 Bacteria 8449
227 Ga0495646_0005666 3300046680 Bacteria 7910
228 Ga0495658_0079694 3300046683 Bacteria 1919
229 Ga0495613_0018386 3300046689 Bacteria 5212
230 Ga0495600_0009949 3300046809 Bacteria 5891
231 Ga0495600_0021266 3300046809 Bacteria 4152
232 Ga0495581_0013222 3300047315 Bacteria 4787
233 Ga0495604_0001081 3300047317 Bacteria 22603
234 Ga0495604_0019942 3300047317 Bacteria 5360
235 Ga0495674_0055364 3300047319 Bacteria 3479
236 Ga0495674_0075230 3300047319 Bacteria 2906
237 Ga0495680_0000678 3300047322 Bacteria 38049
238 Ga0495680_0006076 3300047322 Bacteria 11278
239 Ga0495680_0013572 3300047322 Bacteria 7099
240 Ga0495675_0001277 3300047444 Bacteria 15256
241 Ga0495675_0007865 3300047444 Bacteria 6588
242 Ga0495684_0003299 3300047471 Bacteria 12677
243 Ga0495684_0207987 3300047471 Bacteria 1440
244 Ga0495602_0000079 3300048088 Bacteria 94307
245 Ga0495602_0015844 3300048088 Bacteria 7593
246 Ga0495602_0398252 3300048088 Bacteria 982
247 Ga0496100_0063727 3300048903 Bacteria 2437
248 Ga0496100_0443031 3300048903 Bacteria 995
249 Ga0496101_0126053 3300048904 Bacteria 1940
250 Ga0496102_0183465 3300048905 Bacteria 1971
251 Ga0496104_0003033 3300048907 Bacteria 14467
252 Ga0496104_0086839 3300048907 Bacteria 2987
253 Ga0496105_0027202 3300048908 Bacteria 4670
254 Ga0496105_0089916 3300048908 Bacteria 2536
255 Ga0496106_0328656 3300048909 Bacteria 1227
256 Ga0496106_0912150 3300048909 Bacteria 693
257 Ga0496108_0034072 3300048911 Bacteria 4230
258 Ga0496108_0492938 3300048911 Bacteria 1070
259 Ga0496109_0178262 3300048912 Bacteria 1995
260 Ga0496109_0322277 3300048912 Bacteria 1458
261 Ga0496111_0009646 3300048914 Bacteria 6449
262 Ga0496112_0027522 3300048915 Bacteria 5482
263 Ga0496113_0529742 3300048916 Bacteria 945
264 Ga0496113_0602897 3300048916 Bacteria 879
265 Ga0496115_0046513 3300048918 Bacteria 3468
266 Ga0496119_0000805 3300048922 Bacteria 41988
267 Ga0496120_0001319 3300048923 Bacteria 30676
268 Ga0496126_0318640 3300048929 Bacteria 1279
269 Ga0501047_0006405 3300049581 Bacteria 11076
270 Ga0501047_0046419 3300049581 Bacteria 4198
271 Ga0501070_0009919 3300049586 Bacteria 8051
272 Ga0501081_0159128 3300049743 Bacteria 1627
273 nmdc:mga08y16_164298_c1 3300050511 Bacteria 2306
274 nmdc:mga0n895_54798_c1 3300050512 Bacteria 3924
275 nmdc:mga08x19_23529_c1 3300050514 Bacteria 3822
276 nmdc:mga08x19_251290_c1 3300050514 Bacteria 1221
277 Ga0495601_0179583 3300053077 Bacteria 1384
278 Ga0495595_0008246 3300053084 Bacteria 4279
279 Ga0501084_0033385 3300054114 Bacteria 4306
280 Ga0466962_0022004 3300061719 Bacteria 3062
281 2512032092 2511231221 Bacteria 6846400
282 2513593201 2513237087 Bacteria 5817514
283 3003000785 3002998708 Bacteria 11715108
284 JGI25404J52841_10039669
285 Ga0070658_10002058
286 Ga0070680_100213053
287 Ga0070714_100000467
288 Ga0070714_100185847
289 Ga0070714_100939241
290 Ga0070713_100053976
291 Ga0070713_100076683
292 Ga0070711_100154161
293 Ga0070705_100082694
294 Ga0070708_100046473
295 Ga0070708_100072624
296 Ga0070706_100008105
297 Ga0070706_100011755
298 Ga0070706_100025402
299 Ga0070706_100222099
300 Ga0070706_100360574
301 Ga0070707_100003685
302 Ga0070707_100016052
303 Ga0070707_100026788
304 Ga0070707_100146152
305 Ga0070698_100029901
306 Ga0070698_100057073
307 Ga0070699_100010757
308 Ga0070699_100511241
309 Ga0070699_100561320
310 Ga0070684_100002107
311 Ga0070684_100090128
312 Ga0070697_100118338
313 Ga0070665_100261144
314 Ga0070664_100027360
315 Ga0068856_100080192
316 Ga0068856_100218454
317 Ga0070702_100237737
318 Ga0068864_100010849
319 Ga0068864_100031832
320 Ga0068863_100056635
321 Ga0068858_100052939
322 Ga0068860_100265184
323 Ga0081540_1000693
324 Ga0081540_1001294
325 Ga0070717_10002483
326 Ga0070717_10029410
327 Ga0070717_10129796
328 Ga0070717_10147061
329 Ga0070717_10258540
330 Ga0070717_10344811
331 Ga0075364_10004518
332 Ga0070715_10021364
333 Ga0070715_10064417
334 Ga0070716_100037928
335 Ga0070716_100051256
336 Ga0097621_100022203
337 Ga0068871_100142674
338 Ga0075434_100011221
339 Ga0075434_100885010
340 Ga0075436_100043138
341 Ga0075436_100483397
342 Ga0075435_100147562
343 Ga0075435_100151659
344 Ga0111539_10168416
345 Ga0105247_10000020
346 Ga0105247_10214597
347 Ga0105242_10128630
348 Ga0105248_10001046
349 Ga0105248_10160590
350 Ga0157370_10645830
351 Ga0157374_10051934
352 Ga0163162_10264692
353 Ga0157372_10526297
354 Ga0163163_10014895
355 Ga0163163_10064706
356 Ga0157379_10007982
357 Ga0157379_10008272
358 Ga0157379_10392595
359 Ga0157376_10032869
360 Ga0197907_10329644
361 Ga0197907_11001200
362 Ga0206356_10994640
363 Ga0206349_1965794
364 Ga0206350_10582962
365 Ga0206353_10320356
366 Ga0224712_10002750
367 Ga0224712_10012439
368 Ga0224712_10071054
369 Ga0207692_10048689
370 Ga0207692_10095437
371 Ga0207710_10000011
372 Ga0207710_10108183
373 Ga0207685_10019639
374 Ga0207699_10018832
375 Ga0207699_10020860
376 Ga0207705_10002492
377 Ga0207705_10198084
378 Ga0207684_10011055
379 Ga0207684_10196726
380 Ga0207684_10271990
381 Ga0207693_10068611
382 Ga0207693_10159940
383 Ga0207663_10047750
384 Ga0207663_10080668
385 Ga0207660_10035687
386 Ga0207657_10086452
387 Ga0207652_10209568
388 Ga0207646_10003617
389 Ga0207646_10008639
390 Ga0207646_10010695
391 Ga0207646_10041424
392 Ga0207646_10053036
393 Ga0207646_10057501
394 Ga0207700_10079541
395 Ga0207700_10125808
396 Ga0207664_10000430
397 Ga0207664_10047759
398 Ga0207664_10059782
399 Ga0207664_10195961
400 Ga0207686_10226616
401 Ga0207665_10071963
402 Ga0207665_10091199
403 Ga0207711_10036657
404 Ga0207661_10004739
405 Ga0207679_10060903
406 Ga0207667_10361070
407 Ga0207667_10732583
408 Ga0207667_10807591
409 Ga0207702_10403770
410 Ga0207641_10057347
411 Ga0268266_10385798
412 Ga0268265_10707602
413 Ga0265338_10001380
414 Ga0265338_10110930
415 Ga0265328_10012575
416 Ga0265340_10004359
417 Ga0265339_10013214
418 Ga0307513_10407909
419 Ga0307508_10004259
420 Ga0265342_10028745
421 Ga0307516_10117943
422 Ga0307413_10165216
423 Ga0307410_10027897
424 Ga0307409_100231603
425 Ga0307416_100379520
426 Ga0307414_10234984
427 Ga0307415_100118847
428 Ga0373938_0094560
429 Ga0373928_0103151
430 Ga0373923_0264872
431 Ga0373932_0024080
432 Ga0373953_0001904
433 Ga0373954_0011058
434 Ga0373956_0000647
435 Ga0373957_0000047
436 Ga0373955_0000020
437 Ga0373955_0225271
438 Ga0373955_0248893
439 Ga0373924_0128618
440 Ga0373933_0000192
441 Ga0373933_0009616
442 Ga0373933_0129219
443 Ga0373933_0156354
444 Ga0373937_0000067
445 Ga0373937_0017230
446 Ga0373937_0038528
447 Ga0373937_0070731
448 Ga0373925_0009875
449 Ga0395898_0058453
450 Ga0395905_0411883
451 Ga0436364_0735260
452 Ga0395901_0184492
453 Ga0466966_0002655
454 Ga0466963_0017570
455 Ga0466968_0170477
456 Ga0466970_0028609
457 Ga0466957_0056009
458 Ga0466957_0281948
459 Ga0466959_0004929
460 Ga0466967_0023378
461 Ga0466967_0067976
462 Ga0466967_1058530
463 Ga0495592_0000069
464 Ga0495592_0002328
465 Ga0495629_0004971
466 Ga0495641_0012217
467 Ga0495651_0000016
468 Ga0495651_0002503
469 Ga0495651_0003782
470 Ga0495651_0127689
471 Ga0495653_0002113
472 Ga0495653_0009555
473 Ga0495653_0010907
474 Ga0495582_0087706
475 Ga0495582_0422323
476 Ga0495639_0023805
477 Ga0495662_0008724
478 Ga0495608_0000051
479 Ga0495608_0021577
480 Ga0495608_0033262
481 Ga0495618_0089489
482 Ga0495628_0000723
483 Ga0495628_0014019
484 Ga0495628_0596436
485 Ga0495630_0051527
486 Ga0495652_0004286
487 Ga0495652_0007960
488 Ga0495652_0132982
489 Ga0495652_0435861
490 Ga0495665_0009167
491 Ga0495640_0022051
492 Ga0495587_0000058
493 Ga0495587_0001406
494 Ga0495645_0009397
495 Ga0495645_0135372
496 Ga0495667_0000062
497 Ga0495667_0012060
498 Ga0495667_0076289
499 Ga0495634_0055170
500 Ga0495635_0004473
501 Ga0495635_0038735
502 Ga0495657_0000065
503 Ga0495657_0010126
504 Ga0495657_0036078
505 Ga0495599_0000045
506 Ga0495599_0004065
507 Ga0495623_0000051
508 Ga0495623_0008005
509 Ga0495646_0004909
510 Ga0495646_0005666
511 Ga0495658_0079694
512 Ga0495613_0018386
513 Ga0495600_0009949
514 Ga0495600_0021266
515 Ga0495581_0013222
516 Ga0495604_0001081
517 Ga0495604_0019942
518 Ga0495674_0055364
519 Ga0495674_0075230
520 Ga0495680_0000678
521 Ga0495680_0006076
522 Ga0495680_0013572
523 Ga0495675_0001277
524 Ga0495675_0007865
525 Ga0495684_0003299
526 Ga0495684_0207987
527 Ga0495602_0000079
528 Ga0495602_0015844
529 Ga0495602_0398252
530 Ga0496100_0063727
531 Ga0496100_0443031
532 Ga0496101_0126053
533 Ga0496102_0183465
534 Ga0496104_0003033
535 Ga0496104_0086839
536 Ga0496105_0027202
537 Ga0496105_0089916
538 Ga0496106_0328656
539 Ga0496106_0912150
540 Ga0496108_0034072
541 Ga0496108_0492938
542 Ga0496109_0178262
543 Ga0496109_0322277
544 Ga0496111_0009646
545 Ga0496112_0027522
546 Ga0496113_0529742
547 Ga0496113_0602897
548 Ga0496115_0046513
549 Ga0496119_0000805
550 Ga0496120_0001319
551 Ga0496126_0318640
552 Ga0501047_0006405
553 Ga0501047_0046419
554 Ga0501070_0009919
555 Ga0501081_0159128
556 nmdc:mga08y16_164298_c1
557 nmdc:mga0n895_54798_c1
558 nmdc:mga08x19_23529_c1
559 nmdc:mga08x19_251290_c1
560 Ga0495601_0179583
561 Ga0495595_0008246
562 Ga0501084_0033385
563 Ga0466962_0022004
564 2512032092
565 2513593201
566 3003000785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

48

206

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fva-assembly2.cif.gz_B crystal structure of bovine methionine sulfoxide reductase 0.9581 11 215
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9554 10 203
1fva-assembly2.cif.gz_B crystal structure of bovine methionine sulfoxide reductase 0.9534 11 215
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.9518 11 195
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9505 10 203
ID Description Score Start End Superfamily
1ff3B00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9246 6 195 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9166 47 195 3.30.1060.10
af_O02089_1_199_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9073 43 195 3.30.1060.10
4lwkB00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.895 47 195 3.30.1060.10
af_P0A084_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.8947 45 202 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A3D1B5F6-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9971 8 124 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A6P9BMM5-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) 0.9924 9 129 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A7V9SIQ1-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9924 8 104 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A834DWX0-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) 0.9907 30 127 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A7C5WT86-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9879 9 105 GO:0005737
GO:0008113
GO:0034599
GO:0036456

Map