F384562

General Info

Members Datasets Scaffolds Average Seq Length
281 201 562 244

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0007097|Ga0501032_0007097_43_837
Length 264
Sequence MIAGNRWATQEGVMPMAKAADAGRREGAGVSVASRVAALDWSEIASTLDSYGCAVTGPLLSAAECASLAGAYAADALFRSRVIMARHGFGRGEYKYFAYPLPDLVSSLRAALYPNLAEVANRWNAAMNIATRYPPDHESYLRLCHDAGQERPTPLLLRYEPGDYNCLHQDIYGEHVFPLQATVLLSEPAADFTGGEFVLTEQRPRMQSRAEVVPLRQGEAVIFPVRHRPVQGTRGIYRVNMRHGVSRIRSGRRHTLGIIFHDAK

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
134 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
198 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
201 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.63
Nodule 0.71
Rhizoplane 4.63
Rhizosphere 85.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0007097 3300049569 Bacteria 8202
2 JGI25158J39367_1001315 3300002739 Bacteria 4410
3 JGI25159J45721_1004219 3300002987 Bacteria 4843
4 JGI25161J50226_1000769 3300003374 Bacteria 12207
5 Ga0055543_1000813 3300004625 Bacteria 15357
6 Ga0065165_1002666 3300005262 Bacteria 14415
7 Ga0065712_10020256 3300005290 Bacteria 2024
8 Ga0065707_10176965 3300005295 Bacteria 1444
9 Ga0070658_10115669 3300005327 Bacteria 2225
10 Ga0070676_10087741 3300005328 Bacteria 1899
11 Ga0070677_10078048 3300005333 Bacteria 1410
12 Ga0068869_100157396 3300005334 Bacteria 1766
13 Ga0070680_100010053 3300005336 Bacteria 7290
14 Ga0068868_100030115 3300005338 Bacteria 4161
15 Ga0068868_100156413 3300005338 Bacteria 1880
16 Ga0070689_100182893 3300005340 Bacteria 1703
17 Ga0070661_100287709 3300005344 Bacteria 1276
18 Ga0070692_10164462 3300005345 Bacteria 1274
19 Ga0070668_100047698 3300005347 Bacteria 3294
20 Ga0070668_100128852 3300005347 Bacteria 2029
21 Ga0070668_100141740 3300005347 Bacteria 1937
22 Ga0070675_100467852 3300005354 Bacteria 1132
23 Ga0070671_100011967 3300005355 Bacteria 6979
24 Ga0070674_100001389 3300005356 Bacteria 12789
25 Ga0070674_100040712 3300005356 Bacteria 3145
26 Ga0070674_100174509 3300005356 Bacteria 1641
27 Ga0070673_100065565 3300005364 Bacteria 2897
28 Ga0070659_100004663 3300005366 Bacteria 9783
29 Ga0070667_100094999 3300005367 Bacteria 2569
30 Ga0070709_10130656 3300005434 Bacteria 1714
31 Ga0070713_100012577 3300005436 Bacteria 6214
32 Ga0070701_10003568 3300005438 Bacteria 6180
33 Ga0070711_100211333 3300005439 Bacteria 1503
34 Ga0070694_100329417 3300005444 Bacteria 1177
35 Ga0070663_100022004 3300005455 Bacteria 4253
36 Ga0070663_100372852 3300005455 Bacteria 1160
37 Ga0070678_100013870 3300005456 Bacteria 5066
38 Ga0070662_100003483 3300005457 Bacteria 9812
39 Ga0070662_100096994 3300005457 Bacteria 2225
40 Ga0070681_10217931 3300005458 Bacteria 1824
41 Ga0068867_100007229 3300005459 Bacteria 7851
42 Ga0068867_100055034 3300005459 Bacteria 2941
43 Ga0068867_100697015 3300005459 Bacteria 896
44 Ga0070679_100009252 3300005530 Bacteria 9312
45 Ga0068853_100015923 3300005539 Bacteria 6180
46 Ga0070672_100320992 3300005543 Bacteria 1316
47 Ga0070695_100200202 3300005545 Bacteria 1427
48 Ga0070696_100162345 3300005546 Bacteria 1647
49 Ga0070693_100027536 3300005547 Bacteria 3082
50 Ga0070665_100046629 3300005548 Bacteria 4352
51 Ga0068854_100158155 3300005578 Bacteria 1753
52 Ga0068854_100164334 3300005578 Bacteria 1722
53 Ga0068854_100296776 3300005578 Bacteria 1306
54 Ga0068856_100295644 3300005614 Bacteria 1636
55 Ga0068852_100234464 3300005616 Bacteria 1751
56 Ga0068852_100276879 3300005616 Bacteria 1616
57 Ga0068859_100294375 3300005617 Bacteria 1716
58 Ga0068859_100643981 3300005617 Bacteria 1152
59 Ga0068864_100117374 3300005618 Bacteria 2375
60 Ga0068866_10056846 3300005718 Bacteria 2013
61 Ga0068866_10155985 3300005718 Bacteria 1327
62 Ga0068861_100006825 3300005719 Bacteria 7794
63 Ga0068861_100358238 3300005719 Bacteria 1282
64 Ga0068851_10009136 3300005834 Bacteria 4605
65 Ga0068870_10008758 3300005840 Bacteria 4563
66 Ga0068858_100021129 3300005842 Bacteria 6080
67 Ga0068860_100149236 3300005843 Bacteria 2250
68 Ga0068862_100112997 3300005844 Bacteria 2386
69 Ga0070717_10011911 3300006028 Bacteria 6617
70 Ga0097621_100005184 3300006237 Bacteria 9158
71 Ga0097621_100007530 3300006237 Bacteria 7796
72 Ga0097621_100155395 3300006237 Bacteria 1963
73 Ga0068871_100011488 3300006358 Bacteria 6497
74 Ga0068871_100011563 3300006358 Bacteria 6476
75 Ga0075430_100052198 3300006846 Bacteria 3444
76 Ga0075430_100301793 3300006846 Bacteria 1325
77 Ga0075431_100103769 3300006847 Bacteria 2934
78 Ga0075433_10072423 3300006852 Bacteria 3030
79 Ga0075434_100139523 3300006871 Bacteria 2443
80 Ga0075429_100219890 3300006880 Bacteria 1664
81 Ga0075429_100338787 3300006880 Bacteria 1316
82 Ga0097620_100294371 3300006931 Bacteria 1716
83 Ga0097620_100643955 3300006931 Bacteria 1152
84 Ga0105240_10000244 3300009093 Bacteria 107739
85 Ga0105240_10563934 3300009093 Bacteria 1258
86 Ga0105245_10013915 3300009098 Bacteria 7007
87 Ga0114129_10504541 3300009147 Bacteria 1580
88 Ga0105248_10021945 3300009177 Bacteria 7075
89 Ga0105248_10512094 3300009177 Bacteria 1353
90 Ga0105237_10069928 3300009545 Bacteria 3505
91 Ga0105238_10683206 3300009551 Bacteria 1038
92 Ga0105239_10000043 3300010375 Bacteria 196600
93 Ga0157371_10011186 3300013102 Bacteria 6941
94 Ga0157369_10623587 3300013105 Bacteria 1113
95 Ga0157374_10022597 3300013296 Bacteria 5611
96 Ga0157374_10077600 3300013296 Bacteria 3144
97 Ga0157378_10453064 3300013297 Bacteria 1274
98 Ga0163162_10041383 3300013306 Bacteria 4610
99 Ga0163162_10347833 3300013306 Bacteria 1615
100 Ga0163162_10510795 3300013306 Bacteria 1332
101 Ga0157372_10034974 3300013307 Bacteria 5529
102 Ga0163163_10671771 3300014325 Bacteria 1099
103 Ga0157380_10099044 3300014326 Bacteria 2423
104 Ga0157380_10174988 3300014326 Bacteria 1879
105 Ga0157377_10023434 3300014745 Bacteria 3271
106 Ga0157379_10014408 3300014968 Bacteria 6937
107 Ga0157379_10131601 3300014968 Bacteria 2252
108 Ga0157379_10439268 3300014968 Bacteria 1203
109 Ga0157379_10459422 3300014968 Bacteria 1176
110 Ga0157376_10024539 3300014969 Bacteria 4737
111 Ga0157376_10055610 3300014969 Bacteria 3303
112 Ga0163161_10017520 3300017792 Bacteria 5013
113 Ga0213874_10007979 3300021377 Bacteria 2563
114 Ga0213875_10000759 3300021388 Bacteria 24322
115 Ga0213875_10019752 3300021388 Bacteria 3238
116 Ga0209436_100830 3300025208 Bacteria 12535
117 Ga0209130_1001775 3300025284 Bacteria 12704
118 Ga0209564_1019557 3300025295 Bacteria 2524
119 Ga0207426_1023755 3300025302 Bacteria 2089
120 Ga0207697_10181516 3300025315 Bacteria 922
121 Ga0207688_10003881 3300025901 Bacteria 8153
122 Ga0207647_10247307 3300025904 Bacteria 1023
123 Ga0207645_10226868 3300025907 Bacteria 1232
124 Ga0207643_10075387 3300025908 Bacteria 1947
125 Ga0207643_10295235 3300025908 Bacteria 1008
126 Ga0207654_10391786 3300025911 Bacteria 964
127 Ga0207707_10019404 3300025912 Bacteria 5935
128 Ga0207695_10000262 3300025913 Bacteria 133005
129 Ga0207671_10209533 3300025914 Bacteria 1524
130 Ga0207663_10621055 3300025916 Bacteria 851
131 Ga0207657_10036238 3300025919 Bacteria 4417
132 Ga0207657_10114619 3300025919 Bacteria 2222
133 Ga0207649_10078343 3300025920 Bacteria 2132
134 Ga0207681_10235285 3300025923 Bacteria 1423
135 Ga0207700_10047813 3300025928 Bacteria 3173
136 Ga0207664_10036457 3300025929 Bacteria 3802
137 Ga0207644_10004569 3300025931 Bacteria 9000
138 Ga0207644_10084092 3300025931 Bacteria 2358
139 Ga0207644_10193796 3300025931 Bacteria 1599
140 Ga0207690_10010772 3300025932 Bacteria 5449
141 Ga0207706_10010374 3300025933 Bacteria 8508
142 Ga0207706_10036413 3300025933 Bacteria 4371
143 Ga0207706_10194133 3300025933 Bacteria 1781
144 Ga0207686_10056460 3300025934 Bacteria 2468
145 Ga0207669_10002457 3300025937 Bacteria 7911
146 Ga0207669_10045045 3300025937 Bacteria 2597
147 Ga0207711_10028711 3300025941 Bacteria 4684
148 Ga0207689_10002313 3300025942 Bacteria 17849
149 Ga0207689_10153280 3300025942 Bacteria 1899
150 Ga0207661_10227789 3300025944 Bacteria 1649
151 Ga0207667_10224024 3300025949 Bacteria 1926
152 Ga0207651_10022303 3300025960 Bacteria 3868
153 Ga0207668_10068672 3300025972 Bacteria 2521
154 Ga0207668_10231755 3300025972 Bacteria 1489
155 Ga0207640_10019791 3300025981 Bacteria 3983
156 Ga0207640_10291516 3300025981 Bacteria 1287
157 Ga0207658_10057733 3300025986 Bacteria 2886
158 Ga0207658_10270881 3300025986 Bacteria 1451
159 Ga0207703_10026417 3300026035 Bacteria 4569
160 Ga0207703_10184286 3300026035 Bacteria 1844
161 Ga0207703_10186402 3300026035 Bacteria 1834
162 Ga0207639_10072388 3300026041 Bacteria 2698
163 Ga0207639_10736646 3300026041 Bacteria 916
164 Ga0207678_10020104 3300026067 Bacteria 5864
165 Ga0207678_10141294 3300026067 Bacteria 2055
166 Ga0207702_10097625 3300026078 Bacteria 2586
167 Ga0207641_10063935 3300026088 Bacteria 3144
168 Ga0207648_10013356 3300026089 Bacteria 7643
169 Ga0207648_10182698 3300026089 Bacteria 1856
170 Ga0207648_10541379 3300026089 Bacteria 1069
171 Ga0207648_10752521 3300026089 Bacteria 905
172 Ga0207676_10021943 3300026095 Bacteria 4690
173 Ga0207676_10170949 3300026095 Bacteria 1893
174 Ga0207675_100000656 3300026118 Bacteria 34030
175 Ga0207675_100003645 3300026118 Bacteria 15012
176 Ga0207675_100235907 3300026118 Bacteria 1766
177 Ga0207683_10000702 3300026121 Bacteria 30562
178 Ga0207683_10163658 3300026121 Bacteria 2012
179 Ga0207683_10354182 3300026121 Bacteria 1347
180 Ga0207698_10139465 3300026142 Bacteria 2086
181 Ga0207698_10272278 3300026142 Bacteria 1562
182 Ga0268266_10344919 3300028379 Bacteria 1398
183 Ga0268266_10355335 3300028379 Bacteria 1378
184 Ga0268265_10200696 3300028380 Bacteria 1730
185 Ga0307517_10233139 3300028786 Bacteria 1102
186 Ga0307413_10004231 3300031824 Bacteria 6207
187 Ga0307410_10045060 3300031852 Bacteria 2934
188 Ga0307407_10012065 3300031903 Bacteria 4141
189 Ga0307414_10528060 3300032004 Bacteria 1048
190 Ga0373941_0039213 3300035115 Bacteria 1455
191 Ga0373942_0030347 3300035207 Bacteria 1424
192 Ga0373931_0008368 3300035691 Bacteria 4903
193 Ga0373947_0135590 3300035725 Bacteria 1575
194 Ga0373937_1005715 3300036401 Bacteria 782
195 Ga0436364_1032274 3300037853 Bacteria 3238
196 Ga0436364_1149423 3300037853 Bacteria 148108
197 Ga0436361_0103578 3300039447 Bacteria 4908
198 Ga0436363_0665751 3300039450 Bacteria 1621
199 Ga0451853_3011850 3300041512 Bacteria 797
200 Ga0439435_0040188 3300042436 Bacteria 1306
201 Ga0466957_0297368 3300044842 Bacteria 1084
202 Ga0451576_0047281 3300045051 Bacteria 4525
203 Ga0495634_0222913 3300046642 Bacteria 1163
204 Ga0495625_0015062 3300046660 Bacteria 6141
205 Ga0495613_0280656 3300046689 Bacteria 1157
206 Ga0495670_0201194 3300046691 Bacteria 1055
207 Ga0496100_0028569 3300048903 Bacteria 3441
208 Ga0496101_0007862 3300048904 Bacteria 6938
209 Ga0496104_0064673 3300048907 Bacteria 3470
210 Ga0496105_0002129 3300048908 Bacteria 14348
211 Ga0496106_0089008 3300048909 Bacteria 2380
212 Ga0496107_0020074 3300048910 Bacteria 4718
213 Ga0496109_0024243 3300048912 Bacteria 5392
214 Ga0496109_0796840 3300048912 Bacteria 883
215 Ga0496110_0079928 3300048913 Bacteria 2912
216 Ga0496111_0057563 3300048914 Bacteria 2814
217 Ga0496112_0356820 3300048915 Bacteria 1404
218 Ga0496113_0212487 3300048916 Bacteria 1540
219 Ga0496114_0131951 3300048917 Bacteria 2158
220 Ga0496117_0054633 3300048920 Bacteria 2796
221 Ga0496118_0010226 3300048921 Bacteria 9312
222 Ga0496119_0000531 3300048922 Bacteria 51990
223 Ga0496120_0000182 3300048923 Bacteria 107094
224 Ga0496121_0073501 3300048924 Bacteria 2739
225 Ga0496126_0246880 3300048929 Bacteria 1489
226 Ga0501032_0074863 3300049569 Bacteria 2256
227 Ga0501033_0000555 3300049570 Bacteria 34773
228 Ga0501033_0098368 3300049570 Bacteria 2137
229 Ga0501034_0233356 3300049571 Bacteria 1788
230 Ga0501034_0248468 3300049571 Bacteria 1723
231 Ga0501036_0257658 3300049572 Bacteria 1461
232 Ga0501037_0040948 3300049573 Bacteria 3409
233 Ga0501037_0057261 3300049573 Bacteria 2845
234 Ga0501038_0017102 3300049574 Bacteria 6561
235 Ga0501039_0009827 3300049575 Bacteria 7292
236 Ga0501039_0180076 3300049575 Bacteria 1662
237 Ga0501042_0138979 3300049578 Bacteria 1751
238 Ga0501043_0016910 3300049579 Bacteria 5717
239 Ga0501043_0225483 3300049579 Bacteria 1448
240 Ga0501046_0007458 3300049580 Bacteria 9610
241 Ga0501046_0128717 3300049580 Bacteria 1921
242 Ga0501047_0001702 3300049581 Bacteria 21390
243 Ga0501047_0117755 3300049581 Bacteria 2538
244 Ga0501047_0355771 3300049581 Bacteria 1300
245 Ga0501048_0060259 3300049582 Bacteria 2689
246 Ga0501069_0062794 3300049585 Bacteria 2074
247 Ga0501070_0019370 3300049586 Bacteria 5705
248 Ga0501070_0527971 3300049586 Bacteria 946
249 Ga0501071_0003215 3300049587 Bacteria 10174
250 Ga0501071_0026803 3300049587 Bacteria 4049
251 Ga0501072_0224493 3300049588 Bacteria 1497
252 Ga0501073_0001721 3300049589 Bacteria 16256
253 Ga0501073_0013706 3300049589 Bacteria 5896
254 Ga0501074_0000200 3300049590 Bacteria 32565
255 Ga0501076_0596568 3300049592 Bacteria 911
256 Ga0501077_0326749 3300049593 Bacteria 978
257 Ga0501080_0005454 3300049742 Bacteria 11346
258 Ga0501080_0035378 3300049742 Bacteria 4661
259 Ga0501080_0077690 3300049742 Bacteria 3087
260 Ga0501080_0309376 3300049742 Bacteria 1432
261 Ga0501083_0058490 3300049744 Bacteria 2579
262 Ga0501035_0099294 3300049822 Bacteria 2555
263 Ga0501044_0010792 3300049823 Bacteria 9910
264 Ga0501044_0026070 3300049823 Bacteria 6191
265 Ga0501044_0120322 3300049823 Bacteria 2627
266 Ga0501044_0165104 3300049823 Bacteria 2189
267 nmdc:mga0yw44_156955_c1 3300050492 Bacteria 1487
268 nmdc:mga0yw44_60094_c1 3300050492 Bacteria 2327
269 nmdc:mga09592_269544_c1 3300050508 Bacteria 1477
270 nmdc:mga0qj67_233144_c1 3300050509 Bacteria 1494
271 nmdc:mga0qj67_50882_c1 3300050509 Bacteria 3275
272 nmdc:mga06r32_37710_c1 3300050510 Bacteria 4572
273 nmdc:mga0a205_123283_c1 3300050515 Bacteria 2491
274 Ga0495601_0342593 3300053077 Bacteria 972
275 Ga0495595_0058639 3300053084 Bacteria 1798
276 Ga0500641_0004711 3300053096 Bacteria 4820
277 Ga0500609_007090 3300053731 Bacteria 1515
278 Ga0501082_0122809 3300060353 Bacteria 2252
279 Ga0501082_0203564 3300060353 Bacteria 1722
280 644750963 644736347 Bacteria 6476522
281 8056685504 8056681323 Bacteria 8472857
282 Ga0501032_0007097
283 JGI25158J39367_1001315
284 JGI25159J45721_1004219
285 JGI25161J50226_1000769
286 Ga0055543_1000813
287 Ga0065165_1002666
288 Ga0065712_10020256
289 Ga0065707_10176965
290 Ga0070658_10115669
291 Ga0070676_10087741
292 Ga0070677_10078048
293 Ga0068869_100157396
294 Ga0070680_100010053
295 Ga0068868_100030115
296 Ga0068868_100156413
297 Ga0070689_100182893
298 Ga0070661_100287709
299 Ga0070692_10164462
300 Ga0070668_100047698
301 Ga0070668_100128852
302 Ga0070668_100141740
303 Ga0070675_100467852
304 Ga0070671_100011967
305 Ga0070674_100001389
306 Ga0070674_100040712
307 Ga0070674_100174509
308 Ga0070673_100065565
309 Ga0070659_100004663
310 Ga0070667_100094999
311 Ga0070709_10130656
312 Ga0070713_100012577
313 Ga0070701_10003568
314 Ga0070711_100211333
315 Ga0070694_100329417
316 Ga0070663_100022004
317 Ga0070663_100372852
318 Ga0070678_100013870
319 Ga0070662_100003483
320 Ga0070662_100096994
321 Ga0070681_10217931
322 Ga0068867_100007229
323 Ga0068867_100055034
324 Ga0068867_100697015
325 Ga0070679_100009252
326 Ga0068853_100015923
327 Ga0070672_100320992
328 Ga0070695_100200202
329 Ga0070696_100162345
330 Ga0070693_100027536
331 Ga0070665_100046629
332 Ga0068854_100158155
333 Ga0068854_100164334
334 Ga0068854_100296776
335 Ga0068856_100295644
336 Ga0068852_100234464
337 Ga0068852_100276879
338 Ga0068859_100294375
339 Ga0068859_100643981
340 Ga0068864_100117374
341 Ga0068866_10056846
342 Ga0068866_10155985
343 Ga0068861_100006825
344 Ga0068861_100358238
345 Ga0068851_10009136
346 Ga0068870_10008758
347 Ga0068858_100021129
348 Ga0068860_100149236
349 Ga0068862_100112997
350 Ga0070717_10011911
351 Ga0097621_100005184
352 Ga0097621_100007530
353 Ga0097621_100155395
354 Ga0068871_100011488
355 Ga0068871_100011563
356 Ga0075430_100052198
357 Ga0075430_100301793
358 Ga0075431_100103769
359 Ga0075433_10072423
360 Ga0075434_100139523
361 Ga0075429_100219890
362 Ga0075429_100338787
363 Ga0097620_100294371
364 Ga0097620_100643955
365 Ga0105240_10000244
366 Ga0105240_10563934
367 Ga0105245_10013915
368 Ga0114129_10504541
369 Ga0105248_10021945
370 Ga0105248_10512094
371 Ga0105237_10069928
372 Ga0105238_10683206
373 Ga0105239_10000043
374 Ga0157371_10011186
375 Ga0157369_10623587
376 Ga0157374_10022597
377 Ga0157374_10077600
378 Ga0157378_10453064
379 Ga0163162_10041383
380 Ga0163162_10347833
381 Ga0163162_10510795
382 Ga0157372_10034974
383 Ga0163163_10671771
384 Ga0157380_10099044
385 Ga0157380_10174988
386 Ga0157377_10023434
387 Ga0157379_10014408
388 Ga0157379_10131601
389 Ga0157379_10439268
390 Ga0157379_10459422
391 Ga0157376_10024539
392 Ga0157376_10055610
393 Ga0163161_10017520
394 Ga0213874_10007979
395 Ga0213875_10000759
396 Ga0213875_10019752
397 Ga0209436_100830
398 Ga0209130_1001775
399 Ga0209564_1019557
400 Ga0207426_1023755
401 Ga0207697_10181516
402 Ga0207688_10003881
403 Ga0207647_10247307
404 Ga0207645_10226868
405 Ga0207643_10075387
406 Ga0207643_10295235
407 Ga0207654_10391786
408 Ga0207707_10019404
409 Ga0207695_10000262
410 Ga0207671_10209533
411 Ga0207663_10621055
412 Ga0207657_10036238
413 Ga0207657_10114619
414 Ga0207649_10078343
415 Ga0207681_10235285
416 Ga0207700_10047813
417 Ga0207664_10036457
418 Ga0207644_10004569
419 Ga0207644_10084092
420 Ga0207644_10193796
421 Ga0207690_10010772
422 Ga0207706_10010374
423 Ga0207706_10036413
424 Ga0207706_10194133
425 Ga0207686_10056460
426 Ga0207669_10002457
427 Ga0207669_10045045
428 Ga0207711_10028711
429 Ga0207689_10002313
430 Ga0207689_10153280
431 Ga0207661_10227789
432 Ga0207667_10224024
433 Ga0207651_10022303
434 Ga0207668_10068672
435 Ga0207668_10231755
436 Ga0207640_10019791
437 Ga0207640_10291516
438 Ga0207658_10057733
439 Ga0207658_10270881
440 Ga0207703_10026417
441 Ga0207703_10184286
442 Ga0207703_10186402
443 Ga0207639_10072388
444 Ga0207639_10736646
445 Ga0207678_10020104
446 Ga0207678_10141294
447 Ga0207702_10097625
448 Ga0207641_10063935
449 Ga0207648_10013356
450 Ga0207648_10182698
451 Ga0207648_10541379
452 Ga0207648_10752521
453 Ga0207676_10021943
454 Ga0207676_10170949
455 Ga0207675_100000656
456 Ga0207675_100003645
457 Ga0207675_100235907
458 Ga0207683_10000702
459 Ga0207683_10163658
460 Ga0207683_10354182
461 Ga0207698_10139465
462 Ga0207698_10272278
463 Ga0268266_10344919
464 Ga0268266_10355335
465 Ga0268265_10200696
466 Ga0307517_10233139
467 Ga0307413_10004231
468 Ga0307410_10045060
469 Ga0307407_10012065
470 Ga0307414_10528060
471 Ga0373941_0039213
472 Ga0373942_0030347
473 Ga0373931_0008368
474 Ga0373947_0135590
475 Ga0373937_1005715
476 Ga0436364_1032274
477 Ga0436364_1149423
478 Ga0436361_0103578
479 Ga0436363_0665751
480 Ga0451853_3011850
481 Ga0439435_0040188
482 Ga0466957_0297368
483 Ga0451576_0047281
484 Ga0495634_0222913
485 Ga0495625_0015062
486 Ga0495613_0280656
487 Ga0495670_0201194
488 Ga0496100_0028569
489 Ga0496101_0007862
490 Ga0496104_0064673
491 Ga0496105_0002129
492 Ga0496106_0089008
493 Ga0496107_0020074
494 Ga0496109_0024243
495 Ga0496109_0796840
496 Ga0496110_0079928
497 Ga0496111_0057563
498 Ga0496112_0356820
499 Ga0496113_0212487
500 Ga0496114_0131951
501 Ga0496117_0054633
502 Ga0496118_0010226
503 Ga0496119_0000531
504 Ga0496120_0000182
505 Ga0496121_0073501
506 Ga0496126_0246880
507 Ga0501032_0074863
508 Ga0501033_0000555
509 Ga0501033_0098368
510 Ga0501034_0233356
511 Ga0501034_0248468
512 Ga0501036_0257658
513 Ga0501037_0040948
514 Ga0501037_0057261
515 Ga0501038_0017102
516 Ga0501039_0009827
517 Ga0501039_0180076
518 Ga0501042_0138979
519 Ga0501043_0016910
520 Ga0501043_0225483
521 Ga0501046_0007458
522 Ga0501046_0128717
523 Ga0501047_0001702
524 Ga0501047_0117755
525 Ga0501047_0355771
526 Ga0501048_0060259
527 Ga0501069_0062794
528 Ga0501070_0019370
529 Ga0501070_0527971
530 Ga0501071_0003215
531 Ga0501071_0026803
532 Ga0501072_0224493
533 Ga0501073_0001721
534 Ga0501073_0013706
535 Ga0501074_0000200
536 Ga0501076_0596568
537 Ga0501077_0326749
538 Ga0501080_0005454
539 Ga0501080_0035378
540 Ga0501080_0077690
541 Ga0501080_0309376
542 Ga0501083_0058490
543 Ga0501035_0099294
544 Ga0501044_0010792
545 Ga0501044_0026070
546 Ga0501044_0120322
547 Ga0501044_0165104
548 nmdc:mga0yw44_156955_c1
549 nmdc:mga0yw44_60094_c1
550 nmdc:mga09592_269544_c1
551 nmdc:mga0qj67_233144_c1
552 nmdc:mga0qj67_50882_c1
553 nmdc:mga06r32_37710_c1
554 nmdc:mga0a205_123283_c1
555 Ga0495601_0342593
556 Ga0495595_0058639
557 Ga0500641_0004711
558 Ga0500609_007090
559 Ga0501082_0122809
560 Ga0501082_0203564
561 644750963
562 8056685504

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09859

Oxygenase-NA

Oxygenase, catalysing oxidative methylation of damaged DNA

92

263

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p7w-assembly1.cif.gz_A l-proline-bound l-proline cis-4-hydroxylase 0.7404 131 237
6l9i-assembly1.cif.gz_A crystal structure of lactobacillus farciminis oxalate decarboxylase formate complex 0.7387 131 240
4j25-assembly7.cif.gz_G crystal structure of a pseudomonas putida prolyl-4-hydroxylase (p4h) 0.7276 19 239
4j25-assembly6.cif.gz_F crystal structure of a pseudomonas putida prolyl-4-hydroxylase (p4h) 0.7208 19 238
2uy8-assembly1.cif.gz_A r92a mutant of bacillus subtilis oxalate decarboxylase oxdc 0.7201 132 242
ID Description Score Start End Superfamily
af_P9WLH7_61_232_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9534 75 241 2.60.120.590
af_P9WLH7_61_232_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9213 75 241 2.60.120.590
af_Q20679_557_729_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8026 131 238 2.60.120.620
4j25F00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7208 19 238 2.60.120.620
af_Q9S772_37_227_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7082 131 240 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2G3LM63-F1-model_v4 Proline hydroxylase 0.9967 34 242 GO:0016491
GO:0046872
AF-A0A536UGM0-F1-model_v4 Proline hydroxylase 0.9966 21 242 GO:0016491
GO:0046872
AF-A0A372JYQ6-F1-model_v4 Proline hydroxylase 0.9966 16 242 GO:0016491
GO:0046872
AF-A0A3D9HE48-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9965 23 242 GO:0016491
GO:0046872
AF-A0A329DDX1-F1-model_v4 deleted 0.9962 16 242

Map