F383803

General Info

Members Datasets Scaffolds Average Seq Length
280 211 560 286

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0200210|Ga0395898_0200210_303_1241
Length 312
Sequence MMTAPVTAASIALDGGVLAAEDAAHGPEAAFAPSRGFWGHVGHRLVRDPVAMGAGAVILLVVIIAVLSPWITPMDPYKGSMLRRLKHVGDATYWLGSDELGRDMISRLMLGSRLSLFIGVTPVLIAFVIGSGIGILAGYVGGWTNTILMRTIDVFFAFPSVLLAIALSGALGAGIFNSIVSLTCVFVPQIARVAESVTTGIRKRDYIDAAKLSGASALTIMRMQVLGNVVGPIFVYATSLISVSMILASGLSFLGLGVRPPEPEWGLMLNTLRTAIYVNPVVAALPGVCIFIVSIAFNLFSDGLRAAMEIRQ

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
28 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
29 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
42 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
43 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
70 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
86 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
87 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
88 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
103 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
109 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
116 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
147 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
148 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
149 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
183 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
184 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
185 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
186 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
187 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
188 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
189 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
190 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
196 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
197 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
198 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
199 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
200 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
201 2842694124 Methylopila sp. R-72369 Isolate Unclassified
202 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
203 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
204 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
205 2902330777 Methylobacterium sp. 2A Isolate Unclassified
206 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
207 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
208 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
209 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
210 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
211 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.29
Metatranscriptomes 0.36
Isolates 5.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.43
Nodule 0.71
Rhizoplane 5.71
Rhizosphere 57.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0200210 3300037466 Bacteria 1907
2 JGI25153J46596_10004157 3300003215 Bacteria 7858
3 Ga0006562J51391_1113361 3300003578 Bacteria 1170
4 JGI25404J52841_10002609 3300003659 Bacteria 3439
5 Ga0070668_100378139 3300005347 Bacteria 1205
6 Ga0070709_10002780 3300005434 Bacteria 9450
7 Ga0070714_100013583 3300005435 Bacteria 6527
8 Ga0070713_100001260 3300005436 Bacteria 16183
9 Ga0070710_10001251 3300005437 Bacteria 12059
10 Ga0070711_100001495 3300005439 Bacteria 12838
11 Ga0070698_100214310 3300005471 Bacteria 1860
12 Ga0068866_10121739 3300005718 Bacteria 1471
13 Ga0081455_10067919 3300005937 Bacteria 2969
14 Ga0081540_1010416 3300005983 Bacteria 6301
15 Ga0081539_10000207 3300005985 Bacteria 136970
16 Ga0081539_10129581 3300005985 Bacteria 1241
17 Ga0070717_10005205 3300006028 Bacteria 9476
18 Ga0075365_10008388 3300006038 Bacteria 5861
19 Ga0075365_10168187 3300006038 Bacteria 1530
20 Ga0075368_10089520 3300006042 Bacteria 1258
21 Ga0075363_100118079 3300006048 Bacteria 1479
22 Ga0070712_100000463 3300006175 Bacteria 23326
23 Ga0075362_10177045 3300006177 Bacteria 1032
24 Ga0075367_10125511 3300006178 Bacteria 1584
25 Ga0075367_10153643 3300006178 Bacteria 1429
26 Ga0075367_10191241 3300006178 Bacteria 1277
27 Ga0075366_10046182 3300006195 Bacteria 2581
28 Ga0075366_10055562 3300006195 Bacteria 2352
29 Ga0075370_10136447 3300006353 Bacteria 1433
30 Ga0075370_10203099 3300006353 Bacteria 1169
31 Ga0075370_10212407 3300006353 Bacteria 1142
32 Ga0075428_100395770 3300006844 Bacteria 1481
33 Ga0075431_100344976 3300006847 Bacteria 1498
34 Ga0099794_10020575 3300007265 Bacteria 2988
35 Ga0099795_10003024 3300007788 Bacteria 4095
36 Ga0105251_10077007 3300009011 Bacteria 1547
37 Ga0105243_10339088 3300009148 Bacteria 1376
38 Ga0099796_10010340 3300010159 Bacteria 2562
39 Ga0099796_10054594 3300010159 Bacteria 1397
40 Ga0157373_10017388 3300013100 Bacteria 5239
41 Ga0157371_10000848 3300013102 Bacteria 34910
42 Ga0171462_1010 3300013250 Bacteria 310590
43 Ga0163162_10172314 3300013306 Bacteria 2289
44 Ga0157380_10486997 3300014326 Bacteria 1194
45 Ga0182008_10063493 3300014497 Bacteria 1819
46 Ga0157379_10415932 3300014968 Bacteria 1238
47 Ga0182006_1071951 3300015261 Bacteria 1280
48 Ga0163161_10000707 3300017792 Bacteria 26488
49 Ga0207425_1000984 3300025245 Bacteria 13398
50 Ga0209129_1000084 3300025258 Bacteria 182554
51 Ga0209565_1000285 3300025263 Bacteria 49572
52 Ga0209565_1007779 3300025263 Bacteria 2856
53 Ga0209673_1002884 3300025273 Bacteria 10912
54 Ga0209130_1001824 3300025284 Bacteria 12323
55 Ga0209675_1001325 3300025291 Bacteria 14680
56 Ga0209675_1007450 3300025291 Bacteria 4190
57 Ga0209025_1000942 3300025294 Bacteria 44278
58 Ga0209564_1000357 3300025295 Bacteria 85402
59 Ga0209758_1000176 3300025297 Bacteria 143504
60 Ga0209758_1000184 3300025297 Bacteria 140021
61 Ga0209256_1000030 3300025299 Bacteria 414828
62 Ga0209256_1000156 3300025299 Bacteria 144277
63 Ga0209256_1000954 3300025299 Bacteria 35032
64 Ga0207426_1000049 3300025302 Bacteria 401954
65 Ga0209257_1004419 3300025304 Bacteria 10911
66 Ga0207692_10188934 3300025898 Bacteria 1204
67 Ga0207642_10093915 3300025899 Bacteria 1489
68 Ga0207688_10076312 3300025901 Bacteria 1908
69 Ga0207685_10004457 3300025905 Bacteria 3564
70 Ga0207699_10022207 3300025906 Bacteria 3435
71 Ga0207693_10154141 3300025915 Bacteria 1807
72 Ga0207681_10002481 3300025923 Bacteria 11710
73 Ga0207686_10202050 3300025934 Bacteria 1424
74 Ga0207709_10190365 3300025935 Bacteria 1457
75 Ga0207669_10016410 3300025937 Bacteria 3762
76 Ga0207665_10025687 3300025939 Bacteria 3887
77 Ga0207668_10043777 3300025972 Bacteria 3041
78 Ga0268266_10264920 3300028379 Bacteria 1594
79 Ga0268265_10501541 3300028380 Bacteria 1144
80 Ga0307517_10091702 3300028786 Bacteria 2479
81 Ga0307515_10000877 3300028794 Bacteria 69170
82 Ga0307515_10050608 3300028794 Bacteria 6216
83 Ga0307515_10339456 3300028794 Bacteria 1156
84 Ga0316183_1002159 3300030742 Bacteria 1499
85 Ga0316182_1404263 3300030745 Bacteria 2241
86 Ga0265340_10032963 3300031247 Bacteria 2582
87 Ga0265340_10035701 3300031247 Bacteria 2468
88 Ga0265340_10161569 3300031247 Bacteria 1018
89 Ga0265331_10034853 3300031250 Bacteria 2480
90 Ga0307513_10005679 3300031456 Bacteria 16423
91 Ga0307513_10043136 3300031456 Bacteria 4958
92 Ga0307408_100091929 3300031548 Bacteria 2292
93 Ga0265314_10239028 3300031711 Bacteria 1049
94 Ga0265342_10074163 3300031712 Bacteria 1978
95 Ga0316576_10003774 3300031727 Bacteria 8951
96 Ga0307405_10085712 3300031731 Bacteria 2071
97 Ga0307405_10227974 3300031731 Bacteria 1371
98 Ga0307405_10370857 3300031731 Bacteria 1111
99 Ga0307413_10330237 3300031824 Bacteria 1169
100 Ga0307412_10001916 3300031911 Bacteria 11496
101 Ga0307507_10036308 3300033179 Bacteria 5041
102 Ga0307510_10041448 3300033180 Bacteria 5033
103 Ga0307510_10141714 3300033180 Bacteria 2046
104 Ga0373926_0100465 3300035083 Bacteria 1082
105 Ga0373927_0005522 3300035695 Bacteria 8709
106 Ga0400483_274600 3300039062 Bacteria 1660
107 Ga0439447_051784 3300041407 Bacteria 979
108 Ga0451807_0902963 3300041486 Bacteria 1102
109 Ga0450911_000210 3300042115 Bacteria 22859
110 Ga0451577_0134487 3300042876 Bacteria 2219
111 Ga0466968_0060693 3300044735 Bacteria 1630
112 Ga0466960_0201922 3300044901 Bacteria 1086
113 Ga0451576_0000545 3300045051 Bacteria 80903
114 Ga0451576_0001712 3300045051 Bacteria 36238
115 Ga0495627_014676 3300046453 Bacteria 2726
116 Ga0495592_0005391 3300046454 Bacteria 9440
117 Ga0495603_0027461 3300046455 Bacteria 3435
118 Ga0495591_000159 3300046458 Bacteria 71539
119 Ga0495591_006126 3300046458 Bacteria 5392
120 Ga0495629_0001995 3300046459 Bacteria 15858
121 Ga0495638_0060655 3300046460 Bacteria 2339
122 Ga0495653_0003194 3300046463 Bacteria 13122
123 Ga0495653_0008284 3300046463 Bacteria 8523
124 Ga0495650_0004263 3300046471 Bacteria 9885
125 Ga0495580_0000659 3300046472 Bacteria 29319
126 Ga0495605_0000001 3300046474 Bacteria 614538
127 Ga0495605_0000025 3300046474 Bacteria 223594
128 Ga0495605_0000201 3300046474 Bacteria 73671
129 Ga0495662_0007042 3300046476 Bacteria 5585
130 Ga0495664_0059938 3300046477 Bacteria 2265
131 Ga0495584_0000814 3300046491 Bacteria 20544
132 Ga0495585_0000322 3300046492 Bacteria 47213
133 Ga0495594_0042305 3300046499 Bacteria 2495
134 Ga0495607_0000074 3300046501 Bacteria 99993
135 Ga0495607_0002558 3300046501 Bacteria 14696
136 Ga0495607_0051290 3300046501 Bacteria 2397
137 Ga0495583_0000070 3300046506 Bacteria 185226
138 Ga0495583_0000732 3300046506 Bacteria 41759
139 Ga0495606_0001580 3300046507 Bacteria 29797
140 Ga0495616_0005195 3300046513 Bacteria 8056
141 Ga0495620_0000009 3300046515 Bacteria 174473
142 Ga0495628_0168099 3300046516 Bacteria 1663
143 Ga0495630_0007124 3300046517 Bacteria 7969
144 Ga0495631_0004443 3300046518 Bacteria 7468
145 Ga0495637_0011059 3300046520 Bacteria 4347
146 Ga0495637_0049923 3300046520 Bacteria 1756
147 Ga0495648_0003210 3300046524 Bacteria 14505
148 Ga0495648_0011475 3300046524 Bacteria 6668
149 Ga0495648_0019945 3300046524 Bacteria 4692
150 Ga0495666_0000966 3300046526 Bacteria 13584
151 Ga0495642_0093483 3300046528 Bacteria 1275
152 Ga0495652_0150037 3300046529 Bacteria 1822
153 Ga0495654_0001028 3300046530 Bacteria 20448
154 Ga0495654_0032399 3300046530 Bacteria 2650
155 Ga0495586_0162096 3300046535 Bacteria 1261
156 Ga0495609_0000074 3300046538 Bacteria 123121
157 Ga0495609_0003727 3300046538 Bacteria 8606
158 Ga0495597_0000002 3300046542 Bacteria 420382
159 Ga0495597_0002100 3300046542 Bacteria 13237
160 Ga0495645_0007107 3300046543 Bacteria 7793
161 Ga0495633_0000010 3300046558 Bacteria 280844
162 Ga0495668_0075382 3300046616 Bacteria 1853
163 Ga0495634_0024689 3300046642 Bacteria 4213
164 Ga0495611_0003840 3300046648 Bacteria 6553
165 Ga0495611_0103626 3300046648 Bacteria 1323
166 Ga0495635_0008172 3300046663 Bacteria 7307
167 Ga0495661_0000008 3300046665 Bacteria 317971
168 Ga0495661_0000014 3300046665 Bacteria 258915
169 Ga0495661_0007742 3300046665 Bacteria 7481
170 Ga0495661_0019068 3300046665 Bacteria 4500
171 Ga0495599_0008113 3300046678 Bacteria 6376
172 Ga0495623_0076740 3300046679 Bacteria 2073
173 Ga0495646_0001345 3300046680 Bacteria 14521
174 Ga0495613_0035658 3300046689 Bacteria 3690
175 Ga0495649_0000162 3300046694 Bacteria 58169
176 Ga0495589_0001007 3300046794 Bacteria 17087
177 Ga0495600_0092832 3300046809 Bacteria 1969
178 Ga0495660_0001709 3300046810 Bacteria 14687
179 Ga0495581_0000454 3300047315 Bacteria 20975
180 Ga0495604_0003389 3300047317 Bacteria 12712
181 Ga0495674_0018640 3300047319 Bacteria 6458
182 Ga0495672_0051089 3300047320 Bacteria 2437
183 Ga0495672_0066337 3300047320 Bacteria 2060
184 Ga0495676_0003242 3300047321 Bacteria 14720
185 Ga0495680_0003089 3300047322 Bacteria 16592
186 Ga0495683_0000002 3300047323 Bacteria 638279
187 Ga0495679_000034 3300047446 Bacteria 164878
188 Ga0495679_003705 3300047446 Bacteria 7273
189 Ga0495673_0000386 3300047469 Bacteria 51987
190 Ga0495673_0118846 3300047469 Bacteria 1049
191 Ga0495681_0001430 3300047470 Bacteria 17946
192 Ga0495593_0005739 3300047673 Bacteria 7326
193 Ga0495614_0008186 3300048089 Bacteria 4650
194 Ga0496100_0142375 3300048903 Bacteria 1701
195 Ga0496101_0106973 3300048904 Bacteria 2101
196 Ga0496102_0226940 3300048905 Bacteria 1761
197 Ga0496102_0301440 3300048905 Bacteria 1510
198 Ga0496104_0015379 3300048907 Bacteria 6930
199 Ga0496104_0084884 3300048907 Bacteria 3022
200 Ga0496106_0046313 3300048909 Bacteria 3269
201 Ga0496106_0130832 3300048909 Bacteria 1968
202 Ga0496107_0061374 3300048910 Bacteria 2722
203 Ga0496108_0091483 3300048911 Bacteria 2586
204 Ga0496109_0019192 3300048912 Bacteria 6022
205 Ga0496112_0000169 3300048915 Bacteria 41507
206 Ga0496112_0036672 3300048915 Bacteria 4783
207 Ga0496113_0054050 3300048916 Bacteria 3005
208 Ga0496115_0281135 3300048918 Bacteria 1366
209 Ga0496117_0028593 3300048920 Bacteria 4315
210 Ga0496117_0060129 3300048920 Bacteria 2621
211 Ga0496117_0125361 3300048920 Bacteria 1569
212 Ga0496118_0015191 3300048921 Bacteria 7150
213 Ga0496119_0040898 3300048922 Bacteria 2959
214 Ga0496121_0017422 3300048924 Bacteria 7341
215 Ga0496122_0000029 3300048925 Bacteria 336396
216 Ga0496122_0000184 3300048925 Bacteria 144437
217 Ga0496122_0207365 3300048925 Bacteria 1139
218 Ga0496123_0000216 3300048926 Bacteria 117098
219 Ga0496123_0000738 3300048926 Bacteria 52962
220 Ga0496123_0023289 3300048926 Bacteria 4742
221 Ga0496124_0179284 3300048927 Bacteria 1632
222 Ga0496125_0009347 3300048928 Bacteria 10100
223 Ga0496125_0051389 3300048928 Bacteria 3400
224 Ga0496125_0052827 3300048928 Bacteria 3338
225 Ga0496126_0009925 3300048929 Bacteria 10053
226 Ga0496126_0050582 3300048929 Bacteria 3786
227 Ga0496126_0127359 3300048929 Bacteria 2203
228 Ga0496126_0130897 3300048929 Bacteria 2168
229 Ga0496126_0320482 3300048929 Bacteria 1274
230 Ga0495678_000005 3300049459 Bacteria 522958
231 Ga0495678_006624 3300049459 Bacteria 6137
232 Ga0501034_0254303 3300049571 Bacteria 1701
233 nmdc:mga03683_66904_c1 3300050489 Bacteria 1528
234 nmdc:mga0yw44_236568_c1 3300050492 Bacteria 1213
235 nmdc:mga0yw44_67482_c1 3300050492 Bacteria 2211
236 nmdc:mga0k408_32122_c1 3300050493 Bacteria 2999
237 nmdc:mga0k408_59634_c1 3300050493 Bacteria 2217
238 nmdc:mga06z11_72179_c1 3300050494 Bacteria 1829
239 nmdc:mga07m45_193193_c1 3300050496 Bacteria 1184
240 nmdc:mga07m45_57427_c1 3300050496 Bacteria 2201
241 nmdc:mga09592_62289_c1 3300050508 Bacteria 3156
242 nmdc:mga0qj67_178890_c1 3300050509 Bacteria 1723
243 nmdc:mga06r32_36000_c1 3300050510 Bacteria 4674
244 nmdc:mga06r32_96808_c1 3300050510 Bacteria 2891
245 nmdc:mga0sz30_50392_c1 3300050516 Bacteria 1765
246 Ga0500643_041080 3300053087 Bacteria 1360
247 Ga0500644_0000703 3300053088 Bacteria 11861
248 Ga0500583_0143111 3300053092 Bacteria 1189
249 Ga0500651_0011438 3300053093 Bacteria 5351
250 Ga0500651_0180099 3300053093 Bacteria 1256
251 Ga0500562_012348 3300053108 Bacteria 2173
252 Ga0500595_000003 3300053119 Bacteria 419332
253 Ga0500595_001128 3300053119 Bacteria 14801
254 Ga0500595_006405 3300053119 Bacteria 4995
255 Ga0500607_004115 3300053121 Bacteria 10163
256 Ga0500618_003636 3300053125 Bacteria 5220
257 Ga0500618_003858 3300053125 Bacteria 4992
258 Ga0500618_027023 3300053125 Bacteria 1367
259 Ga0500559_0006546 3300053136 Bacteria 5256
260 Ga0500568_0025087 3300053139 Bacteria 2519
261 Ga0500573_0000788 3300053140 Bacteria 14254
262 Ga0500616_0000002 3300053153 Bacteria 1611257
263 Ga0500616_0046282 3300053153 Bacteria 2313
264 Ga0500622_0017813 3300053156 Bacteria 3778
265 Ga0500645_000087 3300053730 Bacteria 74431
266 2514040642 2513237165 Bacteria 6771773
267 2596371745 2595698237 Bacteria 6712432
268 2738746124 2738541281 Bacteria 5112672
269 2739355354 2738543032 Bacteria 5115625
270 2842695475 2842694124 Bacteria 4063419
271 2842700659 2842698319 Bacteria 5190321
272 2889311405 2889306138 Bacteria 6358934
273 2894775814 2894772417 Bacteria 5305674
274 2902336917 2902330777 Bacteria 6395352
275 2902411183 2902405164 Bacteria 6784948
276 2928128006 2928125067 Bacteria 5937560
277 2954770538 2954767861 Bacteria 5535784
278 2960672070 2960667422 Bacteria 6763020
279 3003670118 3003665799 Bacteria 7279786
280 8055227016 8055225921 Bacteria 3341787
281 Ga0395898_0200210
282 JGI25153J46596_10004157
283 Ga0006562J51391_1113361
284 JGI25404J52841_10002609
285 Ga0070668_100378139
286 Ga0070709_10002780
287 Ga0070714_100013583
288 Ga0070713_100001260
289 Ga0070710_10001251
290 Ga0070711_100001495
291 Ga0070698_100214310
292 Ga0068866_10121739
293 Ga0081455_10067919
294 Ga0081540_1010416
295 Ga0081539_10000207
296 Ga0081539_10129581
297 Ga0070717_10005205
298 Ga0075365_10008388
299 Ga0075365_10168187
300 Ga0075368_10089520
301 Ga0075363_100118079
302 Ga0070712_100000463
303 Ga0075362_10177045
304 Ga0075367_10125511
305 Ga0075367_10153643
306 Ga0075367_10191241
307 Ga0075366_10046182
308 Ga0075366_10055562
309 Ga0075370_10136447
310 Ga0075370_10203099
311 Ga0075370_10212407
312 Ga0075428_100395770
313 Ga0075431_100344976
314 Ga0099794_10020575
315 Ga0099795_10003024
316 Ga0105251_10077007
317 Ga0105243_10339088
318 Ga0099796_10010340
319 Ga0099796_10054594
320 Ga0157373_10017388
321 Ga0157371_10000848
322 Ga0171462_1010
323 Ga0163162_10172314
324 Ga0157380_10486997
325 Ga0182008_10063493
326 Ga0157379_10415932
327 Ga0182006_1071951
328 Ga0163161_10000707
329 Ga0207425_1000984
330 Ga0209129_1000084
331 Ga0209565_1000285
332 Ga0209565_1007779
333 Ga0209673_1002884
334 Ga0209130_1001824
335 Ga0209675_1001325
336 Ga0209675_1007450
337 Ga0209025_1000942
338 Ga0209564_1000357
339 Ga0209758_1000176
340 Ga0209758_1000184
341 Ga0209256_1000030
342 Ga0209256_1000156
343 Ga0209256_1000954
344 Ga0207426_1000049
345 Ga0209257_1004419
346 Ga0207692_10188934
347 Ga0207642_10093915
348 Ga0207688_10076312
349 Ga0207685_10004457
350 Ga0207699_10022207
351 Ga0207693_10154141
352 Ga0207681_10002481
353 Ga0207686_10202050
354 Ga0207709_10190365
355 Ga0207669_10016410
356 Ga0207665_10025687
357 Ga0207668_10043777
358 Ga0268266_10264920
359 Ga0268265_10501541
360 Ga0307517_10091702
361 Ga0307515_10000877
362 Ga0307515_10050608
363 Ga0307515_10339456
364 Ga0316183_1002159
365 Ga0316182_1404263
366 Ga0265340_10032963
367 Ga0265340_10035701
368 Ga0265340_10161569
369 Ga0265331_10034853
370 Ga0307513_10005679
371 Ga0307513_10043136
372 Ga0307408_100091929
373 Ga0265314_10239028
374 Ga0265342_10074163
375 Ga0316576_10003774
376 Ga0307405_10085712
377 Ga0307405_10227974
378 Ga0307405_10370857
379 Ga0307413_10330237
380 Ga0307412_10001916
381 Ga0307507_10036308
382 Ga0307510_10041448
383 Ga0307510_10141714
384 Ga0373926_0100465
385 Ga0373927_0005522
386 Ga0400483_274600
387 Ga0439447_051784
388 Ga0451807_0902963
389 Ga0450911_000210
390 Ga0451577_0134487
391 Ga0466968_0060693
392 Ga0466960_0201922
393 Ga0451576_0000545
394 Ga0451576_0001712
395 Ga0495627_014676
396 Ga0495592_0005391
397 Ga0495603_0027461
398 Ga0495591_000159
399 Ga0495591_006126
400 Ga0495629_0001995
401 Ga0495638_0060655
402 Ga0495653_0003194
403 Ga0495653_0008284
404 Ga0495650_0004263
405 Ga0495580_0000659
406 Ga0495605_0000001
407 Ga0495605_0000025
408 Ga0495605_0000201
409 Ga0495662_0007042
410 Ga0495664_0059938
411 Ga0495584_0000814
412 Ga0495585_0000322
413 Ga0495594_0042305
414 Ga0495607_0000074
415 Ga0495607_0002558
416 Ga0495607_0051290
417 Ga0495583_0000070
418 Ga0495583_0000732
419 Ga0495606_0001580
420 Ga0495616_0005195
421 Ga0495620_0000009
422 Ga0495628_0168099
423 Ga0495630_0007124
424 Ga0495631_0004443
425 Ga0495637_0011059
426 Ga0495637_0049923
427 Ga0495648_0003210
428 Ga0495648_0011475
429 Ga0495648_0019945
430 Ga0495666_0000966
431 Ga0495642_0093483
432 Ga0495652_0150037
433 Ga0495654_0001028
434 Ga0495654_0032399
435 Ga0495586_0162096
436 Ga0495609_0000074
437 Ga0495609_0003727
438 Ga0495597_0000002
439 Ga0495597_0002100
440 Ga0495645_0007107
441 Ga0495633_0000010
442 Ga0495668_0075382
443 Ga0495634_0024689
444 Ga0495611_0003840
445 Ga0495611_0103626
446 Ga0495635_0008172
447 Ga0495661_0000008
448 Ga0495661_0000014
449 Ga0495661_0007742
450 Ga0495661_0019068
451 Ga0495599_0008113
452 Ga0495623_0076740
453 Ga0495646_0001345
454 Ga0495613_0035658
455 Ga0495649_0000162
456 Ga0495589_0001007
457 Ga0495600_0092832
458 Ga0495660_0001709
459 Ga0495581_0000454
460 Ga0495604_0003389
461 Ga0495674_0018640
462 Ga0495672_0051089
463 Ga0495672_0066337
464 Ga0495676_0003242
465 Ga0495680_0003089
466 Ga0495683_0000002
467 Ga0495679_000034
468 Ga0495679_003705
469 Ga0495673_0000386
470 Ga0495673_0118846
471 Ga0495681_0001430
472 Ga0495593_0005739
473 Ga0495614_0008186
474 Ga0496100_0142375
475 Ga0496101_0106973
476 Ga0496102_0226940
477 Ga0496102_0301440
478 Ga0496104_0015379
479 Ga0496104_0084884
480 Ga0496106_0046313
481 Ga0496106_0130832
482 Ga0496107_0061374
483 Ga0496108_0091483
484 Ga0496109_0019192
485 Ga0496112_0000169
486 Ga0496112_0036672
487 Ga0496113_0054050
488 Ga0496115_0281135
489 Ga0496117_0028593
490 Ga0496117_0060129
491 Ga0496117_0125361
492 Ga0496118_0015191
493 Ga0496119_0040898
494 Ga0496121_0017422
495 Ga0496122_0000029
496 Ga0496122_0000184
497 Ga0496122_0207365
498 Ga0496123_0000216
499 Ga0496123_0000738
500 Ga0496123_0023289
501 Ga0496124_0179284
502 Ga0496125_0009347
503 Ga0496125_0051389
504 Ga0496125_0052827
505 Ga0496126_0009925
506 Ga0496126_0050582
507 Ga0496126_0127359
508 Ga0496126_0130897
509 Ga0496126_0320482
510 Ga0495678_000005
511 Ga0495678_006624
512 Ga0501034_0254303
513 nmdc:mga03683_66904_c1
514 nmdc:mga0yw44_236568_c1
515 nmdc:mga0yw44_67482_c1
516 nmdc:mga0k408_32122_c1
517 nmdc:mga0k408_59634_c1
518 nmdc:mga06z11_72179_c1
519 nmdc:mga07m45_193193_c1
520 nmdc:mga07m45_57427_c1
521 nmdc:mga09592_62289_c1
522 nmdc:mga0qj67_178890_c1
523 nmdc:mga06r32_36000_c1
524 nmdc:mga06r32_96808_c1
525 nmdc:mga0sz30_50392_c1
526 Ga0500643_041080
527 Ga0500644_0000703
528 Ga0500583_0143111
529 Ga0500651_0011438
530 Ga0500651_0180099
531 Ga0500562_012348
532 Ga0500595_000003
533 Ga0500595_001128
534 Ga0500595_006405
535 Ga0500607_004115
536 Ga0500618_003636
537 Ga0500618_003858
538 Ga0500618_027023
539 Ga0500559_0006546
540 Ga0500568_0025087
541 Ga0500573_0000788
542 Ga0500616_0000002
543 Ga0500616_0046282
544 Ga0500622_0017813
545 Ga0500645_000087
546 2514040642
547 2596371745
548 2738746124
549 2739355354
550 2842695475
551 2842700659
552 2889311405
553 2894775814
554 2902336917
555 2902411183
556 2928128006
557 2954770538
558 2960672070
559 3003670118
560 8055227016

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

130

312

0.95

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

36

87

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.8099 68 275
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7931 68 275
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7793 68 275
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7632 68 275
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7403 76 270
ID Description Score Start End Superfamily
af_P75799_92_298_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9279 72 277 1.10.3720.10
af_Q2G1F6_179_383_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9251 73 277 1.10.3720.10
af_P75799_92_298_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9195 72 277 1.10.3720.10
af_P0AEG1_88_295_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9193 70 277 1.10.3720.10
af_P77463_85_288_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9179 73 274 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A4P0XY00-F1-model_v4 Dipeptide transport system permease DppC 0.8877 52 280 GO:0005886
GO:0055085
AF-A0A1Z9TLN1-F1-model_v4 deleted 0.8772 53 279
AF-A0A4P0XY00-F1-model_v4 Dipeptide transport system permease DppC 0.8731 52 280 GO:0005886
GO:0055085
AF-C9Y3S0-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8549 48 274 GO:0005886
GO:0055085
AF-A0A2W7R4E0-F1-model_v4 Peptide/nickel transport system permease protein 0.841 23 280 GO:0005886
GO:0015833
GO:0055085

Map