F384811

General Info

Members Datasets Scaffolds Average Seq Length
282 188 274 120

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100357704|Ga0068853_1003577042
Length 124
Sequence MNNLSLPIMTPAEINKKWDVLQQRIAEDFDNEKPDIKVMLFLIGVQELGQGPRKFSKRQKEELMHIATCRLMSMMGFYELEGLDQDGWPHWKRVKVIPNYTLLEQEMMMKSLIVNYFEEMDGDN

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2739367663 Pedobacter sp. YR510 Isolate Unclassified
3 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
4 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
5 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
6 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
7 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
8 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
9 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
97 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
98 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
99 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
100 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
101 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
112 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
120 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
141 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
152 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
155 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
156 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
157 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
158 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
159 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
160 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
161 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
162 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
163 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
164 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
165 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
172 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
173 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
174 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
175 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
176 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
177 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
178 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
179 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
180 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
181 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
182 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
183 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
184 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
185 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
186 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
188 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.81
Metatranscriptomes 0
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.18
Nodule 0
Rhizoplane 1.42
Rhizosphere 70.92
Stem 0
Stem Tuber 0
Unclassified 13.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10079787 3300001989 Bacteria 1006
2 JGI24737J22298_10000851 3300001990 Bacteria 10884
3 JGI24735J21928_10000093 3300002067 Bacteria 33623
4 JGI25162J39368_1000008 3300002737 Bacteria 397212
5 JGI25162J39368_1000097 3300002737 Bacteria 96520
6 rootH1_10033509 3300003316 Bacteria 25567
7 rootH1_10055821 3300003316 Bacteria 2544
8 rootH2_10091594 3300003320 Bacteria 1906
9 rootH2_10115426 3300003320 Bacteria 2129
10 rootL2_10106701 3300003322 Bacteria 1139
11 rootL2_10181078 3300003322 Bacteria 2448
12 rootL2_10240312 3300003322 Bacteria 4931
13 rootL2_10272423 3300003322 Bacteria 1144
14 rootH1_10000619 3300003316 Bacteria 3651
15 rootH1_10000619 3300003323 Bacteria 100005
16 rootH1_10018469 3300003323 Bacteria 26425
17 rootH1_10031215 3300003323 Bacteria 18885
18 rootH1_10051962 3300003323 Bacteria 6095
19 rootH1_10062311 3300003323 Bacteria 1053
20 rootH1_10259350 3300003323 Bacteria 1847
21 Ga0055531_10000120 3300003794 Bacteria 87551
22 Ga0065714_10005450 3300005288 Bacteria 4931
23 Ga0065714_10078641 3300005288 Bacteria 2581
24 Ga0070658_10240240 3300005327 Bacteria 1535
25 Ga0070658_10583699 3300005327 Bacteria 968
26 Ga0070688_100256789 3300005365 Bacteria 1246
27 Ga0070667_101537377 3300005367 Bacteria 625
28 Ga0070663_102114345 3300005455 Unclassified 507
29 Ga0068853_100024008 3300005539 Bacteria 5110
30 Ga0068853_100357704 3300005539 Bacteria 1359
31 Ga0070704_100731446 3300005549 Unclassified 880
32 Ga0068855_100052254 3300005563 Bacteria 4811
33 Ga0068855_100093980 3300005563 Bacteria 3457
34 Ga0068855_100094858 3300005563 Unclassified 3440
35 Ga0068855_101397487 3300005563 Bacteria 721
36 Ga0068857_100078284 3300005577 Bacteria 2951
37 Ga0068854_100048083 3300005578 Bacteria 3042
38 Ga0068856_100026413 3300005614 Bacteria 5663
39 Ga0068856_100221101 3300005614 Bacteria 1909
40 Ga0068859_102535904 3300005617 Unclassified 564
41 Ga0068864_100407588 3300005618 Bacteria 1293
42 Ga0068864_100771439 3300005618 Unclassified 943
43 Ga0068864_101259130 3300005618 Bacteria 739
44 Ga0068864_102301070 3300005618 Bacteria 545
45 Ga0068866_10034145 3300005718 Bacteria 2475
46 Ga0068863_100118168 3300005841 Bacteria 2527
47 Ga0068862_101991884 3300005844 Bacteria 591
48 Ga0075366_10000435 3300006195 Bacteria 19478
49 Ga0075366_10000779 3300006195 Bacteria 15223
50 Ga0097621_101561971 3300006237 Unclassified 627
51 Ga0068871_100343251 3300006358 Unclassified 1319
52 Ga0075430_100776944 3300006846 Bacteria 789
53 Ga0075429_100748051 3300006880 Bacteria 856
54 Ga0097620_102535869 3300006931 Unclassified 564
55 Ga0105240_10162931 3300009093 Bacteria 2647
56 Ga0105240_10580580 3300009093 Bacteria 1236
57 Ga0111539_10004895 3300009094 Bacteria 17435
58 Ga0111539_10036534 3300009094 Bacteria 5937
59 Ga0111539_13130139 3300009094 Bacteria 534
60 Ga0105237_10024357 3300009545 Bacteria 6193
61 Ga0105237_10098379 3300009545 Bacteria 2916
62 Ga0105237_10592102 3300009545 Bacteria 1116
63 Ga0105239_10006488 3300010375 Bacteria 13566
64 Ga0105239_10143882 3300010375 Bacteria 2658
65 Ga0105239_10188785 3300010375 Bacteria 2307
66 Ga0157373_10404981 3300013100 Bacteria 978
67 Ga0157370_10022834 3300013104 Bacteria 6220
68 Ga0157370_10088423 3300013104 Bacteria 2909
69 Ga0157370_10629558 3300013104 Bacteria 981
70 Ga0157369_10121906 3300013105 Bacteria 2766
71 Ga0157378_10822336 3300013297 Bacteria 956
72 Ga0157378_11779923 3300013297 Bacteria 664
73 Ga0163162_10008696 3300013306 Bacteria 9881
74 Ga0163162_10326725 3300013306 Bacteria 1666
75 Ga0163162_12527745 3300013306 Bacteria 591
76 Ga0157372_10002641 3300013307 Bacteria 19411
77 Ga0157380_10117363 3300014326 Bacteria 2247
78 Ga0157376_10246928 3300014969 Bacteria 1665
79 Ga0157376_11830914 3300014969 Bacteria 643
80 Ga0163161_10038318 3300017792 Bacteria 3438
81 Ga0209437_100030 3300025233 Bacteria 532466
82 Ga0209026_1003864 3300025250 Bacteria 4724
83 Ga0209129_1016504 3300025258 Bacteria 1481
84 Ga0209233_1017862 3300025261 Unclassified 1922
85 Ga0209257_1000007 3300025304 Bacteria 1564415
86 Ga0209257_1041152 3300025304 Bacteria 1373
87 Ga0207642_10592743 3300025899 Bacteria 689
88 Ga0207647_10062857 3300025904 Bacteria 2260
89 Ga0207705_10387719 3300025909 Bacteria 1080
90 Ga0207695_10123977 3300025913 Bacteria 2548
91 Ga0207671_10012109 3300025914 Bacteria 6965
92 Ga0207671_10206934 3300025914 Bacteria 1534
93 Ga0207671_10654890 3300025914 Bacteria 836
94 Ga0207665_10148502 3300025939 Bacteria 1677
95 Ga0207667_10067533 3300025949 Bacteria 3724
96 Ga0207667_10120330 3300025949 Unclassified 2706
97 Ga0207667_10316202 3300025949 Bacteria 1595
98 Ga0207667_11560428 3300025949 Bacteria 630
99 Ga0207640_10031441 3300025981 Bacteria 3280
100 Ga0207639_10006123 3300026041 Bacteria 8165
101 Ga0207639_10305028 3300026041 Bacteria 1409
102 Ga0207702_10019073 3300026078 Bacteria 5676
103 Ga0207702_10427265 3300026078 Bacteria 1282
104 Ga0207702_10561983 3300026078 Bacteria 1117
105 Ga0207641_10079194 3300026088 Bacteria 2848
106 Ga0207676_10183143 3300026095 Bacteria 1836
107 Ga0207674_10027882 3300026116 Bacteria 5967
108 Ga0207675_102354366 3300026118 Unclassified 545
109 Ga0207428_10570708 3300027907 Bacteria 817
110 Ga0268264_10944087 3300028381 Bacteria 867
111 Ga0307517_10000212 3300028786 Bacteria 99215
112 Ga0307515_10000224 3300028794 Bacteria 140276
113 Ga0307515_10000318 3300028794 Bacteria 118891
114 Ga0307515_10230775 3300028794 Unclassified 1644
115 Ga0307513_10492680 3300031456 Bacteria 944
116 Ga0307509_10047347 3300031507 Bacteria 4626
117 Ga0307509_10119889 3300031507 Unclassified 2611
118 Ga0307509_10167959 3300031507 Bacteria 2078
119 Ga0307408_100150290 3300031548 Unclassified 1838
120 Ga0307514_10223964 3300031649 Unclassified 1149
121 Ga0307516_10580304 3300031730 Unclassified 775
122 Ga0307405_10009762 3300031731 Bacteria 4936
123 Ga0307413_10085449 3300031824 Unclassified 2037
124 Ga0307413_10228216 3300031824 Bacteria 1365
125 Ga0307413_11620603 3300031824 Bacteria 575
126 Ga0307410_10078707 3300031852 Bacteria 2308
127 Ga0307406_10034645 3300031901 Bacteria 3099
128 Ga0307412_10049776 3300031911 Bacteria 2762
129 Ga0307412_10270898 3300031911 Bacteria 1328
130 Ga0307409_100154036 3300031995 Bacteria 2000
131 Ga0307416_100000229 3300032002 Bacteria 29837
132 Ga0307414_10000109 3300032004 Bacteria 58307
133 Ga0307414_10130723 3300032004 Bacteria 1948
134 Ga0307414_11026649 3300032004 Unclassified 760
135 Ga0307415_100005020 3300032126 Bacteria 6968
136 Ga0307507_10000111 3300033179 Bacteria 134722
137 Ga0307510_10000249 3300033180 Bacteria 48754
138 Ga0373932_0142878 3300035112 Unclassified 815
139 Ga0373931_0287813 3300035691 Unclassified 1011
140 Ga0373927_0009488 3300035695 Bacteria 6527
141 Ga0451789_0214502 3300041443 Bacteria 533
142 Ga0451798_0684554 3300041458 Unclassified 744
143 Ga0451807_2723629 3300041486 Bacteria 1433
144 Ga0451849_1543657 3300041505 Bacteria 2687
145 Ga0439449_0430577 3300042007 Unclassified 501
146 Ga0450923_140250 3300042125 Bacteria 580
147 Ga0451577_0028643 3300042876 Bacteria 5035
148 Ga0453683_0022968 3300044673 Bacteria 3975
149 Ga0453684_0001177 3300044712 Bacteria 81167
150 Ga0453684_1813710 3300044712 Unclassified 620
151 Ga0453684_1833682 3300044712 Bacteria 616
152 Ga0451576_0003574 3300045051 Bacteria 21154
153 Ga0451576_0008760 3300045051 Bacteria 11839
154 Ga0451576_0021248 3300045051 Bacteria 7056
155 Ga0451576_0320371 3300045051 Unclassified 1622
156 Ga0495592_0362572 3300046454 Bacteria 926
157 Ga0495638_0000004 3300046460 Bacteria 700795
158 Ga0495638_0198257 3300046460 Bacteria 1135
159 Ga0495638_0233769 3300046460 Bacteria 1021
160 Ga0495651_0390566 3300046462 Bacteria 910
161 Ga0495650_0000268 3300046471 Bacteria 99891
162 Ga0495582_0749273 3300046473 Bacteria 565
163 Ga0495585_0000034 3300046492 Bacteria 143120
164 Ga0495585_0000785 3300046492 Bacteria 28010
165 Ga0495596_0083612 3300046500 Bacteria 1239
166 Ga0495583_0067108 3300046506 Bacteria 1585
167 Ga0495583_0191009 3300046506 Bacteria 835
168 Ga0495606_0000009 3300046507 Bacteria 306313
169 Ga0495606_0003806 3300046507 Bacteria 15677
170 Ga0495606_0026886 3300046507 Bacteria 4089
171 Ga0495608_0659686 3300046511 Bacteria 625
172 Ga0495610_0003590 3300046512 Bacteria 11989
173 Ga0495610_0069448 3300046512 Bacteria 1649
174 Ga0495616_0000907 3300046513 Bacteria 21368
175 Ga0495616_0007494 3300046513 Bacteria 6534
176 Ga0495631_0005855 3300046518 Bacteria 6407
177 Ga0495631_0110371 3300046518 Bacteria 1183
178 Ga0495632_0263682 3300046519 Bacteria 770
179 Ga0495637_0178861 3300046520 Bacteria 787
180 Ga0495648_0079357 3300046524 Bacteria 1873
181 Ga0495663_0332435 3300046525 Bacteria 551
182 Ga0495652_0176067 3300046529 Bacteria 1646
183 Ga0495652_0583364 3300046529 Bacteria 765
184 Ga0495654_0207829 3300046530 Bacteria 834
185 Ga0495654_0307960 3300046530 Bacteria 645
186 Ga0495609_0007476 3300046538 Bacteria 5447
187 Ga0495609_0039495 3300046538 Bacteria 2124
188 Ga0495622_0045262 3300046557 Bacteria 2045
189 Ga0495633_0000785 3300046558 Bacteria 28402
190 Ga0495633_0002693 3300046558 Bacteria 12330
191 Ga0495668_0000011 3300046616 Bacteria 472186
192 Ga0495668_0351538 3300046616 Bacteria 809
193 Ga0495668_0432110 3300046616 Bacteria 724
194 Ga0495625_0000007 3300046660 Bacteria 565749
195 Ga0495625_0000761 3300046660 Bacteria 44882
196 Ga0495625_0001500 3300046660 Bacteria 28046
197 Ga0495625_0081481 3300046660 Bacteria 2252
198 Ga0495625_0227985 3300046660 Bacteria 1218
199 Ga0495661_0001101 3300046665 Bacteria 23675
200 Ga0495661_0002357 3300046665 Bacteria 14578
201 Ga0495623_0376360 3300046679 Bacteria 769
202 Ga0495646_0707639 3300046680 Bacteria 506
203 Ga0495658_0131787 3300046683 Bacteria 1522
204 Ga0495671_0026295 3300046692 Bacteria 3019
205 Ga0495649_0000007 3300046694 Bacteria 518037
206 Ga0495649_0062085 3300046694 Bacteria 2009
207 Ga0495660_0370107 3300046810 Bacteria 633
208 Ga0495680_0618944 3300047322 Bacteria 723
209 Ga0495683_0043395 3300047323 Bacteria 2264
210 Ga0495683_0084507 3300047323 Bacteria 1544
211 Ga0495687_001497 3300047443 Bacteria 21340
212 Ga0495679_015804 3300047446 Bacteria 2748
213 Ga0495673_0027678 3300047469 Bacteria 2694
214 Ga0495686_0000965 3300047472 Bacteria 35434
215 Ga0495686_0355293 3300047472 Bacteria 795
216 Ga0495593_0292259 3300047673 Bacteria 815
217 Ga0495614_0048143 3300048089 Bacteria 1828
218 Ga0496117_0001774 3300048920 Bacteria 29604
219 Ga0496118_0125990 3300048921 Bacteria 1657
220 Ga0496122_0003563 3300048925 Bacteria 20343
221 Ga0496123_0011355 3300048926 Bacteria 7731
222 Ga0496125_0083407 3300048928 Bacteria 2432
223 Ga0496126_0309146 3300048929 Bacteria 1302
224 Ga0495678_038701 3300049459 Bacteria 1927
225 Ga0501290_041662 3300049513 Unclassified 690
226 Ga0501069_0041862 3300049585 Bacteria 2533
227 Ga0501199_009832 3300049650 Unclassified 1015
228 Ga0501206_014541 3300049653 Bacteria 1083
229 Ga0501207_040027 3300049654 Bacteria 813
230 Ga0501222_020388 3300049662 Bacteria 886
231 Ga0501223_000417 3300049663 Bacteria 10327
232 Ga0501233_204348 3300049668 Unclassified 576
233 Ga0501239_003493 3300049672 Bacteria 1497
234 Ga0501257_000534 3300049686 Bacteria 7565
235 Ga0501257_141389 3300049686 Unclassified 658
236 Ga0501257_153546 3300049686 Bacteria 636
237 Ga0501259_016399 3300049688 Bacteria 1273
238 Ga0501229_029453 3300049706 Unclassified 749
239 Ga0501268_106955 3300049765 Unclassified 606
240 Ga0501278_010224 3300049774 Unclassified 746
241 nmdc:mga0k408_11130_c1 3300050493 Bacteria 4890
242 nmdc:mga0k408_120_c1 3300050493 Bacteria 38359
243 nmdc:mga0k408_283807_c1 3300050493 Unclassified 988
244 nmdc:mga07m45_405794_c1 3300050496 Bacteria 791
245 nmdc:mga07m45_537583_c1 3300050496 Bacteria 676
246 nmdc:mga09592_541682_c1 3300050508 Bacteria 1000
247 nmdc:mga0qj67_800224_c1 3300050509 Bacteria 746
248 nmdc:mga08y16_14915_c1 3300050511 Bacteria 8175
249 nmdc:mga08y16_153898_c1 3300050511 Bacteria 2390
250 Ga0500643_072303 3300053087 Bacteria 956
251 Ga0500644_0302087 3300053088 Bacteria 685
252 Ga0500646_0225080 3300053090 Unclassified 652
253 Ga0500646_0255556 3300053090 Unclassified 618
254 Ga0500583_0077639 3300053092 Bacteria 1599
255 Ga0500650_0499684 3300053098 Bacteria 517
256 Ga0500557_003315 3300053105 Bacteria 3176
257 Ga0500562_002710 3300053108 Unclassified 4404
258 Ga0500608_009957 3300053122 Bacteria 4061
259 Ga0500608_234349 3300053122 Bacteria 729
260 Ga0500608_304079 3300053122 Bacteria 590
261 Ga0500618_000006 3300053125 Bacteria 239188
262 Ga0500561_0070518 3300053137 Bacteria 998
263 Ga0500564_384668 3300053138 Unclassified 512
264 Ga0500579_099175 3300053143 Bacteria 1528
265 Ga0500604_0000080 3300053151 Bacteria 33611
266 Ga0500604_0053908 3300053151 Bacteria 1247
267 Ga0500616_0000015 3300053153 Bacteria 633259
268 Ga0500616_0002318 3300053153 Bacteria 16063
269 Ga0500622_0000049 3300053156 Bacteria 145793
270 Ga0500622_0000056 3300053156 Bacteria 142254
271 Ga0500622_0062808 3300053156 Bacteria 1892
272 Ga0500624_000567 3300053157 Bacteria 10211
273 Ga0500645_020675 3300053730 Unclassified 2038
274 Ga0500587_001430 3300053739 Bacteria 3379

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053122 Ga0500608_234349 Ga0500608_234349_403_714 103
2 iso_pu_bacteria 2739367663 2739646267 110
3 3300031824 Ga0307413_10228216 Ga0307413_102282162 111
4 iso_pu_bacteria 2898713307 2898714356 111
5 iso_pu_bacteria 2919437846 2919439937 111
6 3300005365 Ga0070688_100256789 Ga0070688_1002567892 112
7 3300005539 Ga0068853_100024008 Ga0068853_1000240082 112
8 3300005718 Ga0068866_10034145 Ga0068866_100341452 112
9 3300013297 Ga0157378_10822336 Ga0157378_108223362 112
10 3300025899 Ga0207642_10592743 Ga0207642_105927431 112
11 3300026041 Ga0207639_10006123 Ga0207639_100061236 112
12 3300028381 Ga0268264_10944087 Ga0268264_109440871 112
13 3300028786 Ga0307517_10000212 Ga0307517_1000021277 112
14 3300033180 Ga0307510_10000249 Ga0307510_1000024951 112
15 3300046500 Ga0495596_0083612 Ga0495596_0083612_406_744 112
16 3300046506 Ga0495583_0191009 Ga0495583_0191009_142_480 112
17 3300046518 Ga0495631_0005855 Ga0495631_0005855_846_1184 112
18 3300046519 Ga0495632_0263682 Ga0495632_0263682_178_516 112
19 3300046616 Ga0495668_0351538 Ga0495668_0351538_324_662 112
20 3300046660 Ga0495625_0227985 Ga0495625_0227985_658_996 112
21 3300046679 Ga0495623_0376360 Ga0495623_0376360_353_691 112
22 3300046694 Ga0495649_0062085 Ga0495649_0062085_1610_1948 112
23 3300047323 Ga0495683_0043395 Ga0495683_0043395_1223_1561 112
24 3300053122 Ga0500608_009957 Ga0500608_009957_1190_1528 112
25 3300053730 Ga0500645_020675 Ga0500645_020675_374_712 112
26 iso_pu_bacteria 2599185184 2599480757 112
27 iso_pu_bacteria 2928078545 2928081649 112
28 3300005614 Ga0068856_100221101 Ga0068856_1002211013 113
29 3300028794 Ga0307515_10230775 Ga0307515_102307752 113
30 3300031649 Ga0307514_10223964 Ga0307514_102239642 113
31 3300031731 Ga0307405_10009762 Ga0307405_100097623 113
32 3300031911 Ga0307412_10270898 Ga0307412_102708982 113
33 3300032004 Ga0307414_11026649 Ga0307414_110266492 113
34 3300033179 Ga0307507_10000111 Ga0307507_1000011162 113
35 3300049663 Ga0501223_000417 Ga0501223_000417_4705_5046 113
36 3300013104 Ga0157370_10088423 Ga0157370_100884235 114
37 3300053122 Ga0500608_304079 Ga0500608_304079_70_414 114
38 iso_pu_bacteria 2884634485 2884635644 114
39 iso_pu_bacteria 2919692658 2919693476 114
40 3300002737 JGI25162J39368_1000008 JGI25162J39368_1000008352 115
41 3300002737 JGI25162J39368_1000097 JGI25162J39368_10000977 115
42 3300005288 Ga0065714_10005450 Ga0065714_100054503 115
43 3300005288 Ga0065714_10078641 Ga0065714_100786412 115
44 3300005563 Ga0068855_100052254 Ga0068855_1000522543 115
45 3300005563 Ga0068855_101397487 Ga0068855_1013974872 115
46 3300005578 Ga0068854_100048083 Ga0068854_1000480833 115
47 3300006195 Ga0075366_10000435 Ga0075366_1000043512 115
48 3300009093 Ga0105240_10162931 Ga0105240_101629313 115
49 3300009545 Ga0105237_10024357 Ga0105237_100243574 115
50 3300009545 Ga0105237_10098379 Ga0105237_100983793 115
51 3300010375 Ga0105239_10006488 Ga0105239_1000648812 115
52 3300010375 Ga0105239_10188785 Ga0105239_101887852 115
53 3300013306 Ga0163162_10326725 Ga0163162_103267251 115
54 3300013306 Ga0163162_12527745 Ga0163162_125277451 115
55 3300017792 Ga0163161_10038318 Ga0163161_100383183 115
56 3300025233 Ga0209437_100030 Ga0209437_10003093 115
57 3300025258 Ga0209129_1016504 Ga0209129_10165042 115
58 3300025913 Ga0207695_10123977 Ga0207695_101239773 115
59 3300025914 Ga0207671_10012109 Ga0207671_100121095 115
60 3300025914 Ga0207671_10206934 Ga0207671_102069342 115
61 3300025949 Ga0207667_10067533 Ga0207667_100675333 115
62 3300025949 Ga0207667_11560428 Ga0207667_115604281 115
63 3300025981 Ga0207640_10031441 Ga0207640_100314413 115
64 3300028794 Ga0307515_10000224 Ga0307515_1000022464 115
65 3300028794 Ga0307515_10000318 Ga0307515_1000031818 115
66 3300041443 Ga0451789_0214502 Ga0451789_0214502_38_385 115
67 3300046454 Ga0495592_0362572 Ga0495592_0362572_423_770 115
68 3300046460 Ga0495638_0233769 Ga0495638_0233769_41_388 115
69 3300046462 Ga0495651_0390566 Ga0495651_0390566_199_546 115
70 3300046473 Ga0495582_0749273 Ga0495582_0749273_161_508 115
71 3300046492 Ga0495585_0000785 Ga0495585_0000785_3732_4079 115
72 3300046507 Ga0495606_0003806 Ga0495606_0003806_2090_2437 115
73 3300046507 Ga0495606_0026886 Ga0495606_0026886_167_514 115
74 3300046511 Ga0495608_0659686 Ga0495608_0659686_149_496 115
75 3300046513 Ga0495616_0000907 Ga0495616_0000907_15031_15378 115
76 3300046518 Ga0495631_0110371 Ga0495631_0110371_721_1068 115
77 3300046524 Ga0495648_0079357 Ga0495648_0079357_632_979 115
78 3300046525 Ga0495663_0332435 Ga0495663_0332435_141_488 115
79 3300046529 Ga0495652_0176067 Ga0495652_0176067_88_435 115
80 3300046530 Ga0495654_0307960 Ga0495654_0307960_94_441 115
81 3300046538 Ga0495609_0007476 Ga0495609_0007476_2768_3115 115
82 3300046557 Ga0495622_0045262 Ga0495622_0045262_138_485 115
83 3300046558 Ga0495633_0000785 Ga0495633_0000785_20952_21299 115
84 3300046616 Ga0495668_0000011 Ga0495668_0000011_420068_420415 115
85 3300046660 Ga0495625_0000761 Ga0495625_0000761_12452_12799 115
86 3300046660 Ga0495625_0001500 Ga0495625_0001500_11310_11657 115
87 3300046660 Ga0495625_0081481 Ga0495625_0081481_987_1334 115
88 3300046683 Ga0495658_0131787 Ga0495658_0131787_1033_1380 115
89 3300046810 Ga0495660_0370107 Ga0495660_0370107_262_609 115
90 3300047472 Ga0495686_0000965 Ga0495686_0000965_8071_8418 115
91 3300047472 Ga0495686_0355293 Ga0495686_0355293_229_576 115
92 3300047673 Ga0495593_0292259 Ga0495593_0292259_144_491 115
93 3300048089 Ga0495614_0048143 Ga0495614_0048143_1250_1597 115
94 3300048920 Ga0496117_0001774 Ga0496117_0001774_16244_16591 115
95 3300048921 Ga0496118_0125990 Ga0496118_0125990_901_1248 115
96 3300048925 Ga0496122_0003563 Ga0496122_0003563_3563_3910 115
97 3300048926 Ga0496123_0011355 Ga0496123_0011355_466_813 115
98 3300048928 Ga0496125_0083407 Ga0496125_0083407_235_582 115
99 3300048929 Ga0496126_0309146 Ga0496126_0309146_440_787 115
100 3300049459 Ga0495678_038701 Ga0495678_038701_1546_1893 115
101 3300050493 nmdc:mga0k408_120_c1 nmdc:mga0k408_120_c1_30757_31104 115
102 3300050496 nmdc:mga07m45_537583_c1 nmdc:mga07m45_537583_c1_239_586 115
103 3300053137 Ga0500561_0070518 Ga0500561_0070518_581_928 115
104 3300053138 Ga0500564_384668 Ga0500564_384668_59_406 115
105 3300053143 Ga0500579_099175 Ga0500579_099175_371_718 115
106 3300001989 JGI24739J22299_10079787 JGI24739J22299_100797874 116
107 3300001990 JGI24737J22298_10000851 JGI24737J22298_100008514 116
108 3300002067 JGI24735J21928_10000093 JGI24735J21928_1000009320 116
109 3300003316 rootH1_10033509 rootH1_1003350915 116
110 3300003316 rootH1_10055821 rootH1_100558214 116
111 3300003320 rootH2_10091594 rootH2_100915942 116
112 3300003320 rootH2_10115426 rootH2_101154262 116
113 3300003322 rootL2_10106701 rootL2_101067012 116
114 3300003322 rootL2_10181078 rootL2_101810782 116
115 3300003322 rootL2_10240312 rootL2_102403121 116
116 3300003322 rootL2_10272423 rootL2_102724233 116
117 3300003323 rootH1_10000619 rootH1_1000061959 116
118 3300003323 rootH1_10018469 rootH1_1001846918 116
119 3300003323 rootH1_10031215 rootH1_100312154 116
120 3300003323 rootH1_10051962 rootH1_100519622 116
121 3300003323 rootH1_10062311 rootH1_100623112 116
122 3300003323 rootH1_10259350 rootH1_102593502 116
123 3300003794 Ga0055531_10000120 Ga0055531_1000012013 116
124 3300005327 Ga0070658_10240240 Ga0070658_102402402 116
125 3300005327 Ga0070658_10583699 Ga0070658_105836992 116
126 3300005367 Ga0070667_101537377 Ga0070667_1015373771 116
127 3300005455 Ga0070663_102114345 Ga0070663_1021143451 116
128 3300005539 Ga0068853_100357704 Ga0068853_1003577042 116
129 3300005549 Ga0070704_100731446 Ga0070704_1007314461 116
130 3300005563 Ga0068855_100093980 Ga0068855_1000939804 116
131 3300005563 Ga0068855_100094858 Ga0068855_1000948582 116
132 3300005577 Ga0068857_100078284 Ga0068857_1000782843 116
133 3300005614 Ga0068856_100026413 Ga0068856_1000264133 116
134 3300005617 Ga0068859_102535904 Ga0068859_1025359042 116
135 3300005618 Ga0068864_100407588 Ga0068864_1004075882 116
136 3300005618 Ga0068864_100771439 Ga0068864_1007714392 116
137 3300005618 Ga0068864_101259130 Ga0068864_1012591301 116
138 3300005618 Ga0068864_102301070 Ga0068864_1023010701 116
139 3300005841 Ga0068863_100118168 Ga0068863_1001181681 116
140 3300005844 Ga0068862_101991884 Ga0068862_1019918841 116
141 3300006195 Ga0075366_10000779 Ga0075366_1000077912 116
142 3300006237 Ga0097621_101561971 Ga0097621_1015619712 116
143 3300006358 Ga0068871_100343251 Ga0068871_1003432512 116
144 3300006846 Ga0075430_100776944 Ga0075430_1007769442 116
145 3300006880 Ga0075429_100748051 Ga0075429_1007480512 116
146 3300006931 Ga0097620_102535869 Ga0097620_1025358692 116
147 3300009093 Ga0105240_10580580 Ga0105240_105805803 116
148 3300009094 Ga0111539_10004895 Ga0111539_100048952 116
149 3300009094 Ga0111539_10036534 Ga0111539_100365343 116
150 3300009094 Ga0111539_13130139 Ga0111539_131301392 116
151 3300009545 Ga0105237_10592102 Ga0105237_105921022 116
152 3300010375 Ga0105239_10143882 Ga0105239_101438822 116
153 3300013100 Ga0157373_10404981 Ga0157373_104049811 116
154 3300013104 Ga0157370_10022834 Ga0157370_100228344 116
155 3300013104 Ga0157370_10629558 Ga0157370_106295581 116
156 3300013105 Ga0157369_10121906 Ga0157369_101219062 116
157 3300013297 Ga0157378_11779923 Ga0157378_117799232 116
158 3300013306 Ga0163162_10008696 Ga0163162_100086966 116
159 3300013307 Ga0157372_10002641 Ga0157372_100026413 116
160 3300014326 Ga0157380_10117363 Ga0157380_101173632 116
161 3300014969 Ga0157376_10246928 Ga0157376_102469282 116
162 3300014969 Ga0157376_11830914 Ga0157376_118309141 116
163 3300025250 Ga0209026_1003864 Ga0209026_10038644 116
164 3300025261 Ga0209233_1017862 Ga0209233_10178621 116
165 3300025304 Ga0209257_1000007 Ga0209257_10000071066 116
166 3300025304 Ga0209257_1041152 Ga0209257_10411523 116
167 3300025904 Ga0207647_10062857 Ga0207647_100628572 116
168 3300025909 Ga0207705_10387719 Ga0207705_103877192 116
169 3300025914 Ga0207671_10654890 Ga0207671_106548901 116
170 3300025939 Ga0207665_10148502 Ga0207665_101485023 116
171 3300025949 Ga0207667_10120330 Ga0207667_101203302 116
172 3300025949 Ga0207667_10316202 Ga0207667_103162023 116
173 3300026041 Ga0207639_10305028 Ga0207639_103050282 116
174 3300026078 Ga0207702_10019073 Ga0207702_100190733 116
175 3300026078 Ga0207702_10427265 Ga0207702_104272652 116
176 3300026078 Ga0207702_10561983 Ga0207702_105619832 116
177 3300026088 Ga0207641_10079194 Ga0207641_100791944 116
178 3300026095 Ga0207676_10183143 Ga0207676_101831433 116
179 3300026116 Ga0207674_10027882 Ga0207674_100278822 116
180 3300026118 Ga0207675_102354366 Ga0207675_1023543661 116
181 3300027907 Ga0207428_10570708 Ga0207428_105707082 116
182 3300031456 Ga0307513_10492680 Ga0307513_104926801 116
183 3300031507 Ga0307509_10047347 Ga0307509_100473476 116
184 3300031507 Ga0307509_10119889 Ga0307509_101198892 116
185 3300031507 Ga0307509_10167959 Ga0307509_101679592 116
186 3300031548 Ga0307408_100150290 Ga0307408_1001502902 116
187 3300031730 Ga0307516_10580304 Ga0307516_105803042 116
188 3300031824 Ga0307413_10085449 Ga0307413_100854492 116
189 3300031824 Ga0307413_11620603 Ga0307413_116206031 116
190 3300031852 Ga0307410_10078707 Ga0307410_100787073 116
191 3300031901 Ga0307406_10034645 Ga0307406_100346454 116
192 3300031911 Ga0307412_10049776 Ga0307412_100497762 116
193 3300031995 Ga0307409_100154036 Ga0307409_1001540362 116
194 3300032002 Ga0307416_100000229 Ga0307416_10000022912 116
195 3300032004 Ga0307414_10000109 Ga0307414_1000010935 116
196 3300032004 Ga0307414_10130723 Ga0307414_101307232 116
197 3300032126 Ga0307415_100005020 Ga0307415_1000050202 116
198 3300035112 Ga0373932_0142878 Ga0373932_0142878_395_775 116
199 3300035691 Ga0373931_0287813 Ga0373931_0287813_240_620 116
200 3300035695 Ga0373927_0009488 Ga0373927_0009488_5659_6033 116
201 3300041458 Ga0451798_0684554 Ga0451798_0684554_309_683 116
202 3300041486 Ga0451807_2723629 Ga0451807_2723629_287_685 116
203 3300041505 Ga0451849_1543657 Ga0451849_1543657_403_801 116
204 3300042007 Ga0439449_0430577 Ga0439449_0430577_94_474 116
205 3300042125 Ga0450923_140250 Ga0450923_140250_52_414 116
206 3300042876 Ga0451577_0028643 Ga0451577_0028643_2642_3022 116
207 3300044673 Ga0453683_0022968 Ga0453683_0022968_58_429 116
208 3300044712 Ga0453684_0001177 Ga0453684_0001177_78246_78626 116
209 3300044712 Ga0453684_1813710 Ga0453684_1813710_191_571 116
210 3300044712 Ga0453684_1833682 Ga0453684_1833682_171_551 116
211 3300045051 Ga0451576_0003574 Ga0451576_0003574_18690_19061 116
212 3300045051 Ga0451576_0008760 Ga0451576_0008760_10842_11222 116
213 3300045051 Ga0451576_0021248 Ga0451576_0021248_4371_4754 116
214 3300045051 Ga0451576_0320371 Ga0451576_0320371_1041_1421 116
215 3300046460 Ga0495638_0000004 Ga0495638_0000004_352451_352837 116
216 3300046460 Ga0495638_0198257 Ga0495638_0198257_401_751 116
217 3300046471 Ga0495650_0000268 Ga0495650_0000268_17866_18216 116
218 3300046492 Ga0495585_0000034 Ga0495585_0000034_89738_90088 116
219 3300046506 Ga0495583_0067108 Ga0495583_0067108_502_852 116
220 3300046507 Ga0495606_0000009 Ga0495606_0000009_10740_11090 116
221 3300046512 Ga0495610_0003590 Ga0495610_0003590_11527_11880 116
222 3300046512 Ga0495610_0069448 Ga0495610_0069448_1087_1437 116
223 3300046513 Ga0495616_0007494 Ga0495616_0007494_4875_5225 116
224 3300046520 Ga0495637_0178861 Ga0495637_0178861_379_729 116
225 3300046529 Ga0495652_0583364 Ga0495652_0583364_116_472 116
226 3300046530 Ga0495654_0207829 Ga0495654_0207829_94_444 116
227 3300046538 Ga0495609_0039495 Ga0495609_0039495_1657_2007 116
228 3300046558 Ga0495633_0002693 Ga0495633_0002693_10235_10588 116
229 3300046616 Ga0495668_0432110 Ga0495668_0432110_109_462 116
230 3300046660 Ga0495625_0000007 Ga0495625_0000007_347856_348206 116
231 3300046665 Ga0495661_0001101 Ga0495661_0001101_3147_3500 116
232 3300046665 Ga0495661_0002357 Ga0495661_0002357_965_1315 116
233 3300046680 Ga0495646_0707639 Ga0495646_0707639_84_458 116
234 3300046692 Ga0495671_0026295 Ga0495671_0026295_1935_2285 116
235 3300046694 Ga0495649_0000007 Ga0495649_0000007_89395_89745 116
236 3300047322 Ga0495680_0618944 Ga0495680_0618944_54_422 116
237 3300047323 Ga0495683_0084507 Ga0495683_0084507_578_931 116
238 3300047443 Ga0495687_001497 Ga0495687_001497_12720_13070 116
239 3300047446 Ga0495679_015804 Ga0495679_015804_1307_1657 116
240 3300047469 Ga0495673_0027678 Ga0495673_0027678_937_1287 116
241 3300049513 Ga0501290_041662 Ga0501290_041662_26_391 116
242 3300049585 Ga0501069_0041862 Ga0501069_0041862_1354_1740 116
243 3300049650 Ga0501199_009832 Ga0501199_009832_411_836 116
244 3300049653 Ga0501206_014541 Ga0501206_014541_140_505 116
245 3300049654 Ga0501207_040027 Ga0501207_040027_41_406 116
246 3300049662 Ga0501222_020388 Ga0501222_020388_16_381 116
247 3300049668 Ga0501233_204348 Ga0501233_204348_152_541 116
248 3300049672 Ga0501239_003493 Ga0501239_003493_666_1055 116
249 3300049686 Ga0501257_000534 Ga0501257_000534_6763_7128 116
250 3300049686 Ga0501257_141389 Ga0501257_141389_162_530 116
251 3300049686 Ga0501257_153546 Ga0501257_153546_41_406 116
252 3300049688 Ga0501259_016399 Ga0501259_016399_643_1008 116
253 3300049706 Ga0501229_029453 Ga0501229_029453_66_455 116
254 3300049765 Ga0501268_106955 Ga0501268_106955_157_531 116
255 3300049774 Ga0501278_010224 Ga0501278_010224_151_576 116
256 3300050493 nmdc:mga0k408_11130_c1 nmdc:mga0k408_11130_c1_2112_2486 116
257 3300050493 nmdc:mga0k408_283807_c1 nmdc:mga0k408_283807_c1_565_945 116
258 3300050496 nmdc:mga07m45_405794_c1 nmdc:mga07m45_405794_c1_37_387 116
259 3300050508 nmdc:mga09592_541682_c1 nmdc:mga09592_541682_c1_382_744 116
260 3300050509 nmdc:mga0qj67_800224_c1 nmdc:mga0qj67_800224_c1_69_452 116
261 3300050511 nmdc:mga08y16_14915_c1 nmdc:mga08y16_14915_c1_3881_4270 116
262 3300050511 nmdc:mga08y16_153898_c1 nmdc:mga08y16_153898_c1_1666_2028 116
263 3300053087 Ga0500643_072303 Ga0500643_072303_17_391 116
264 3300053088 Ga0500644_0302087 Ga0500644_0302087_120_470 116
265 3300053090 Ga0500646_0225080 Ga0500646_0225080_172_555 116
266 3300053090 Ga0500646_0255556 Ga0500646_0255556_165_539 116
267 3300053092 Ga0500583_0077639 Ga0500583_0077639_921_1298 116
268 3300053098 Ga0500650_0499684 Ga0500650_0499684_67_453 116
269 3300053105 Ga0500557_003315 Ga0500557_003315_1335_1721 116
270 3300053108 Ga0500562_002710 Ga0500562_002710_3607_3990 116
271 3300053125 Ga0500618_000006 Ga0500618_000006_174952_175308 116
272 3300053151 Ga0500604_0000080 Ga0500604_0000080_11128_11511 116
273 3300053151 Ga0500604_0053908 Ga0500604_0053908_630_1007 116
274 3300053153 Ga0500616_0000015 Ga0500616_0000015_474876_475262 116
275 3300053153 Ga0500616_0002318 Ga0500616_0002318_14737_15123 116
276 3300053156 Ga0500622_0000049 Ga0500622_0000049_68060_68443 116
277 3300053156 Ga0500622_0000056 Ga0500622_0000056_78258_78641 116
278 3300053156 Ga0500622_0062808 Ga0500622_0062808_641_1027 116
279 3300053157 Ga0500624_000567 Ga0500624_000567_1526_1876 116
280 3300053739 Ga0500587_001430 Ga0500587_001430_1971_2351 116
281 iso_pu_bacteria 2928147474 2928150323 116
282 iso_pu_bacteria 2932082852 2932085146 116

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j5t-assembly3.cif.gz_A glutamate 5-kinase from escherichia coli complexed with glutamate 0.686 32 67
3v9r-assembly1.cif.gz_C crystal structure of saccharomyces cerevisiae mhf complex 0.5531 28 69
3v9r-assembly1.cif.gz_A crystal structure of saccharomyces cerevisiae mhf complex 0.5361 28 69
3vh5-assembly1.cif.gz_A crystal structure of the chicken cenp-t histone fold/cenp-w/cenp-s/cenp-x heterotetrameric complex, crystal form i 0.4959 3 69
1e6y-assembly1.cif.gz_B methyl-coenzyme m reductase from methanosarcina barkeri 0.4804 32 86
ID Description Score Start End Superfamily
af_O13810_3_260_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.7541 32 66 3.40.1160.10
af_Q9N4N4_168_398_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.5793 71 108 3.30.420.40
af_Q9N4N4_204_315_3.90.640.10 Alpha Beta;Alpha-Beta Complex;Actin; Chain A, domain 4;ATPase, substrate binding domain, subdomain 4 0.5793 71 108 3.90.640.10
3v9rA00 Mainly Alpha;Orthogonal Bundle;Histone, subunit A;Histone, subunit A 0.5388 28 69 1.10.20.10
1s7bB00 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.5307 28 65 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A1H7V884-F1-model_v4 Uncharacterized protein 1.003 1 112
AF-A0A6M1Q5S2-F1-model_v4 deleted 1.003 35 113
AF-A0A1H8LQI6-F1-model_v4 Uncharacterized protein 1.001 1 112
AF-A0A223NQ57-F1-model_v4 Uncharacterized protein 1 1 112
AF-A0A1G9RLG6-F1-model_v4 Uncharacterized protein 0.9998 1 111

Feature Viewer

pLDDT pTM Quality
93.82 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map