F385209

General Info

Members Datasets Scaffolds Average Seq Length
282 188 564 258

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0000609|Ga0501043_0000609_3225_4178
Length 317
Sequence LIVNSGWRGWHIDDVCVEGRFPGRLACGCAKWLAHYNGAAGWPLAGGGGLRTKGRSMVSLDRLSKRFGIPPGPVQTAVDEISFAXXXXQIVGFLGPNGAGKSTTLKMLTGMLQPTCGTATICGFDLLKDPLEVKKRVGFVPESAAVFESLTGLEYLEMVASLYAIPREAALERIRQFISFFDLSFETLTEKLLGAYSKGMRRKVVITSALLHNPPVVFFDEPLDGLDANAAVGFKTLIQTLAREGKTIVYSSHILDVVERVCHRVIIIDKGKLLLDGAPEELIATHQAATLEQLFTRLTGGTELERRAQEFARTFRP

Samples

Sample ID Description Type Environment
1 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
117 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
118 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
172 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 1.06
Rhizosphere 96.81
Stem 0
Stem Tuber 0
Unclassified 3.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501043_0000609 3300049579 Bacteria 31671
2 rootH2_10036148 3300003320 Bacteria 11060
3 rootH1_10075524 3300003323 Bacteria 5873
4 Ga0065704_10087423 3300005289 Bacteria 3024
5 Ga0065704_10154907 3300005289 Bacteria 1399
6 Ga0065707_10137618 3300005295 Bacteria 1817
7 Ga0070658_10005946 3300005327 Bacteria 9901
8 Ga0070658_10029244 3300005327 Bacteria 4426
9 Ga0070670_100133674 3300005331 Bacteria 2143
10 Ga0070666_10030245 3300005335 Bacteria 3567
11 Ga0070682_100154444 3300005337 Bacteria 1578
12 Ga0068868_100417400 3300005338 Bacteria 1161
13 Ga0070660_100251429 3300005339 Bacteria 1441
14 Ga0070689_100043937 3300005340 Unclassified 3437
15 Ga0070689_100427378 3300005340 Bacteria 1124
16 Ga0070691_10125792 3300005341 Bacteria 1295
17 Ga0070687_100067996 3300005343 Bacteria 1903
18 Ga0070675_100060191 3300005354 Bacteria 3135
19 Ga0070673_100002124 3300005364 Bacteria 12001
20 Ga0070714_100082438 3300005435 Bacteria 2802
21 Ga0070701_10018646 3300005438 Bacteria 3264
22 Ga0070705_100159200 3300005440 Bacteria 1507
23 Ga0070705_100250643 3300005440 Bacteria 1243
24 Ga0070705_100401392 3300005440 Bacteria 1015
25 Ga0070694_100011258 3300005444 Bacteria 5538
26 Ga0070681_10002533 3300005458 Bacteria 16748
27 Ga0070681_10037542 3300005458 Bacteria 4861
28 Ga0068867_100056133 3300005459 Bacteria 2913
29 Ga0070685_10256799 3300005466 Bacteria 1160
30 Ga0070679_100076384 3300005530 Bacteria 3340
31 Ga0070684_100164265 3300005535 Bacteria 2015
32 Ga0070672_100274743 3300005543 Bacteria 1423
33 Ga0070686_100002377 3300005544 Bacteria 10367
34 Ga0070686_100002702 3300005544 Bacteria 9761
35 Ga0070686_100086319 3300005544 Unclassified 2089
36 Ga0070686_100172618 3300005544 Bacteria 1530
37 Ga0070686_100208404 3300005544 Bacteria 1405
38 Ga0070695_100499956 3300005545 Bacteria 940
39 Ga0070696_100063700 3300005546 Bacteria 2583
40 Ga0070665_101014118 3300005548 Bacteria 842
41 Ga0070704_100032067 3300005549 Bacteria 3540
42 Ga0070704_100101986 3300005549 Bacteria 2164
43 Ga0068855_100002218 3300005563 Bacteria 24042
44 Ga0068855_100135785 3300005563 Bacteria 2807
45 Ga0068855_100487711 3300005563 Bacteria 1341
46 Ga0068856_100006086 3300005614 Bacteria 11854
47 Ga0068856_100060521 3300005614 Bacteria 3741
48 Ga0068856_100098106 3300005614 Bacteria 2920
49 Ga0070702_100316775 3300005615 Bacteria 1085
50 Ga0068859_100017108 3300005617 Bacteria 7281
51 Ga0068859_100109343 3300005617 Bacteria 2826
52 Ga0068864_100323922 3300005618 Bacteria 1448
53 Ga0068864_100388089 3300005618 Bacteria 1325
54 Ga0068861_100016274 3300005719 Bacteria 5259
55 Ga0068863_100332102 3300005841 Bacteria 1478
56 Ga0068860_100235165 3300005843 Bacteria 1781
57 Ga0068871_100059035 3300006358 Unclassified 3125
58 Ga0075428_100010364 3300006844 Bacteria 10345
59 Ga0075430_100157010 3300006846 Bacteria 1894
60 Ga0075431_100322496 3300006847 Bacteria 1557
61 Ga0075431_100617505 3300006847 Bacteria 1067
62 Ga0075433_10029042 3300006852 Bacteria 4708
63 Ga0075434_100089899 3300006871 Bacteria 3072
64 Ga0075434_100143496 3300006871 Unclassified 2408
65 Ga0075429_100011503 3300006880 Bacteria 7673
66 Ga0097620_100017108 3300006931 Bacteria 7281
67 Ga0097620_100109337 3300006931 Bacteria 2826
68 Ga0105240_10031196 3300009093 Bacteria 6915
69 Ga0105240_10107852 3300009093 Bacteria 3376
70 Ga0111539_10000056 3300009094 Bacteria 114878
71 Ga0111539_10009655 3300009094 Bacteria 12179
72 Ga0111539_10149359 3300009094 Bacteria 2735
73 Ga0111539_10226854 3300009094 Bacteria 2176
74 Ga0111539_10698152 3300009094 Bacteria 1181
75 Ga0105245_10689177 3300009098 Bacteria 1054
76 Ga0114129_10005284 3300009147 Bacteria 18220
77 Ga0114129_10034960 3300009147 Bacteria 7099
78 Ga0114129_10303641 3300009147 Bacteria 2126
79 Ga0105248_11108505 3300009177 Bacteria 895
80 Ga0105237_10002136 3300009545 Bacteria 24894
81 Ga0105237_10118526 3300009545 Bacteria 2641
82 Ga0105237_10129348 3300009545 Bacteria 2519
83 Ga0105238_10525251 3300009551 Bacteria 1186
84 Ga0105238_10554505 3300009551 Unclassified 1154
85 Ga0105249_10181102 3300009553 Bacteria 2050
86 Ga0105249_10273970 3300009553 Bacteria 1682
87 Ga0105249_10613803 3300009553 Bacteria 1143
88 Ga0105239_10009040 3300010375 Bacteria 11280
89 Ga0105239_10199246 3300010375 Bacteria 2243
90 Ga0157369_10203586 3300013105 Bacteria 2077
91 Ga0157372_10210422 3300013307 Bacteria 2254
92 Ga0157375_10357197 3300013308 Bacteria 1627
93 Ga0163163_10000020 3300014325 Bacteria 196885
94 Ga0163163_10006355 3300014325 Bacteria 10316
95 Ga0163163_10527033 3300014325 Bacteria 1244
96 Ga0157380_10110931 3300014326 Bacteria 2305
97 Ga0157377_10073632 3300014745 Bacteria 1980
98 Ga0157379_10061459 3300014968 Bacteria 3359
99 Ga0157376_10218333 3300014969 Bacteria 1764
100 Ga0207682_10046219 3300025893 Bacteria 1788
101 Ga0207680_10110698 3300025903 Bacteria 1780
102 Ga0207643_10046450 3300025908 Bacteria 2455
103 Ga0207705_10001805 3300025909 Bacteria 16883
104 Ga0207705_10070874 3300025909 Bacteria 2526
105 Ga0207707_10014331 3300025912 Bacteria 6903
106 Ga0207707_10095097 3300025912 Bacteria 2604
107 Ga0207695_10000326 3300025913 Bacteria 113674
108 Ga0207695_10057097 3300025913 Bacteria 4058
109 Ga0207695_10261957 3300025913 Bacteria 1626
110 Ga0207695_10262259 3300025913 Bacteria 1625
111 Ga0207671_10119591 3300025914 Bacteria 2012
112 Ga0207671_10225242 3300025914 Bacteria 1470
113 Ga0207660_10242330 3300025917 Bacteria 1421
114 Ga0207662_10087450 3300025918 Bacteria 1912
115 Ga0207652_10199137 3300025921 Bacteria 1802
116 Ga0207694_10008573 3300025924 Bacteria 7722
117 Ga0207650_10267337 3300025925 Bacteria 1389
118 Ga0207659_10049698 3300025926 Bacteria 2976
119 Ga0207659_10131542 3300025926 Bacteria 1932
120 Ga0207659_10450598 3300025926 Bacteria 1084
121 Ga0207664_10070520 3300025929 Bacteria 2813
122 Ga0207670_10598504 3300025936 Bacteria 905
123 Ga0207691_10230961 3300025940 Bacteria 1602
124 Ga0207689_10297031 3300025942 Bacteria 1339
125 Ga0207679_10299025 3300025945 Bacteria 1387
126 Ga0207667_10002317 3300025949 Bacteria 23855
127 Ga0207667_10017689 3300025949 Bacteria 8020
128 Ga0207667_10430642 3300025949 Bacteria 1342
129 Ga0207651_10041640 3300025960 Bacteria 3050
130 Ga0207712_10072553 3300025961 Bacteria 2479
131 Ga0207712_10229357 3300025961 Bacteria 1490
132 Ga0207678_10037219 3300026067 Bacteria 4234
133 Ga0207708_10295134 3300026075 Bacteria 1317
134 Ga0207702_10646035 3300026078 Bacteria 1040
135 Ga0207641_10298613 3300026088 Bacteria 1521
136 Ga0207648_10024376 3300026089 Bacteria 5401
137 Ga0207648_10087286 3300026089 Bacteria 2722
138 Ga0207676_10389423 3300026095 Bacteria 1299
139 Ga0207675_100025784 3300026118 Bacteria 5470
140 Ga0207675_100197620 3300026118 Bacteria 1931
141 Ga0207675_100340017 3300026118 Bacteria 1469
142 Ga0207675_100814296 3300026118 Bacteria 948
143 Ga0207428_10078002 3300027907 Bacteria 2592
144 Ga0207428_10179123 3300027907 Bacteria 1602
145 Ga0207428_10377638 3300027907 Bacteria 1040
146 Ga0268266_10002575 3300028379 Bacteria 19239
147 Ga0268266_10761905 3300028379 Bacteria 934
148 Ga0268265_10430084 3300028380 Bacteria 1228
149 Ga0268264_10197326 3300028381 Bacteria 1839
150 Ga0268264_10462082 3300028381 Bacteria 1232
151 Ga0265334_10052872 3300028573 Bacteria 1553
152 Ga0265336_10022719 3300028666 Bacteria 1995
153 Ga0265338_10000040 3300028800 Bacteria 232041
154 Ga0265338_10000042 3300028800 Bacteria 226810
155 Ga0265338_10001925 3300028800 Bacteria 32393
156 Ga0265338_10086945 3300028800 Bacteria 2599
157 Ga0265338_10102914 3300028800 Bacteria 2321
158 Ga0265338_10147415 3300028800 Bacteria 1834
159 Ga0265324_10001662 3300029957 Bacteria 12299
160 Ga0265324_10005932 3300029957 Bacteria 5182
161 Ga0265320_10002861 3300031240 Bacteria 11854
162 Ga0265320_10011328 3300031240 Bacteria 5252
163 Ga0265325_10030272 3300031241 Bacteria 2904
164 Ga0265329_10017409 3300031242 Bacteria 2473
165 Ga0265340_10190661 3300031247 Bacteria 924
166 Ga0265339_10014193 3300031249 Bacteria 4806
167 Ga0265327_10001277 3300031251 Bacteria 33154
168 Ga0265327_10001821 3300031251 Bacteria 24926
169 Ga0265327_10033989 3300031251 Bacteria 2835
170 Ga0307408_100008188 3300031548 Bacteria 6907
171 Ga0307408_100018195 3300031548 Bacteria 4716
172 Ga0307408_100151255 3300031548 Bacteria 1832
173 Ga0265314_10000646 3300031711 Bacteria 42731
174 Ga0265314_10001045 3300031711 Bacteria 32296
175 Ga0265314_10009293 3300031711 Bacteria 8325
176 Ga0265314_10052657 3300031711 Bacteria 2828
177 Ga0307405_10041191 3300031731 Bacteria 2802
178 Ga0307406_10001307 3300031901 Bacteria 13981
179 Ga0307406_10095131 3300031901 Bacteria 2015
180 Ga0307407_10162127 3300031903 Bacteria 1464
181 Ga0307412_10040816 3300031911 Bacteria 3004
182 Ga0307416_100100320 3300032002 Bacteria 2517
183 Ga0307414_10000007 3300032004 Bacteria 407977
184 Ga0307414_10072932 3300032004 Bacteria 2481
185 Ga0307414_10134673 3300032004 Bacteria 1924
186 Ga0307415_100499180 3300032126 Bacteria 1063
187 Ga0373934_0002224 3300035086 Bacteria 7130
188 Ga0373956_0157801 3300035119 Bacteria 1068
189 Ga0373957_0002395 3300035120 Bacteria 5342
190 Ga0373955_0003345 3300035172 Bacteria 7046
191 Ga0373927_0020364 3300035695 Bacteria 4350
192 Ga0373933_0005484 3300035724 Bacteria 6910
193 Ga0373947_0024027 3300035725 Bacteria 3548
194 Ga0373937_0000613 3300036401 Bacteria 31505
195 Ga0373937_0150101 3300036401 Bacteria 2183
196 Ga0373925_0078415 3300037068 Bacteria 2508
197 Ga0395905_0038309 3300037471 Unclassified 4498
198 Ga0395905_0154151 3300037471 Unclassified 2161
199 Ga0395905_0332423 3300037471 Unclassified 1410
200 Ga0451577_0700537 3300042876 Bacteria 917
201 Ga0451577_0885997 3300042876 Bacteria 804
202 Ga0453684_0226275 3300044712 Bacteria 2163
203 Ga0451576_0018568 3300045051 Bacteria 7615
204 Ga0451576_0042393 3300045051 Bacteria 4805
205 Ga0451576_0111415 3300045051 Bacteria 2848
206 Ga0451576_0124037 3300045051 Bacteria 2690
207 Ga0451576_0648831 3300045051 Bacteria 1109
208 Ga0495651_0013239 3300046462 Bacteria 6378
209 Ga0495653_0084201 3300046463 Bacteria 2343
210 Ga0495608_0013856 3300046511 Bacteria 5596
211 Ga0495628_0031390 3300046516 Bacteria 4298
212 Ga0495630_0155865 3300046517 Bacteria 1738
213 Ga0495652_0018815 3300046529 Bacteria 6156
214 Ga0495586_0051883 3300046535 Bacteria 2220
215 Ga0495598_0034914 3300046537 Bacteria 1436
216 Ga0495645_0017060 3300046543 Bacteria 5199
217 Ga0495667_0022657 3300046559 Bacteria 4232
218 Ga0495635_0010812 3300046663 Bacteria 6394
219 Ga0495599_0006400 3300046678 Bacteria 7103
220 Ga0495646_0040481 3300046680 Bacteria 2870
221 Ga0495647_0058840 3300046681 Bacteria 1511
222 Ga0495613_0249015 3300046689 Bacteria 1240
223 Ga0495604_0227148 3300047317 Bacteria 1282
224 Ga0495674_0055131 3300047319 Bacteria 3487
225 Ga0495680_0064406 3300047322 Bacteria 2811
226 Ga0495684_0037103 3300047471 Bacteria 3737
227 Ga0495602_0034073 3300048088 Bacteria 4769
228 Ga0496105_0323258 3300048908 Bacteria 1236
229 Ga0496109_0350634 3300048912 Bacteria 1394
230 Ga0496115_0014415 3300048918 Bacteria 5983
231 Ga0496121_0067347 3300048924 Bacteria 2903
232 Ga0496122_0044330 3300048925 Bacteria 3473
233 Ga0496126_0001933 3300048929 Bacteria 29539
234 Ga0501033_0090598 3300049570 Bacteria 2237
235 Ga0501034_0000104 3300049571 Bacteria 155848
236 Ga0501034_0001343 3300049571 Bacteria 33241
237 Ga0501034_0425883 3300049571 Bacteria 1248
238 Ga0501036_0087162 3300049572 Bacteria 2639
239 Ga0501036_0583472 3300049572 Bacteria 928
240 Ga0501037_0001540 3300049573 Bacteria 16813
241 Ga0501037_0148407 3300049573 Bacteria 1677
242 Ga0501038_0000424 3300049574 Bacteria 36804
243 Ga0501039_0035654 3300049575 Bacteria 3840
244 Ga0501039_0101299 3300049575 Bacteria 2248
245 Ga0501040_0076834 3300049576 Bacteria 2309
246 Ga0501041_0352789 3300049577 Bacteria 930
247 Ga0501043_0032925 3300049579 Bacteria 4077
248 Ga0501046_0000020 3300049580 Bacteria 218268
249 Ga0501047_0088489 3300049581 Bacteria 2974
250 Ga0501068_0092969 3300049584 Bacteria 1863
251 Ga0501071_0104245 3300049587 Bacteria 2093
252 Ga0501072_0018736 3300049588 Bacteria 5337
253 Ga0501072_0194400 3300049588 Bacteria 1618
254 Ga0501075_0357509 3300049591 Bacteria 1113
255 Ga0501076_0006631 3300049592 Bacteria 8399
256 Ga0501077_0129911 3300049593 Bacteria 1597
257 Ga0501223_005404 3300049663 Bacteria 2685
258 Ga0501227_003018 3300049665 Unclassified 3673
259 Ga0501079_0077135 3300049741 Bacteria 2577
260 Ga0501080_0244549 3300049742 Bacteria 1637
261 Ga0501081_0065216 3300049743 Bacteria 2531
262 Ga0501083_0000005 3300049744 Bacteria 206200
263 Ga0501035_0017949 3300049822 Bacteria 6523
264 Ga0501044_0026112 3300049823 Bacteria 6185
265 Ga0501044_0301881 3300049823 Bacteria 1530
266 Ga0501045_0016560 3300049824 Bacteria 5238
267 nmdc:mga05p37_1072575_c1 3300050507 Bacteria 847
268 nmdc:mga05p37_335671_c1 3300050507 Bacteria 1784
269 nmdc:mga09592_598183_c1 3300050508 Bacteria 945
270 nmdc:mga09592_6124_c1 3300050508 Bacteria 6587
271 nmdc:mga0qj67_325222_c1 3300050509 Bacteria 1245
272 nmdc:mga0qj67_60927_c1 3300050509 Bacteria 2995
273 nmdc:mga06r32_32352_c1 3300050510 Bacteria 4920
274 nmdc:mga06r32_347891_c1 3300050510 Bacteria 1467
275 nmdc:mga06r32_94959_c1 3300050510 Bacteria 2918
276 nmdc:mga08y16_344_c3 3300050511 Bacteria 10817
277 nmdc:mga08y16_42762_c1 3300050511 Bacteria 4745
278 nmdc:mga08y16_6955_c1 3300050511 Bacteria 11855
279 nmdc:mga0a205_36406_c1 3300050515 Bacteria 4728
280 Ga0500566_0118182 3300053094 Bacteria 1433
281 Ga0501084_0381448 3300054114 Bacteria 1191
282 Ga0501082_0047256 3300060353 Bacteria 3709
283 Ga0501043_0000609
284 rootH2_10036148
285 rootH1_10075524
286 Ga0065704_10087423
287 Ga0065704_10154907
288 Ga0065707_10137618
289 Ga0070658_10005946
290 Ga0070658_10029244
291 Ga0070670_100133674
292 Ga0070666_10030245
293 Ga0070682_100154444
294 Ga0068868_100417400
295 Ga0070660_100251429
296 Ga0070689_100043937
297 Ga0070689_100427378
298 Ga0070691_10125792
299 Ga0070687_100067996
300 Ga0070675_100060191
301 Ga0070673_100002124
302 Ga0070714_100082438
303 Ga0070701_10018646
304 Ga0070705_100159200
305 Ga0070705_100250643
306 Ga0070705_100401392
307 Ga0070694_100011258
308 Ga0070681_10002533
309 Ga0070681_10037542
310 Ga0068867_100056133
311 Ga0070685_10256799
312 Ga0070679_100076384
313 Ga0070684_100164265
314 Ga0070672_100274743
315 Ga0070686_100002377
316 Ga0070686_100002702
317 Ga0070686_100086319
318 Ga0070686_100172618
319 Ga0070686_100208404
320 Ga0070695_100499956
321 Ga0070696_100063700
322 Ga0070665_101014118
323 Ga0070704_100032067
324 Ga0070704_100101986
325 Ga0068855_100002218
326 Ga0068855_100135785
327 Ga0068855_100487711
328 Ga0068856_100006086
329 Ga0068856_100060521
330 Ga0068856_100098106
331 Ga0070702_100316775
332 Ga0068859_100017108
333 Ga0068859_100109343
334 Ga0068864_100323922
335 Ga0068864_100388089
336 Ga0068861_100016274
337 Ga0068863_100332102
338 Ga0068860_100235165
339 Ga0068871_100059035
340 Ga0075428_100010364
341 Ga0075430_100157010
342 Ga0075431_100322496
343 Ga0075431_100617505
344 Ga0075433_10029042
345 Ga0075434_100089899
346 Ga0075434_100143496
347 Ga0075429_100011503
348 Ga0097620_100017108
349 Ga0097620_100109337
350 Ga0105240_10031196
351 Ga0105240_10107852
352 Ga0111539_10000056
353 Ga0111539_10009655
354 Ga0111539_10149359
355 Ga0111539_10226854
356 Ga0111539_10698152
357 Ga0105245_10689177
358 Ga0114129_10005284
359 Ga0114129_10034960
360 Ga0114129_10303641
361 Ga0105248_11108505
362 Ga0105237_10002136
363 Ga0105237_10118526
364 Ga0105237_10129348
365 Ga0105238_10525251
366 Ga0105238_10554505
367 Ga0105249_10181102
368 Ga0105249_10273970
369 Ga0105249_10613803
370 Ga0105239_10009040
371 Ga0105239_10199246
372 Ga0157369_10203586
373 Ga0157372_10210422
374 Ga0157375_10357197
375 Ga0163163_10000020
376 Ga0163163_10006355
377 Ga0163163_10527033
378 Ga0157380_10110931
379 Ga0157377_10073632
380 Ga0157379_10061459
381 Ga0157376_10218333
382 Ga0207682_10046219
383 Ga0207680_10110698
384 Ga0207643_10046450
385 Ga0207705_10001805
386 Ga0207705_10070874
387 Ga0207707_10014331
388 Ga0207707_10095097
389 Ga0207695_10000326
390 Ga0207695_10057097
391 Ga0207695_10261957
392 Ga0207695_10262259
393 Ga0207671_10119591
394 Ga0207671_10225242
395 Ga0207660_10242330
396 Ga0207662_10087450
397 Ga0207652_10199137
398 Ga0207694_10008573
399 Ga0207650_10267337
400 Ga0207659_10049698
401 Ga0207659_10131542
402 Ga0207659_10450598
403 Ga0207664_10070520
404 Ga0207670_10598504
405 Ga0207691_10230961
406 Ga0207689_10297031
407 Ga0207679_10299025
408 Ga0207667_10002317
409 Ga0207667_10017689
410 Ga0207667_10430642
411 Ga0207651_10041640
412 Ga0207712_10072553
413 Ga0207712_10229357
414 Ga0207678_10037219
415 Ga0207708_10295134
416 Ga0207702_10646035
417 Ga0207641_10298613
418 Ga0207648_10024376
419 Ga0207648_10087286
420 Ga0207676_10389423
421 Ga0207675_100025784
422 Ga0207675_100197620
423 Ga0207675_100340017
424 Ga0207675_100814296
425 Ga0207428_10078002
426 Ga0207428_10179123
427 Ga0207428_10377638
428 Ga0268266_10002575
429 Ga0268266_10761905
430 Ga0268265_10430084
431 Ga0268264_10197326
432 Ga0268264_10462082
433 Ga0265334_10052872
434 Ga0265336_10022719
435 Ga0265338_10000040
436 Ga0265338_10000042
437 Ga0265338_10001925
438 Ga0265338_10086945
439 Ga0265338_10102914
440 Ga0265338_10147415
441 Ga0265324_10001662
442 Ga0265324_10005932
443 Ga0265320_10002861
444 Ga0265320_10011328
445 Ga0265325_10030272
446 Ga0265329_10017409
447 Ga0265340_10190661
448 Ga0265339_10014193
449 Ga0265327_10001277
450 Ga0265327_10001821
451 Ga0265327_10033989
452 Ga0307408_100008188
453 Ga0307408_100018195
454 Ga0307408_100151255
455 Ga0265314_10000646
456 Ga0265314_10001045
457 Ga0265314_10009293
458 Ga0265314_10052657
459 Ga0307405_10041191
460 Ga0307406_10001307
461 Ga0307406_10095131
462 Ga0307407_10162127
463 Ga0307412_10040816
464 Ga0307416_100100320
465 Ga0307414_10000007
466 Ga0307414_10072932
467 Ga0307414_10134673
468 Ga0307415_100499180
469 Ga0373934_0002224
470 Ga0373956_0157801
471 Ga0373957_0002395
472 Ga0373955_0003345
473 Ga0373927_0020364
474 Ga0373933_0005484
475 Ga0373947_0024027
476 Ga0373937_0000613
477 Ga0373937_0150101
478 Ga0373925_0078415
479 Ga0395905_0038309
480 Ga0395905_0154151
481 Ga0395905_0332423
482 Ga0451577_0700537
483 Ga0451577_0885997
484 Ga0453684_0226275
485 Ga0451576_0018568
486 Ga0451576_0042393
487 Ga0451576_0111415
488 Ga0451576_0124037
489 Ga0451576_0648831
490 Ga0495651_0013239
491 Ga0495653_0084201
492 Ga0495608_0013856
493 Ga0495628_0031390
494 Ga0495630_0155865
495 Ga0495652_0018815
496 Ga0495586_0051883
497 Ga0495598_0034914
498 Ga0495645_0017060
499 Ga0495667_0022657
500 Ga0495635_0010812
501 Ga0495599_0006400
502 Ga0495646_0040481
503 Ga0495647_0058840
504 Ga0495613_0249015
505 Ga0495604_0227148
506 Ga0495674_0055131
507 Ga0495680_0064406
508 Ga0495684_0037103
509 Ga0495602_0034073
510 Ga0496105_0323258
511 Ga0496109_0350634
512 Ga0496115_0014415
513 Ga0496121_0067347
514 Ga0496122_0044330
515 Ga0496126_0001933
516 Ga0501033_0090598
517 Ga0501034_0000104
518 Ga0501034_0001343
519 Ga0501034_0425883
520 Ga0501036_0087162
521 Ga0501036_0583472
522 Ga0501037_0001540
523 Ga0501037_0148407
524 Ga0501038_0000424
525 Ga0501039_0035654
526 Ga0501039_0101299
527 Ga0501040_0076834
528 Ga0501041_0352789
529 Ga0501043_0032925
530 Ga0501046_0000020
531 Ga0501047_0088489
532 Ga0501068_0092969
533 Ga0501071_0104245
534 Ga0501072_0018736
535 Ga0501072_0194400
536 Ga0501075_0357509
537 Ga0501076_0006631
538 Ga0501077_0129911
539 Ga0501223_005404
540 Ga0501227_003018
541 Ga0501079_0077135
542 Ga0501080_0244549
543 Ga0501081_0065216
544 Ga0501083_0000005
545 Ga0501035_0017949
546 Ga0501044_0026112
547 Ga0501044_0301881
548 Ga0501045_0016560
549 nmdc:mga05p37_1072575_c1
550 nmdc:mga05p37_335671_c1
551 nmdc:mga09592_598183_c1
552 nmdc:mga09592_6124_c1
553 nmdc:mga0qj67_325222_c1
554 nmdc:mga0qj67_60927_c1
555 nmdc:mga06r32_32352_c1
556 nmdc:mga06r32_347891_c1
557 nmdc:mga06r32_94959_c1
558 nmdc:mga08y16_344_c3
559 nmdc:mga08y16_42762_c1
560 nmdc:mga08y16_6955_c1
561 nmdc:mga0a205_36406_c1
562 Ga0500566_0118182
563 Ga0501084_0381448
564 Ga0501082_0047256

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

78

224

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o17-assembly1.cif.gz_B abc transporter nosdfy e154q, atp-bound in lipid nanodisc 0.9473 2 223
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.94 2 224
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9393 2 224
8bms-assembly1.cif.gz_B cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation 0.9393 1 223
6cvl-assembly1.cif.gz_D crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.9383 1 217
ID Description Score Start End Superfamily
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9643 2 221 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9594 2 223 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9487 2 214 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.947 1 224 3.40.50.300
af_Q2FVS3_1_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9454 2 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2N9NVS2-F1-model_v4 ABC transporter-related protein 0.9804 1 256 GO:0005524
GO:0016887
AF-A0A7J4F098-F1-model_v4 deleted 0.9616 1 217
AF-A0A7C5B8D2-F1-model_v4 ABC transporter ATP-binding protein 0.9583 1 221 GO:0005524
GO:0016887
AF-A0A0F9D1U0-F1-model_v4 ABC transporter domain-containing protein 0.9533 1 224 GO:0005524
GO:0016887
AF-A0A7J3DAP2-F1-model_v4 ABC transporter ATP-binding protein 0.953 1 225 GO:0005524
GO:0016887

Map