F384302

General Info

Members Datasets Scaffolds Average Seq Length
281 216 279 150

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10470796|Ga0157375_104707963
Length 180
Sequence LGAGRYDASINSPGQRAQRQLRENSESKGELIMPTGTIRLHRVLRAPPERVYRAFLDADAKAKWLPPYGFTCKVHHLDAKVGGTYKMSFTNFTTGHGHSFGGEYRELVPSERIRYTDRFDDPNLPGEMQTTVTLRQVSCGTELNIVQEGVPEAIPVEMCYLGWQESLAQLAKLVEPEIPG

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2738541283 Pedobacter sp. OK701 Isolate Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
135 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
136 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
207 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
208 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
209 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
214 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.12
Nodule 0
Rhizoplane 1.42
Rhizosphere 85.05
Stem 0
Stem Tuber 0
Unclassified 6.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1041130 3300002705 Bacteria 637
2 JGI25153J46596_10021622 3300003215 Bacteria 2392
3 Ga0065712_10329068 3300005290 Bacteria 817
4 Ga0070676_10007271 3300005328 Bacteria 5939
5 Ga0070670_100413756 3300005331 Bacteria 1191
6 Ga0068869_100014487 3300005334 Bacteria 5268
7 Ga0068868_100269893 3300005338 Bacteria 1437
8 Ga0070689_100321485 3300005340 Bacteria 1292
9 Ga0070691_10090441 3300005341 Bacteria 1508
10 Ga0070691_10151083 3300005341 Bacteria 1191
11 Ga0070687_100592593 3300005343 Bacteria 760
12 Ga0070668_100958809 3300005347 Bacteria 767
13 Ga0070671_100613207 3300005355 Bacteria 941
14 Ga0070674_100307579 3300005356 Bacteria 1266
15 Ga0070673_100003637 3300005364 Bacteria 9647
16 Ga0070659_100748513 3300005366 Bacteria 847
17 Ga0070667_100093117 3300005367 Bacteria 2595
18 Ga0070703_10100874 3300005406 Bacteria 1017
19 Ga0070701_10520934 3300005438 Bacteria 775
20 Ga0070705_100092438 3300005440 Bacteria 1888
21 Ga0070700_100407202 3300005441 Bacteria 1024
22 Ga0070694_100010290 3300005444 Bacteria 5766
23 Ga0070708_102020140 3300005445 Bacteria 534
24 Ga0070678_100022446 3300005456 Bacteria 4183
25 Ga0068867_100022511 3300005459 Bacteria 4506
26 Ga0068867_100051145 3300005459 Bacteria 3047
27 Ga0070706_100021834 3300005467 Bacteria 5895
28 Ga0070706_100102994 3300005467 Bacteria 2654
29 Ga0070706_101346317 3300005467 Bacteria 654
30 Ga0070707_100074831 3300005468 Bacteria 3266
31 Ga0070707_100676650 3300005468 Bacteria 995
32 Ga0070698_101677067 3300005471 Bacteria 588
33 Ga0070697_100517886 3300005536 Bacteria 1044
34 Ga0070672_100051363 3300005543 Bacteria 3215
35 Ga0070695_100001022 3300005545 Bacteria 15270
36 Ga0070695_100083806 3300005545 Bacteria 2113
37 Ga0070696_101106451 3300005546 Bacteria 666
38 Ga0070693_100784240 3300005547 Bacteria 705
39 Ga0070704_100220661 3300005549 Bacteria 1541
40 Ga0068855_100291887 3300005563 Bacteria 1808
41 Ga0068855_100506225 3300005563 Bacteria 1312
42 Ga0070664_100063531 3300005564 Bacteria 3148
43 Ga0068857_100015328 3300005577 Bacteria 6692
44 Ga0068854_100042802 3300005578 Bacteria 3207
45 Ga0068854_100128715 3300005578 Bacteria 1931
46 Ga0068854_100447765 3300005578 Bacteria 1078
47 Ga0068859_100235503 3300005617 Bacteria 1919
48 Ga0068864_100009530 3300005618 Bacteria 8013
49 Ga0068866_10048267 3300005718 Bacteria 2152
50 Ga0068861_100000163 3300005719 Bacteria 34909
51 Ga0068870_10007131 3300005840 Bacteria 4971
52 Ga0068870_10231502 3300005840 Bacteria 1136
53 Ga0068863_100067429 3300005841 Bacteria 3384
54 Ga0068858_100021710 3300005842 Bacteria 5999
55 Ga0068860_100030886 3300005843 Bacteria 5151
56 Ga0068862_100008828 3300005844 Bacteria 8348
57 Ga0081455_10002261 3300005937 Bacteria 22946
58 Ga0081455_10400233 3300005937 Bacteria 953
59 Ga0075432_10054637 3300006058 Bacteria 1414
60 Ga0070712_100494049 3300006175 Bacteria 1025
61 Ga0075362_10191789 3300006177 Bacteria 993
62 Ga0075362_10423339 3300006177 Bacteria 674
63 Ga0075366_10001709 3300006195 Bacteria 11032
64 Ga0075366_10110009 3300006195 Bacteria 1657
65 Ga0075366_10300583 3300006195 Bacteria 982
66 Ga0075370_10573271 3300006353 Bacteria 683
67 Ga0075433_10059137 3300006852 Bacteria 3353
68 Ga0075436_100022957 3300006914 Bacteria 4286
69 Ga0097620_100235496 3300006931 Bacteria 1919
70 Ga0099795_10067496 3300007788 Bacteria 1342
71 Ga0105240_11219920 3300009093 Bacteria 796
72 Ga0105245_10661395 3300009098 Bacteria 1075
73 Ga0105245_10713736 3300009098 Bacteria 1036
74 Ga0114129_10060098 3300009147 Bacteria 5314
75 Ga0114129_10253859 3300009147 Bacteria 2359
76 Ga0105243_10088668 3300009148 Bacteria 2542
77 Ga0105243_10226558 3300009148 Bacteria 1656
78 Ga0105248_10005106 3300009177 Bacteria 14485
79 Ga0105239_10478528 3300010375 Bacteria 1415
80 Ga0105239_10518873 3300010375 Bacteria 1355
81 Ga0105246_10042282 3300011119 Bacteria 3086
82 Ga0105246_10702758 3300011119 Bacteria 886
83 Ga0157378_10010313 3300013297 Bacteria 8156
84 Ga0157378_10037827 3300013297 Bacteria 4276
85 Ga0157378_10532786 3300013297 Bacteria 1177
86 Ga0163162_10182795 3300013306 Bacteria 2223
87 Ga0163162_10202229 3300013306 Bacteria 2115
88 Ga0157372_10050010 3300013307 Bacteria 4650
89 Ga0157375_10112930 3300013308 Bacteria 2817
90 Ga0157375_10470796 3300013308 Bacteria 1422
91 Ga0157380_10130230 3300014326 Bacteria 2145
92 Ga0157380_10256540 3300014326 Bacteria 1586
93 Ga0182008_10011231 3300014497 Bacteria 4771
94 Ga0157379_10002520 3300014968 Bacteria 15334
95 Ga0157376_11325824 3300014969 Bacteria 750
96 Ga0209759_1001255 3300025256 Bacteria 15355
97 Ga0209758_1000045 3300025297 Bacteria 369174
98 Ga0207653_10061755 3300025885 Bacteria 1265
99 Ga0207710_10057849 3300025900 Bacteria 1752
100 Ga0207680_10064628 3300025903 Bacteria 2244
101 Ga0207699_10628009 3300025906 Bacteria 783
102 Ga0207645_10008775 3300025907 Bacteria 7030
103 Ga0207684_10976975 3300025910 Bacteria 709
104 Ga0207693_10514046 3300025915 Bacteria 935
105 Ga0207662_10159129 3300025918 Bacteria 1442
106 Ga0207657_10189496 3300025919 Bacteria 1660
107 Ga0207646_10066142 3300025922 Bacteria 3227
108 Ga0207646_10398955 3300025922 Bacteria 1242
109 Ga0207681_10014348 3300025923 Bacteria 4922
110 Ga0207650_10005891 3300025925 Bacteria 8366
111 Ga0207650_10597780 3300025925 Bacteria 928
112 Ga0207650_10747675 3300025925 Bacteria 827
113 Ga0207687_10471209 3300025927 Bacteria 1044
114 Ga0207644_10074348 3300025931 Bacteria 2494
115 Ga0207644_10264687 3300025931 Bacteria 1376
116 Ga0207706_10089838 3300025933 Bacteria 2701
117 Ga0207709_10087512 3300025935 Bacteria 2025
118 Ga0207709_10141135 3300025935 Bacteria 1656
119 Ga0207670_10160974 3300025936 Bacteria 1675
120 Ga0207669_10103875 3300025937 Bacteria 1886
121 Ga0207669_10282239 3300025937 Bacteria 1253
122 Ga0207704_10488484 3300025938 Bacteria 990
123 Ga0207691_10003291 3300025940 Bacteria 15739
124 Ga0207691_11107957 3300025940 Bacteria 658
125 Ga0207689_10118846 3300025942 Bacteria 2174
126 Ga0207679_10032973 3300025945 Bacteria 3641
127 Ga0207667_10205071 3300025949 Bacteria 2022
128 Ga0207667_10500152 3300025949 Bacteria 1233
129 Ga0207651_10015387 3300025960 Bacteria 4445
130 Ga0207651_10304398 3300025960 Bacteria 1327
131 Ga0207668_10484137 3300025972 Bacteria 1062
132 Ga0207640_10044798 3300025981 Bacteria 2837
133 Ga0207640_10154241 3300025981 Bacteria 1691
134 Ga0207658_10009677 3300025986 Bacteria 6540
135 Ga0207703_10005927 3300026035 Bacteria 9792
136 Ga0207708_10192900 3300026075 Bacteria 1622
137 Ga0207641_10192431 3300026088 Bacteria 1875
138 Ga0207648_10000348 3300026089 Bacteria 50841
139 Ga0207648_10001548 3300026089 Bacteria 25313
140 Ga0207648_10046963 3300026089 Bacteria 3785
141 Ga0207676_10017632 3300026095 Bacteria 5177
142 Ga0207674_10022583 3300026116 Bacteria 6753
143 Ga0207674_10023260 3300026116 Bacteria 6639
144 Ga0207675_101099439 3300026118 Bacteria 815
145 Ga0207683_10003507 3300026121 Bacteria 13682
146 Ga0209969_1001291 3300027360 Bacteria 3444
147 Ga0209967_1005796 3300027364 Bacteria 1668
148 Ga0209981_1001875 3300027378 Bacteria 2678
149 Ga0209996_1004227 3300027395 Bacteria 1823
150 Ga0210000_1003933 3300027462 Bacteria 2150
151 Ga0209995_1004693 3300027471 Bacteria 2192
152 Ga0209179_1051799 3300027512 Bacteria 881
153 Ga0209968_1002561 3300027526 Bacteria 2741
154 Ga0209999_1000652 3300027543 Bacteria 5566
155 Ga0209982_1010905 3300027552 Bacteria 1351
156 Ga0209970_1007320 3300027614 Bacteria 1809
157 Ga0210002_1009058 3300027617 Bacteria 1520
158 Ga0209983_1007215 3300027665 Bacteria 2279
159 Ga0209971_1000102 3300027682 Bacteria 25201
160 Ga0209966_1000058 3300027695 Bacteria 48823
161 Ga0209998_10000922 3300027717 Bacteria 7513
162 Ga0209974_10003495 3300027876 Bacteria 5662
163 Ga0268265_10050835 3300028380 Bacteria 3125
164 Ga0268264_10003538 3300028381 Bacteria 13449
165 Ga0268264_10559440 3300028381 Bacteria 1123
166 Ga0307515_10114830 3300028794 Bacteria 3108
167 Ga0265332_10000128 3300031238 Bacteria 63543
168 Ga0265328_10002207 3300031239 Bacteria 8773
169 Ga0307513_10159043 3300031456 Bacteria 2154
170 Ga0307509_10006668 3300031507 Bacteria 15407
171 Ga0307509_10048750 3300031507 Bacteria 4546
172 Ga0307508_10010240 3300031616 Bacteria 8577
173 Ga0307508_10011657 3300031616 Bacteria 8035
174 Ga0307508_10411615 3300031616 Bacteria 943
175 Ga0307514_10049920 3300031649 Bacteria 3251
176 Ga0307516_10598090 3300031730 Bacteria 757
177 Ga0307507_10265296 3300033179 Bacteria 1091
178 Ga0307507_10374600 3300033179 Bacteria 823
179 Ga0307510_10031450 3300033180 Bacteria 5997
180 Ga0307510_10257656 3300033180 Bacteria 1227
181 Ga0373931_0213031 3300035691 Bacteria 1159
182 Ga0373931_0316904 3300035691 Bacteria 967
183 Ga0242420_141792 3300038996 Bacteria 535
184 Ga0436361_0714943 3300039447 Bacteria 1719
185 Ga0439464_0001007 3300042439 Bacteria 6416
186 Ga0439460_0001111 3300042461 Bacteria 6287
187 Ga0451577_0012508 3300042876 Bacteria 7968
188 Ga0466969_0002537 3300044656 Bacteria 9757
189 Ga0466972_0002440 3300044658 Bacteria 9185
190 Ga0453683_0059878 3300044673 Bacteria 2380
191 Ga0453683_0622498 3300044673 Bacteria 705
192 Ga0466965_0074037 3300044683 Bacteria 1716
193 Ga0466966_0003298 3300044684 Bacteria 10643
194 Ga0466961_0006006 3300044693 Bacteria 7699
195 Ga0466963_0198513 3300044694 Bacteria 1403
196 Ga0466964_0495133 3300044706 Bacteria 655
197 Ga0453684_0021679 3300044712 Bacteria 9581
198 Ga0453684_0084376 3300044712 Bacteria 3950
199 Ga0453684_0265606 3300044712 Bacteria 1964
200 Ga0453684_0534137 3300044712 Bacteria 1294
201 Ga0453684_0643319 3300044712 Bacteria 1158
202 Ga0466968_0014864 3300044735 Bacteria 3081
203 Ga0466959_0033038 3300045049 Bacteria 3828
204 Ga0466959_0191507 3300045049 Bacteria 1427
205 Ga0451576_0012259 3300045051 Bacteria 9649
206 Ga0451576_0027638 3300045051 Bacteria 6090
207 Ga0451576_0219453 3300045051 Bacteria 1985
208 Ga0495592_0000142 3300046454 Bacteria 63571
209 Ga0495629_0525706 3300046459 Bacteria 796
210 Ga0495620_0200487 3300046515 Bacteria 768
211 Ga0495632_0076232 3300046519 Bacteria 1604
212 Ga0495648_0328766 3300046524 Bacteria 706
213 Ga0495666_0210848 3300046526 Bacteria 891
214 Ga0495645_0099981 3300046543 Bacteria 2063
215 Ga0495646_0294117 3300046680 Bacteria 860
216 Ga0495647_0579441 3300046681 Bacteria 526
217 Ga0495658_0006084 3300046683 Bacteria 5927
218 Ga0495624_0128685 3300046690 Bacteria 1553
219 Ga0495673_0062729 3300047469 Bacteria 1587
220 Ga0495593_0186144 3300047673 Bacteria 1045
221 Ga0496102_0074637 3300048905 Bacteria 3118
222 Ga0496103_0515601 3300048906 Bacteria 764
223 Ga0496108_0210705 3300048911 Bacteria 1687
224 Ga0496109_0023483 3300048912 Bacteria 5476
225 Ga0496125_0190445 3300048928 Bacteria 1355
226 Ga0501290_002543 3300049513 Bacteria 2347
227 Ga0501031_0460062 3300049568 Bacteria 822
228 Ga0501032_0032590 3300049569 Bacteria 3570
229 Ga0501032_0243085 3300049569 Bacteria 1169
230 Ga0501033_0061890 3300049570 Bacteria 2757
231 Ga0501034_0039081 3300049571 Bacteria 4806
232 Ga0501034_0896723 3300049571 Bacteria 775
233 Ga0501037_0045082 3300049573 Bacteria 3237
234 Ga0501038_0301636 3300049574 Bacteria 1257
235 Ga0501039_0742967 3300049575 Bacteria 766
236 Ga0501040_0000560 3300049576 Bacteria 22514
237 Ga0501042_0061445 3300049578 Bacteria 2684
238 Ga0501042_0392794 3300049578 Bacteria 1005
239 Ga0501043_0012166 3300049579 Bacteria 6725
240 Ga0501043_0259765 3300049579 Bacteria 1336
241 Ga0501043_0707283 3300049579 Bacteria 735
242 Ga0501046_0002471 3300049580 Bacteria 17326
243 Ga0501046_0361317 3300049580 Bacteria 1053
244 Ga0501067_0310102 3300049583 Bacteria 879
245 Ga0501068_0007908 3300049584 Bacteria 5893
246 Ga0501068_0415506 3300049584 Bacteria 868
247 Ga0501070_0647936 3300049586 Bacteria 839
248 Ga0501072_0006407 3300049588 Bacteria 8968
249 Ga0501073_0005551 3300049589 Bacteria 9435
250 Ga0501073_0147933 3300049589 Bacteria 1628
251 Ga0501074_0073938 3300049590 Bacteria 2448
252 Ga0501075_0001273 3300049591 Bacteria 16347
253 Ga0501080_0013306 3300049742 Bacteria 7561
254 Ga0501081_0000171 3300049743 Bacteria 30406
255 Ga0501083_0128180 3300049744 Bacteria 1663
256 Ga0501035_0446460 3300049822 Bacteria 1070
257 Ga0501044_0050386 3300049823 Bacteria 4296
258 Ga0501044_0354302 3300049823 Bacteria 1386
259 Ga0501044_0696064 3300049823 Bacteria 902
260 Ga0501045_0000437 3300049824 Bacteria 25547
261 nmdc:mga0k408_442875_c1 3300050493 Bacteria 772
262 nmdc:mga07m45_311073_c1 3300050496 Bacteria 916
263 nmdc:mga05p37_161958_c1 3300050507 Bacteria 2732
264 nmdc:mga05p37_218673_c1 3300050507 Bacteria 2300
265 nmdc:mga08x19_14445_c1 3300050514 Bacteria 4789
266 nmdc:mga0a205_398760_c1 3300050515 Bacteria 1240
267 Ga0500644_0016271 3300053088 Bacteria 2139
268 Ga0500614_110123 3300053123 Bacteria 802
269 Ga0500559_0000203 3300053136 Bacteria 47280
270 Ga0500559_0035536 3300053136 Bacteria 2153
271 Ga0500604_0090862 3300053151 Bacteria 997
272 Ga0500616_0110459 3300053153 Bacteria 1329
273 Ga0500619_019572 3300053154 Bacteria 1920
274 Ga0500622_0000873 3300053156 Bacteria 25654
275 Ga0500636_0072480 3300053177 Bacteria 1996
276 Ga0500587_013370 3300053739 Bacteria 1036
277 Ga0501084_0001036 3300054114 Bacteria 21606
278 Ga0501084_0558918 3300054114 Bacteria 967
279 Ga0501082_0665397 3300060353 Bacteria 911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2738541283 2738758794 144
2 3300046459 Ga0495629_0525706 Ga0495629_0525706_258_698 146
3 3300005468 Ga0070707_100074831 Ga0070707_1000748313 147
4 3300006058 Ga0075432_10054637 Ga0075432_100546373 147
5 3300006852 Ga0075433_10059137 Ga0075433_100591374 147
6 3300006914 Ga0075436_100022957 Ga0075436_1000229577 147
7 3300009093 Ga0105240_11219920 Ga0105240_112199202 147
8 3300009147 Ga0114129_10060098 Ga0114129_100600985 147
9 3300013306 Ga0163162_10202229 Ga0163162_102022294 147
10 3300025922 Ga0207646_10066142 Ga0207646_100661424 147
11 3300028381 Ga0268264_10559440 Ga0268264_105594403 147
12 3300031649 Ga0307514_10049920 Ga0307514_100499204 147
13 3300044658 Ga0466972_0002440 Ga0466972_0002440_4920_5363 147
14 3300044706 Ga0466964_0495133 Ga0466964_0495133_92_535 147
15 3300044712 Ga0453684_0265606 Ga0453684_0265606_227_670 147
16 3300044735 Ga0466968_0014864 Ga0466968_0014864_1855_2298 147
17 3300050507 nmdc:mga05p37_161958_c1 nmdc:mga05p37_161958_c1_1901_2344 147
18 3300050514 nmdc:mga08x19_14445_c1 nmdc:mga08x19_14445_c1_3316_3759 147
19 3300050515 nmdc:mga0a205_398760_c1 nmdc:mga0a205_398760_c1_629_1072 147
20 3300002705 JGI25156J39149_1041130 JGI25156J39149_10411301 148
21 3300003215 JGI25153J46596_10021622 JGI25153J46596_100216221 148
22 3300005290 Ga0065712_10329068 Ga0065712_103290682 148
23 3300005328 Ga0070676_10007271 Ga0070676_100072717 148
24 3300005331 Ga0070670_100413756 Ga0070670_1004137562 148
25 3300005334 Ga0068869_100014487 Ga0068869_1000144873 148
26 3300005338 Ga0068868_100269893 Ga0068868_1002698931 148
27 3300005340 Ga0070689_100321485 Ga0070689_1003214851 148
28 3300005341 Ga0070691_10090441 Ga0070691_100904412 148
29 3300005341 Ga0070691_10151083 Ga0070691_101510831 148
30 3300005343 Ga0070687_100592593 Ga0070687_1005925931 148
31 3300005347 Ga0070668_100958809 Ga0070668_1009588091 148
32 3300005355 Ga0070671_100613207 Ga0070671_1006132072 148
33 3300005356 Ga0070674_100307579 Ga0070674_1003075792 148
34 3300005364 Ga0070673_100003637 Ga0070673_1000036377 148
35 3300005366 Ga0070659_100748513 Ga0070659_1007485131 148
36 3300005367 Ga0070667_100093117 Ga0070667_1000931173 148
37 3300005406 Ga0070703_10100874 Ga0070703_101008742 148
38 3300005438 Ga0070701_10520934 Ga0070701_105209342 148
39 3300005440 Ga0070705_100092438 Ga0070705_1000924383 148
40 3300005441 Ga0070700_100407202 Ga0070700_1004072022 148
41 3300005444 Ga0070694_100010290 Ga0070694_1000102905 148
42 3300005445 Ga0070708_102020140 Ga0070708_1020201401 148
43 3300005456 Ga0070678_100022446 Ga0070678_1000224463 148
44 3300005459 Ga0068867_100022511 Ga0068867_1000225116 148
45 3300005459 Ga0068867_100051145 Ga0068867_1000511454 148
46 3300005467 Ga0070706_100021834 Ga0070706_1000218347 148
47 3300005467 Ga0070706_100102994 Ga0070706_1001029942 148
48 3300005467 Ga0070706_101346317 Ga0070706_1013463171 148
49 3300005468 Ga0070707_100676650 Ga0070707_1006766502 148
50 3300005471 Ga0070698_101677067 Ga0070698_1016770671 148
51 3300005536 Ga0070697_100517886 Ga0070697_1005178861 148
52 3300005543 Ga0070672_100051363 Ga0070672_1000513633 148
53 3300005545 Ga0070695_100001022 Ga0070695_1000010227 148
54 3300005545 Ga0070695_100083806 Ga0070695_1000838064 148
55 3300005546 Ga0070696_101106451 Ga0070696_1011064511 148
56 3300005547 Ga0070693_100784240 Ga0070693_1007842401 148
57 3300005549 Ga0070704_100220661 Ga0070704_1002206611 148
58 3300005563 Ga0068855_100291887 Ga0068855_1002918872 148
59 3300005563 Ga0068855_100506225 Ga0068855_1005062253 148
60 3300005564 Ga0070664_100063531 Ga0070664_1000635313 148
61 3300005577 Ga0068857_100015328 Ga0068857_10001532812 148
62 3300005578 Ga0068854_100042802 Ga0068854_1000428022 148
63 3300005578 Ga0068854_100128715 Ga0068854_1001287153 148
64 3300005578 Ga0068854_100447765 Ga0068854_1004477652 148
65 3300005617 Ga0068859_100235503 Ga0068859_1002355032 148
66 3300005618 Ga0068864_100009530 Ga0068864_1000095303 148
67 3300005718 Ga0068866_10048267 Ga0068866_100482673 148
68 3300005719 Ga0068861_100000163 Ga0068861_10000016314 148
69 3300005840 Ga0068870_10007131 Ga0068870_100071317 148
70 3300005840 Ga0068870_10231502 Ga0068870_102315023 148
71 3300005841 Ga0068863_100067429 Ga0068863_1000674293 148
72 3300005842 Ga0068858_100021710 Ga0068858_1000217107 148
73 3300005843 Ga0068860_100030886 Ga0068860_1000308862 148
74 3300005844 Ga0068862_100008828 Ga0068862_10000882815 148
75 3300005937 Ga0081455_10002261 Ga0081455_100022617 148
76 3300005937 Ga0081455_10400233 Ga0081455_104002332 148
77 3300006175 Ga0070712_100494049 Ga0070712_1004940492 148
78 3300006177 Ga0075362_10191789 Ga0075362_101917892 148
79 3300006177 Ga0075362_10423339 Ga0075362_104233391 148
80 3300006195 Ga0075366_10001709 Ga0075366_100017095 148
81 3300006195 Ga0075366_10110009 Ga0075366_101100092 148
82 3300006195 Ga0075366_10300583 Ga0075366_103005833 148
83 3300006353 Ga0075370_10573271 Ga0075370_105732711 148
84 3300006931 Ga0097620_100235496 Ga0097620_1002354962 148
85 3300007788 Ga0099795_10067496 Ga0099795_100674962 148
86 3300009098 Ga0105245_10661395 Ga0105245_106613952 148
87 3300009098 Ga0105245_10713736 Ga0105245_107137362 148
88 3300009147 Ga0114129_10253859 Ga0114129_102538592 148
89 3300009148 Ga0105243_10088668 Ga0105243_100886683 148
90 3300009148 Ga0105243_10226558 Ga0105243_102265583 148
91 3300009177 Ga0105248_10005106 Ga0105248_100051062 148
92 3300010375 Ga0105239_10478528 Ga0105239_104785283 148
93 3300010375 Ga0105239_10518873 Ga0105239_105188732 148
94 3300011119 Ga0105246_10042282 Ga0105246_100422823 148
95 3300011119 Ga0105246_10702758 Ga0105246_107027582 148
96 3300013297 Ga0157378_10010313 Ga0157378_100103132 148
97 3300013297 Ga0157378_10037827 Ga0157378_100378272 148
98 3300013297 Ga0157378_10532786 Ga0157378_105327862 148
99 3300013306 Ga0163162_10182795 Ga0163162_101827953 148
100 3300013307 Ga0157372_10050010 Ga0157372_100500103 148
101 3300013308 Ga0157375_10112930 Ga0157375_101129305 148
102 3300013308 Ga0157375_10470796 Ga0157375_104707963 148
103 3300014326 Ga0157380_10130230 Ga0157380_101302302 148
104 3300014326 Ga0157380_10256540 Ga0157380_102565401 148
105 3300014497 Ga0182008_10011231 Ga0182008_100112315 148
106 3300014968 Ga0157379_10002520 Ga0157379_1000252010 148
107 3300014969 Ga0157376_11325824 Ga0157376_113258241 148
108 3300025256 Ga0209759_1001255 Ga0209759_10012558 148
109 3300025297 Ga0209758_1000045 Ga0209758_100004524 148
110 3300025885 Ga0207653_10061755 Ga0207653_100617552 148
111 3300025900 Ga0207710_10057849 Ga0207710_100578494 148
112 3300025903 Ga0207680_10064628 Ga0207680_100646282 148
113 3300025906 Ga0207699_10628009 Ga0207699_106280091 148
114 3300025907 Ga0207645_10008775 Ga0207645_100087754 148
115 3300025910 Ga0207684_10976975 Ga0207684_109769752 148
116 3300025915 Ga0207693_10514046 Ga0207693_105140462 148
117 3300025918 Ga0207662_10159129 Ga0207662_101591292 148
118 3300025919 Ga0207657_10189496 Ga0207657_101894963 148
119 3300025922 Ga0207646_10398955 Ga0207646_103989552 148
120 3300025923 Ga0207681_10014348 Ga0207681_100143482 148
121 3300025925 Ga0207650_10005891 Ga0207650_100058912 148
122 3300025925 Ga0207650_10597780 Ga0207650_105977801 148
123 3300025925 Ga0207650_10747675 Ga0207650_107476752 148
124 3300025927 Ga0207687_10471209 Ga0207687_104712092 148
125 3300025931 Ga0207644_10074348 Ga0207644_100743483 148
126 3300025931 Ga0207644_10264687 Ga0207644_102646872 148
127 3300025933 Ga0207706_10089838 Ga0207706_100898382 148
128 3300025935 Ga0207709_10087512 Ga0207709_100875123 148
129 3300025935 Ga0207709_10141135 Ga0207709_101411353 148
130 3300025936 Ga0207670_10160974 Ga0207670_101609742 148
131 3300025937 Ga0207669_10103875 Ga0207669_101038753 148
132 3300025937 Ga0207669_10282239 Ga0207669_102822392 148
133 3300025938 Ga0207704_10488484 Ga0207704_104884842 148
134 3300025940 Ga0207691_10003291 Ga0207691_100032917 148
135 3300025940 Ga0207691_11107957 Ga0207691_111079571 148
136 3300025942 Ga0207689_10118846 Ga0207689_101188462 148
137 3300025945 Ga0207679_10032973 Ga0207679_100329735 148
138 3300025949 Ga0207667_10205071 Ga0207667_102050712 148
139 3300025949 Ga0207667_10500152 Ga0207667_105001522 148
140 3300025960 Ga0207651_10015387 Ga0207651_100153874 148
141 3300025960 Ga0207651_10304398 Ga0207651_103043983 148
142 3300025972 Ga0207668_10484137 Ga0207668_104841372 148
143 3300025981 Ga0207640_10044798 Ga0207640_100447982 148
144 3300025981 Ga0207640_10154241 Ga0207640_101542411 148
145 3300025986 Ga0207658_10009677 Ga0207658_100096772 148
146 3300026035 Ga0207703_10005927 Ga0207703_100059272 148
147 3300026075 Ga0207708_10192900 Ga0207708_101929001 148
148 3300026088 Ga0207641_10192431 Ga0207641_101924313 148
149 3300026089 Ga0207648_10000348 Ga0207648_1000034847 148
150 3300026089 Ga0207648_10001548 Ga0207648_100015487 148
151 3300026089 Ga0207648_10046963 Ga0207648_100469634 148
152 3300026095 Ga0207676_10017632 Ga0207676_100176322 148
153 3300026116 Ga0207674_10022583 Ga0207674_100225835 148
154 3300026116 Ga0207674_10023260 Ga0207674_100232604 148
155 3300026118 Ga0207675_101099439 Ga0207675_1010994391 148
156 3300026121 Ga0207683_10003507 Ga0207683_1000350718 148
157 3300027360 Ga0209969_1001291 Ga0209969_10012915 148
158 3300027364 Ga0209967_1005796 Ga0209967_10057962 148
159 3300027378 Ga0209981_1001875 Ga0209981_10018752 148
160 3300027395 Ga0209996_1004227 Ga0209996_10042272 148
161 3300027462 Ga0210000_1003933 Ga0210000_10039332 148
162 3300027471 Ga0209995_1004693 Ga0209995_10046933 148
163 3300027512 Ga0209179_1051799 Ga0209179_10517991 148
164 3300027526 Ga0209968_1002561 Ga0209968_10025612 148
165 3300027543 Ga0209999_1000652 Ga0209999_10006523 148
166 3300027552 Ga0209982_1010905 Ga0209982_10109052 148
167 3300027614 Ga0209970_1007320 Ga0209970_10073202 148
168 3300027617 Ga0210002_1009058 Ga0210002_10090581 148
169 3300027665 Ga0209983_1007215 Ga0209983_10072152 148
170 3300027682 Ga0209971_1000102 Ga0209971_10001028 148
171 3300027695 Ga0209966_1000058 Ga0209966_100005849 148
172 3300027717 Ga0209998_10000922 Ga0209998_100009222 148
173 3300027876 Ga0209974_10003495 Ga0209974_100034955 148
174 3300028380 Ga0268265_10050835 Ga0268265_100508353 148
175 3300028381 Ga0268264_10003538 Ga0268264_1000353812 148
176 3300028794 Ga0307515_10114830 Ga0307515_101148302 148
177 3300031238 Ga0265332_10000128 Ga0265332_1000012843 148
178 3300031239 Ga0265328_10002207 Ga0265328_100022078 148
179 3300031456 Ga0307513_10159043 Ga0307513_101590434 148
180 3300031507 Ga0307509_10006668 Ga0307509_1000666813 148
181 3300031507 Ga0307509_10048750 Ga0307509_100487502 148
182 3300031616 Ga0307508_10010240 Ga0307508_100102406 148
183 3300031616 Ga0307508_10011657 Ga0307508_100116575 148
184 3300031616 Ga0307508_10411615 Ga0307508_104116152 148
185 3300031730 Ga0307516_10598090 Ga0307516_105980901 148
186 3300033179 Ga0307507_10265296 Ga0307507_102652962 148
187 3300033179 Ga0307507_10374600 Ga0307507_103746001 148
188 3300033180 Ga0307510_10031450 Ga0307510_100314505 148
189 3300033180 Ga0307510_10257656 Ga0307510_102576562 148
190 3300035691 Ga0373931_0213031 Ga0373931_0213031_472_918 148
191 3300035691 Ga0373931_0316904 Ga0373931_0316904_233_679 148
192 3300038996 Ga0242420_141792 Ga0242420_141792_61_507 148
193 3300039447 Ga0436361_0714943 Ga0436361_0714943_145_591 148
194 3300042439 Ga0439464_0001007 Ga0439464_0001007_2178_2624 148
195 3300042461 Ga0439460_0001111 Ga0439460_0001111_2154_2600 148
196 3300042876 Ga0451577_0012508 Ga0451577_0012508_1840_2286 148
197 3300044656 Ga0466969_0002537 Ga0466969_0002537_1313_1816 148
198 3300044673 Ga0453683_0059878 Ga0453683_0059878_213_659 148
199 3300044673 Ga0453683_0622498 Ga0453683_0622498_34_486 148
200 3300044683 Ga0466965_0074037 Ga0466965_0074037_824_1324 148
201 3300044684 Ga0466966_0003298 Ga0466966_0003298_1497_1943 148
202 3300044693 Ga0466961_0006006 Ga0466961_0006006_3577_4080 148
203 3300044694 Ga0466963_0198513 Ga0466963_0198513_247_693 148
204 3300044712 Ga0453684_0021679 Ga0453684_0021679_167_613 148
205 3300044712 Ga0453684_0084376 Ga0453684_0084376_2589_3035 148
206 3300044712 Ga0453684_0534137 Ga0453684_0534137_443_889 148
207 3300044712 Ga0453684_0643319 Ga0453684_0643319_124_774 148
208 3300045049 Ga0466959_0033038 Ga0466959_0033038_1266_1766 148
209 3300045049 Ga0466959_0191507 Ga0466959_0191507_152_655 148
210 3300045051 Ga0451576_0012259 Ga0451576_0012259_6499_6945 148
211 3300045051 Ga0451576_0027638 Ga0451576_0027638_5518_5964 148
212 3300045051 Ga0451576_0219453 Ga0451576_0219453_1041_1487 148
213 3300046454 Ga0495592_0000142 Ga0495592_0000142_8904_9356 148
214 3300046515 Ga0495620_0200487 Ga0495620_0200487_32_484 148
215 3300046519 Ga0495632_0076232 Ga0495632_0076232_159_656 148
216 3300046524 Ga0495648_0328766 Ga0495648_0328766_180_626 148
217 3300046526 Ga0495666_0210848 Ga0495666_0210848_207_653 148
218 3300046543 Ga0495645_0099981 Ga0495645_0099981_1219_1665 148
219 3300046680 Ga0495646_0294117 Ga0495646_0294117_137_589 148
220 3300046681 Ga0495647_0579441 Ga0495647_0579441_25_471 148
221 3300046683 Ga0495658_0006084 Ga0495658_0006084_2216_2662 148
222 3300046690 Ga0495624_0128685 Ga0495624_0128685_941_1453 148
223 3300047469 Ga0495673_0062729 Ga0495673_0062729_501_947 148
224 3300047673 Ga0495593_0186144 Ga0495593_0186144_587_1033 148
225 3300048905 Ga0496102_0074637 Ga0496102_0074637_2295_2771 148
226 3300048906 Ga0496103_0515601 Ga0496103_0515601_85_561 148
227 3300048911 Ga0496108_0210705 Ga0496108_0210705_950_1426 148
228 3300048912 Ga0496109_0023483 Ga0496109_0023483_3920_4396 148
229 3300048928 Ga0496125_0190445 Ga0496125_0190445_524_1195 148
230 3300049513 Ga0501290_002543 Ga0501290_002543_199_681 148
231 3300049568 Ga0501031_0460062 Ga0501031_0460062_62_508 148
232 3300049569 Ga0501032_0032590 Ga0501032_0032590_3035_3481 148
233 3300049569 Ga0501032_0243085 Ga0501032_0243085_234_680 148
234 3300049570 Ga0501033_0061890 Ga0501033_0061890_1267_1713 148
235 3300049571 Ga0501034_0039081 Ga0501034_0039081_4330_4776 148
236 3300049571 Ga0501034_0896723 Ga0501034_0896723_127_573 148
237 3300049573 Ga0501037_0045082 Ga0501037_0045082_1762_2208 148
238 3300049574 Ga0501038_0301636 Ga0501038_0301636_22_468 148
239 3300049575 Ga0501039_0742967 Ga0501039_0742967_24_470 148
240 3300049576 Ga0501040_0000560 Ga0501040_0000560_18234_18680 148
241 3300049578 Ga0501042_0061445 Ga0501042_0061445_1030_1476 148
242 3300049578 Ga0501042_0392794 Ga0501042_0392794_195_641 148
243 3300049579 Ga0501043_0012166 Ga0501043_0012166_6013_6459 148
244 3300049579 Ga0501043_0259765 Ga0501043_0259765_647_1093 148
245 3300049579 Ga0501043_0707283 Ga0501043_0707283_112_564 148
246 3300049580 Ga0501046_0002471 Ga0501046_0002471_16714_17160 148
247 3300049580 Ga0501046_0361317 Ga0501046_0361317_54_500 148
248 3300049583 Ga0501067_0310102 Ga0501067_0310102_241_687 148
249 3300049584 Ga0501068_0007908 Ga0501068_0007908_1842_2288 148
250 3300049584 Ga0501068_0415506 Ga0501068_0415506_328_774 148
251 3300049586 Ga0501070_0647936 Ga0501070_0647936_251_697 148
252 3300049588 Ga0501072_0006407 Ga0501072_0006407_8392_8838 148
253 3300049589 Ga0501073_0005551 Ga0501073_0005551_3443_3889 148
254 3300049589 Ga0501073_0147933 Ga0501073_0147933_367_819 148
255 3300049590 Ga0501074_0073938 Ga0501074_0073938_264_710 148
256 3300049591 Ga0501075_0001273 Ga0501075_0001273_125_571 148
257 3300049742 Ga0501080_0013306 Ga0501080_0013306_1880_2326 148
258 3300049743 Ga0501081_0000171 Ga0501081_0000171_24287_24733 148
259 3300049744 Ga0501083_0128180 Ga0501083_0128180_429_875 148
260 3300049822 Ga0501035_0446460 Ga0501035_0446460_523_969 148
261 3300049823 Ga0501044_0050386 Ga0501044_0050386_1402_1854 148
262 3300049823 Ga0501044_0354302 Ga0501044_0354302_476_922 148
263 3300049823 Ga0501044_0696064 Ga0501044_0696064_208_654 148
264 3300049824 Ga0501045_0000437 Ga0501045_0000437_24474_24920 148
265 3300050493 nmdc:mga0k408_442875_c1 nmdc:mga0k408_442875_c1_258_704 148
266 3300050496 nmdc:mga07m45_311073_c1 nmdc:mga07m45_311073_c1_52_498 148
267 3300050507 nmdc:mga05p37_218673_c1 nmdc:mga05p37_218673_c1_1387_1833 148
268 3300053088 Ga0500644_0016271 Ga0500644_0016271_270_722 148
269 3300053123 Ga0500614_110123 Ga0500614_110123_51_503 148
270 3300053136 Ga0500559_0000203 Ga0500559_0000203_30269_30721 148
271 3300053136 Ga0500559_0035536 Ga0500559_0035536_1459_1911 148
272 3300053151 Ga0500604_0090862 Ga0500604_0090862_410_862 148
273 3300053153 Ga0500616_0110459 Ga0500616_0110459_723_1175 148
274 3300053154 Ga0500619_019572 Ga0500619_019572_1026_1478 148
275 3300053156 Ga0500622_0000873 Ga0500622_0000873_19868_20320 148
276 3300053177 Ga0500636_0072480 Ga0500636_0072480_838_1290 148
277 3300053739 Ga0500587_013370 Ga0500587_013370_246_698 148
278 3300054114 Ga0501084_0001036 Ga0501084_0001036_16765_17211 148
279 3300054114 Ga0501084_0558918 Ga0501084_0558918_408_854 148
280 3300060353 Ga0501082_0665397 Ga0501082_0665397_433_879 148
281 iso_pu_bacteria 2501025501 2501069651 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

45

175

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9917 4 145
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9906 4 145
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9879 4 145
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9765 4 145
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.974 4 145
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9904 4 145 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.976 4 145 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8934 4 141 3.30.530.20
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8881 4 141 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8488 4 141 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A530H529-F1-model_v4 Toxin 1 5 136
AF-A0A529M9F3-F1-model_v4 Toxin 0.9968 5 119
AF-A0A527HZZ3-F1-model_v4 deleted 0.9962 3 105
AF-A0A1C6NIL8-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9941 4 145
AF-A0A3C0B758-F1-model_v4 Polyketide cyclase 0.9921 50 131

Feature Viewer

pLDDT pTM Quality
94.79 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map