F383684

General Info

Members Datasets Scaffolds Average Seq Length
280 167 560 346

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10026424|Ga0157375_100264243
Length 389
Sequence MNPVYRIDMLTSKNLTHTKKPELNECVGCGNEVALFQPEISMNVKLKKLSEQVIVITGASSGIGLVTARMAAKRGARLVLNARNEEALRLVSDEINRAGGEAIHVVGDVGRVDDVQKIPDEAIRRFGGFDTWVNNAGVSIYGRMLEQSLEDQRRLFETNYWGMVHGSLVACAHLRNKGGTLINVGSVLSDVAIPLQGTYCATKHAVKGYTDALRLELEEEGAPISVTLIKPSTIDTPYVQHAKNLMPVEPQNPPPVYAPETVAEAILHCAEHPERDVVVGGGGKMLAEAGHHVPRLTDKLIEATMFDVQQSDRPKPNNRDDSLYSPSKDGKERGTYPGHVAESSVYMKVKLHPVIASSLIAGLGLAAFAGWRSLSRTNERSIGGSSNHA

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
124 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
125 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
126 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
145 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
146 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
147 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
148 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
149 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
150 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
161 2508501050 Microvirga lupini Lut6 Isolate Nodule
162 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
163 2773857925 Microvirga vignae BR3299 Isolate Unclassified
164 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
165 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
166 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
167 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.5
Metatranscriptomes 0
Isolates 2.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 1.43
Rhizoplane 3.57
Rhizosphere 93.21
Stem 0
Stem Tuber 0
Unclassified 8.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10026424 3300013308 Bacteria 5410
2 LJQas_1000972 3300000549 Bacteria 4412
3 JGI24751J29686_10000027 3300002459 Bacteria 95343
4 Ga0065704_10128082 3300005289 Bacteria 1667
5 Ga0065704_10180264 3300005289 Bacteria 1241
6 Ga0065712_10083971 3300005290 Bacteria 2798
7 Ga0065712_10201978 3300005290 Bacteria 1105
8 Ga0065715_10007459 3300005293 Bacteria 4192
9 Ga0065715_10148256 3300005293 Bacteria 1761
10 Ga0065707_10001306 3300005295 Bacteria 9979
11 Ga0065707_10093336 3300005295 Bacteria 3641
12 Ga0070683_100004649 3300005329 Bacteria 11345
13 Ga0070690_100003109 3300005330 Bacteria 9031
14 Ga0070670_100000070 3300005331 Bacteria 103166
15 Ga0070670_100004794 3300005331 Bacteria 11358
16 Ga0070670_100057466 3300005331 Unclassified 3340
17 Ga0070682_100023532 3300005337 Bacteria 3657
18 Ga0070682_100039426 3300005337 Unclassified 2903
19 Ga0068868_100272598 3300005338 Bacteria 1430
20 Ga0070689_100002453 3300005340 Bacteria 12118
21 Ga0070692_10004686 3300005345 Bacteria 5733
22 Ga0070675_100166277 3300005354 Bacteria 1900
23 Ga0070675_100185710 3300005354 Bacteria 1799
24 Ga0070671_100048295 3300005355 Bacteria 3539
25 Ga0070659_100038181 3300005366 Bacteria 3745
26 Ga0070701_10018028 3300005438 Bacteria 3312
27 Ga0070700_100160922 3300005441 Bacteria 1545
28 Ga0070694_100000466 3300005444 Bacteria 22129
29 Ga0070663_100065457 3300005455 Unclassified 2631
30 Ga0070663_100106938 3300005455 Bacteria 2096
31 Ga0070663_100237953 3300005455 Bacteria 1436
32 Ga0070662_100048785 3300005457 Bacteria 3051
33 Ga0070662_100258146 3300005457 Bacteria 1403
34 Ga0068867_100078912 3300005459 Bacteria 2477
35 Ga0070684_100000742 3300005535 Bacteria 22631
36 Ga0070672_100125277 3300005543 Unclassified 2107
37 Ga0070686_100036152 3300005544 Bacteria 3056
38 Ga0070696_100139376 3300005546 Bacteria 1771
39 Ga0070696_100190813 3300005546 Bacteria 1525
40 Ga0070693_100024663 3300005547 Bacteria 3228
41 Ga0070704_100051083 3300005549 Bacteria 2910
42 Ga0070704_100295448 3300005549 Bacteria 1348
43 Ga0070704_100408482 3300005549 Bacteria 1160
44 Ga0070664_100001765 3300005564 Bacteria 17336
45 Ga0070664_100074205 3300005564 Bacteria 2920
46 Ga0068857_100035401 3300005577 Bacteria 4421
47 Ga0068857_100049494 3300005577 Bacteria 3728
48 Ga0068857_100052682 3300005577 Bacteria 3610
49 Ga0068857_100210671 3300005577 Bacteria 1773
50 Ga0068856_100146235 3300005614 Bacteria 2371
51 Ga0070702_100086570 3300005615 Bacteria 1890
52 Ga0068859_100028259 3300005617 Bacteria 5622
53 Ga0068859_100032425 3300005617 Bacteria 5248
54 Ga0068859_100102888 3300005617 Bacteria 2914
55 Ga0068859_100159334 3300005617 Bacteria 2336
56 Ga0068859_100459309 3300005617 Bacteria 1369
57 Ga0068864_100197344 3300005618 Bacteria 1847
58 Ga0068864_100358096 3300005618 Bacteria 1378
59 Ga0068861_100028027 3300005719 Bacteria 4108
60 Ga0068861_100186188 3300005719 Bacteria 1732
61 Ga0068851_10023668 3300005834 Bacteria 3004
62 Ga0068870_10007406 3300005840 Bacteria 4889
63 Ga0068870_10047177 3300005840 Bacteria 2263
64 Ga0068863_100024849 3300005841 Bacteria 5714
65 Ga0068863_100093537 3300005841 Bacteria 2853
66 Ga0068860_100275945 3300005843 Bacteria 1642
67 Ga0068862_100025736 3300005844 Bacteria 4942
68 Ga0081539_10000318 3300005985 Bacteria 107294
69 Ga0097621_100031916 3300006237 Unclassified 4182
70 Ga0068871_100012526 3300006358 Bacteria 6258
71 Ga0075428_100007129 3300006844 Bacteria 12382
72 Ga0075428_100304289 3300006844 Bacteria 1714
73 Ga0075428_100461077 3300006844 Bacteria 1361
74 Ga0075430_100325516 3300006846 Unclassified 1270
75 Ga0075431_100007111 3300006847 Bacteria 11119
76 Ga0075431_100533953 3300006847 Bacteria 1161
77 Ga0075433_10029753 3300006852 Unclassified 4656
78 Ga0075433_10075594 3300006852 Unclassified 2964
79 Ga0075433_10156009 3300006852 Bacteria 2031
80 Ga0075434_100004286 3300006871 Bacteria 12809
81 Ga0075434_100069131 3300006871 Bacteria 3520
82 Ga0075429_100299036 3300006880 Bacteria 1409
83 Ga0068865_100034414 3300006881 Bacteria 3399
84 Ga0068865_100247805 3300006881 Bacteria 1405
85 Ga0075436_100078943 3300006914 Bacteria 2280
86 Ga0097620_100028259 3300006931 Bacteria 5622
87 Ga0097620_100032426 3300006931 Bacteria 5248
88 Ga0097620_100102886 3300006931 Bacteria 2914
89 Ga0097620_100159335 3300006931 Bacteria 2336
90 Ga0097620_100459299 3300006931 Bacteria 1369
91 Ga0105240_10344083 3300009093 Bacteria 1693
92 Ga0111539_10007659 3300009094 Bacteria 13798
93 Ga0111539_10596089 3300009094 Bacteria 1287
94 Ga0114129_10001153 3300009147 Bacteria 34987
95 Ga0114129_10066317 3300009147 Bacteria 5036
96 Ga0114129_10306422 3300009147 Bacteria 2115
97 Ga0114129_10329471 3300009147 Bacteria 2028
98 Ga0105243_10005942 3300009148 Bacteria 9455
99 Ga0105243_10113593 3300009148 Bacteria 2271
100 Ga0105243_10589712 3300009148 Bacteria 1068
101 Ga0105241_10050994 3300009174 Bacteria 3155
102 Ga0105241_10061965 3300009174 Bacteria 2882
103 Ga0105241_10108074 3300009174 Bacteria 2223
104 Ga0105241_10408505 3300009174 Archaea 1193
105 Ga0105242_10048209 3300009176 Bacteria 3462
106 Ga0105242_10244615 3300009176 Bacteria 1614
107 Ga0105248_10254660 3300009177 Bacteria 1976
108 Ga0105237_10000987 3300009545 Bacteria 38208
109 Ga0105237_10284904 3300009545 Bacteria 1655
110 Ga0105238_10003734 3300009551 Bacteria 15146
111 Ga0105238_10005722 3300009551 Bacteria 12289
112 Ga0105249_10018268 3300009553 Bacteria 6234
113 Ga0105249_10018454 3300009553 Bacteria 6207
114 Ga0105249_10031151 3300009553 Bacteria 4822
115 Ga0105249_10255149 3300009553 Unclassified 1740
116 Ga0105239_10054018 3300010375 Bacteria 4405
117 Ga0105246_10072150 3300011119 Bacteria 2433
118 Ga0157373_10021597 3300013100 Bacteria 4674
119 Ga0157374_10138756 3300013296 Bacteria 2359
120 Ga0163162_10061968 3300013306 Bacteria 3779
121 Ga0163162_10100716 3300013306 Bacteria 2981
122 Ga0157372_10112795 3300013307 Bacteria 3115
123 Ga0157372_10118066 3300013307 Bacteria 3043
124 Ga0157375_10396451 3300013308 Unclassified 1547
125 Ga0163163_10000087 3300014325 Bacteria 101689
126 Ga0157380_10010389 3300014326 Bacteria 6697
127 Ga0157380_10022971 3300014326 Bacteria 4704
128 Ga0157380_10155593 3300014326 Bacteria 1981
129 Ga0157380_10156550 3300014326 Bacteria 1975
130 Ga0157380_10409837 3300014326 Unclassified 1289
131 Ga0157380_10555326 3300014326 Bacteria 1127
132 Ga0213876_10012196 3300021384 Bacteria 4577
133 Ga0207656_10037127 3300025321 Bacteria 2048
134 Ga0207710_10001152 3300025900 Bacteria 13476
135 Ga0207688_10062272 3300025901 Bacteria 2103
136 Ga0207647_10020977 3300025904 Bacteria 4370
137 Ga0207643_10009020 3300025908 Bacteria 5355
138 Ga0207654_10024600 3300025911 Bacteria 3239
139 Ga0207695_10145201 3300025913 Bacteria 2317
140 Ga0207671_10006201 3300025914 Bacteria 10732
141 Ga0207681_10028624 3300025923 Bacteria 3610
142 Ga0207694_10005578 3300025924 Bacteria 9644
143 Ga0207650_10000017 3300025925 Bacteria 354674
144 Ga0207650_10003136 3300025925 Bacteria 11389
145 Ga0207650_10326524 3300025925 Bacteria 1258
146 Ga0207659_10220013 3300025926 Bacteria 1526
147 Ga0207659_10241957 3300025926 Bacteria 1460
148 Ga0207644_10050333 3300025931 Bacteria 2986
149 Ga0207690_10006136 3300025932 Bacteria 7120
150 Ga0207706_10075007 3300025933 Bacteria 2974
151 Ga0207706_10128512 3300025933 Bacteria 2228
152 Ga0207709_10012992 3300025935 Bacteria 4590
153 Ga0207709_10036736 3300025935 Bacteria 2905
154 Ga0207670_10000359 3300025936 Bacteria 26532
155 Ga0207704_10055935 3300025938 Bacteria 2414
156 Ga0207689_10192214 3300025942 Bacteria 1684
157 Ga0207679_10009908 3300025945 Bacteria 6118
158 Ga0207679_10051938 3300025945 Bacteria 3004
159 Ga0207712_10001527 3300025961 Bacteria 15671
160 Ga0207712_10010155 3300025961 Bacteria 5970
161 Ga0207668_10022369 3300025972 Bacteria 4047
162 Ga0207658_10317339 3300025986 Bacteria 1348
163 Ga0207703_10018409 3300026035 Bacteria 5454
164 Ga0207639_10123480 3300026041 Unclassified 2131
165 Ga0207678_10025253 3300026067 Bacteria 5187
166 Ga0207678_10041172 3300026067 Unclassified 4005
167 Ga0207708_10007783 3300026075 Bacteria 7936
168 Ga0207708_10054113 3300026075 Bacteria 3059
169 Ga0207641_10314422 3300026088 Unclassified 1483
170 Ga0207676_10015176 3300026095 Bacteria 5556
171 Ga0207676_10265855 3300026095 Bacteria 1551
172 Ga0207674_10007406 3300026116 Bacteria 12787
173 Ga0207674_10026956 3300026116 Bacteria 6092
174 Ga0207674_10063484 3300026116 Bacteria 3728
175 Ga0207674_10071825 3300026116 Bacteria 3477
176 Ga0207674_10234240 3300026116 Bacteria 1784
177 Ga0207675_100007553 3300026118 Bacteria 10271
178 Ga0207675_100118235 3300026118 Bacteria 2506
179 Ga0207675_100185915 3300026118 Bacteria 1991
180 Ga0207675_100393069 3300026118 Bacteria 1365
181 Ga0207683_10341936 3300026121 Bacteria 1372
182 Ga0207698_10047197 3300026142 Unclassified 3260
183 Ga0209974_10057982 3300027876 Bacteria 1308
184 Ga0207428_10090461 3300027907 Unclassified 2377
185 Ga0268265_10038528 3300028380 Bacteria 3517
186 Ga0268264_10032790 3300028381 Unclassified 4262
187 Ga0268264_10101775 3300028381 Bacteria 2498
188 Ga0268264_10288753 3300028381 Bacteria 1540
189 Ga0307408_100007280 3300031548 Bacteria 7320
190 Ga0307408_100158409 3300031548 Bacteria 1796
191 Ga0307408_100246810 3300031548 Bacteria 1470
192 Ga0307413_10002671 3300031824 Bacteria 7309
193 Ga0307413_10015001 3300031824 Bacteria 3958
194 Ga0307410_10025522 3300031852 Bacteria 3709
195 Ga0307410_10091643 3300031852 Bacteria 2158
196 Ga0307410_10098155 3300031852 Bacteria 2094
197 Ga0307410_10144094 3300031852 Bacteria 1766
198 Ga0307406_10018054 3300031901 Bacteria 4115
199 Ga0307406_10045740 3300031901 Bacteria 2750
200 Ga0307407_10000422 3300031903 Bacteria 12949
201 Ga0307407_10008731 3300031903 Bacteria 4671
202 Ga0307407_10029201 3300031903 Bacteria 2959
203 Ga0307407_10088412 3300031903 Bacteria 1893
204 Ga0307412_10023597 3300031911 Bacteria 3788
205 Ga0307412_10082466 3300031911 Bacteria 2227
206 Ga0307409_100009168 3300031995 Bacteria 6065
207 Ga0307409_100171173 3300031995 Bacteria 1912
208 Ga0307409_100240221 3300031995 Bacteria 1648
209 Ga0307416_100149992 3300032002 Bacteria 2136
210 Ga0307416_100213430 3300032002 Unclassified 1843
211 Ga0307416_100429147 3300032002 Unclassified 1368
212 Ga0307414_10018475 3300032004 Bacteria 4294
213 Ga0307414_10021521 3300032004 Bacteria 4049
214 Ga0307414_10239979 3300032004 Bacteria 1500
215 Ga0307414_10414982 3300032004 Bacteria 1172
216 Ga0307411_10024817 3300032005 Bacteria 3580
217 Ga0307411_10086716 3300032005 Bacteria 2172
218 Ga0307415_100054149 3300032126 Bacteria 2737
219 Ga0373951_0000514 3300035091 Bacteria 11019
220 Ga0436365_1820221 3300039437 Bacteria 15326
221 Ga0439441_016700 3300042001 Bacteria 1311
222 Ga0439445_0018592 3300042004 Bacteria 1726
223 Ga0439434_0017513 3300042435 Bacteria 2144
224 Ga0439464_0013290 3300042439 Bacteria 2203
225 Ga0495632_0043680 3300046519 Bacteria 2239
226 Ga0495658_0250781 3300046683 Bacteria 1113
227 Ga0496103_0114783 3300048906 Bacteria 1713
228 Ga0496104_0190066 3300048907 Bacteria 1964
229 Ga0496104_0257920 3300048907 Bacteria 1656
230 Ga0496105_0072784 3300048908 Bacteria 2840
231 Ga0496108_0077544 3300048911 Bacteria 2811
232 Ga0496109_0007465 3300048912 Bacteria 9259
233 Ga0496110_0002426 3300048913 Bacteria 13963
234 Ga0496110_0136869 3300048913 Bacteria 2214
235 Ga0496111_0112546 3300048914 Bacteria 2005
236 Ga0496113_0101458 3300048916 Bacteria 2231
237 Ga0501034_0000584 3300049571 Bacteria 57652
238 Ga0501036_0109759 3300049572 Bacteria 2331
239 Ga0501038_0000574 3300049574 Bacteria 32515
240 Ga0501039_0248418 3300049575 Bacteria 1399
241 Ga0501072_0008577 3300049588 Bacteria 7755
242 Ga0501075_0032220 3300049591 Bacteria 3894
243 Ga0501076_0116039 3300049592 Bacteria 2167
244 Ga0501202_011966 3300049652 Bacteria 1632
245 Ga0501223_003547 3300049663 Bacteria 3378
246 Ga0501233_023366 3300049668 Bacteria 1343
247 Ga0501243_006144 3300049675 Bacteria 1819
248 Ga0501259_009182 3300049688 Bacteria 1602
249 Ga0501225_0003175 3300049705 Bacteria 5022
250 Ga0501268_008582 3300049765 Bacteria 1552
251 Ga0501044_0364866 3300049823 Bacteria 1362
252 Ga0501045_0008169 3300049824 Bacteria 7291
253 nmdc:mga05p37_151035_c1 3300050507 Unclassified 2841
254 nmdc:mga05p37_248301_c1 3300050507 Bacteria 2136
255 nmdc:mga05p37_462164_c1 3300050507 Bacteria 1466
256 nmdc:mga09592_458740_c1 3300050508 Bacteria 1099
257 nmdc:mga0qj67_318932_c1 3300050509 Bacteria 1258
258 nmdc:mga0qj67_3646_c1 3300050509 Bacteria 11112
259 nmdc:mga06r32_110774_c1 3300050510 Bacteria 2701
260 nmdc:mga06r32_265101_c1 3300050510 Bacteria 1705
261 nmdc:mga06r32_28340_c1 3300050510 Bacteria 5239
262 nmdc:mga08y16_336787_c1 3300050511 Bacteria 1551
263 nmdc:mga08y16_4912_c1 3300050511 Bacteria 13977
264 nmdc:mga08y16_6309_c1 3300050511 Bacteria 12435
265 nmdc:mga0n895_23485_c1 3300050512 Bacteria 5796
266 nmdc:mga0n895_263776_c1 3300050512 Unclassified 1748
267 nmdc:mga0n895_280581_c1 3300050512 Bacteria 1689
268 nmdc:mga0n895_352133_c1 3300050512 Bacteria 1491
269 nmdc:mga0a205_174388_c1 3300050515 Bacteria 2046
270 nmdc:mga0a205_180085_c1 3300050515 Bacteria 2008
271 nmdc:mga0a205_186671_c1 3300050515 Unclassified 1966
272 nmdc:mga0a205_406850_c1 3300050515 Unclassified 1224
273 Ga0590077_003228 3300059426 Bacteria 3393
274 2508727572 2508501050 Bacteria 9633614
275 2509077460 2508501114 Bacteria 7082538
276 2774868701 2773857925 Bacteria 6472445
277 2776258309 2775506901 Bacteria 9631051
278 2835315273 2835312727 Bacteria 7413381
279 2882457533 2882456835 Bacteria 6863978
280 2894235452 2894232714 Bacteria 8834183
281 Ga0157375_10026424
282 LJQas_1000972
283 JGI24751J29686_10000027
284 Ga0065704_10128082
285 Ga0065704_10180264
286 Ga0065712_10083971
287 Ga0065712_10201978
288 Ga0065715_10007459
289 Ga0065715_10148256
290 Ga0065707_10001306
291 Ga0065707_10093336
292 Ga0070683_100004649
293 Ga0070690_100003109
294 Ga0070670_100000070
295 Ga0070670_100004794
296 Ga0070670_100057466
297 Ga0070682_100023532
298 Ga0070682_100039426
299 Ga0068868_100272598
300 Ga0070689_100002453
301 Ga0070692_10004686
302 Ga0070675_100166277
303 Ga0070675_100185710
304 Ga0070671_100048295
305 Ga0070659_100038181
306 Ga0070701_10018028
307 Ga0070700_100160922
308 Ga0070694_100000466
309 Ga0070663_100065457
310 Ga0070663_100106938
311 Ga0070663_100237953
312 Ga0070662_100048785
313 Ga0070662_100258146
314 Ga0068867_100078912
315 Ga0070684_100000742
316 Ga0070672_100125277
317 Ga0070686_100036152
318 Ga0070696_100139376
319 Ga0070696_100190813
320 Ga0070693_100024663
321 Ga0070704_100051083
322 Ga0070704_100295448
323 Ga0070704_100408482
324 Ga0070664_100001765
325 Ga0070664_100074205
326 Ga0068857_100035401
327 Ga0068857_100049494
328 Ga0068857_100052682
329 Ga0068857_100210671
330 Ga0068856_100146235
331 Ga0070702_100086570
332 Ga0068859_100028259
333 Ga0068859_100032425
334 Ga0068859_100102888
335 Ga0068859_100159334
336 Ga0068859_100459309
337 Ga0068864_100197344
338 Ga0068864_100358096
339 Ga0068861_100028027
340 Ga0068861_100186188
341 Ga0068851_10023668
342 Ga0068870_10007406
343 Ga0068870_10047177
344 Ga0068863_100024849
345 Ga0068863_100093537
346 Ga0068860_100275945
347 Ga0068862_100025736
348 Ga0081539_10000318
349 Ga0097621_100031916
350 Ga0068871_100012526
351 Ga0075428_100007129
352 Ga0075428_100304289
353 Ga0075428_100461077
354 Ga0075430_100325516
355 Ga0075431_100007111
356 Ga0075431_100533953
357 Ga0075433_10029753
358 Ga0075433_10075594
359 Ga0075433_10156009
360 Ga0075434_100004286
361 Ga0075434_100069131
362 Ga0075429_100299036
363 Ga0068865_100034414
364 Ga0068865_100247805
365 Ga0075436_100078943
366 Ga0097620_100028259
367 Ga0097620_100032426
368 Ga0097620_100102886
369 Ga0097620_100159335
370 Ga0097620_100459299
371 Ga0105240_10344083
372 Ga0111539_10007659
373 Ga0111539_10596089
374 Ga0114129_10001153
375 Ga0114129_10066317
376 Ga0114129_10306422
377 Ga0114129_10329471
378 Ga0105243_10005942
379 Ga0105243_10113593
380 Ga0105243_10589712
381 Ga0105241_10050994
382 Ga0105241_10061965
383 Ga0105241_10108074
384 Ga0105241_10408505
385 Ga0105242_10048209
386 Ga0105242_10244615
387 Ga0105248_10254660
388 Ga0105237_10000987
389 Ga0105237_10284904
390 Ga0105238_10003734
391 Ga0105238_10005722
392 Ga0105249_10018268
393 Ga0105249_10018454
394 Ga0105249_10031151
395 Ga0105249_10255149
396 Ga0105239_10054018
397 Ga0105246_10072150
398 Ga0157373_10021597
399 Ga0157374_10138756
400 Ga0163162_10061968
401 Ga0163162_10100716
402 Ga0157372_10112795
403 Ga0157372_10118066
404 Ga0157375_10396451
405 Ga0163163_10000087
406 Ga0157380_10010389
407 Ga0157380_10022971
408 Ga0157380_10155593
409 Ga0157380_10156550
410 Ga0157380_10409837
411 Ga0157380_10555326
412 Ga0213876_10012196
413 Ga0207656_10037127
414 Ga0207710_10001152
415 Ga0207688_10062272
416 Ga0207647_10020977
417 Ga0207643_10009020
418 Ga0207654_10024600
419 Ga0207695_10145201
420 Ga0207671_10006201
421 Ga0207681_10028624
422 Ga0207694_10005578
423 Ga0207650_10000017
424 Ga0207650_10003136
425 Ga0207650_10326524
426 Ga0207659_10220013
427 Ga0207659_10241957
428 Ga0207644_10050333
429 Ga0207690_10006136
430 Ga0207706_10075007
431 Ga0207706_10128512
432 Ga0207709_10012992
433 Ga0207709_10036736
434 Ga0207670_10000359
435 Ga0207704_10055935
436 Ga0207689_10192214
437 Ga0207679_10009908
438 Ga0207679_10051938
439 Ga0207712_10001527
440 Ga0207712_10010155
441 Ga0207668_10022369
442 Ga0207658_10317339
443 Ga0207703_10018409
444 Ga0207639_10123480
445 Ga0207678_10025253
446 Ga0207678_10041172
447 Ga0207708_10007783
448 Ga0207708_10054113
449 Ga0207641_10314422
450 Ga0207676_10015176
451 Ga0207676_10265855
452 Ga0207674_10007406
453 Ga0207674_10026956
454 Ga0207674_10063484
455 Ga0207674_10071825
456 Ga0207674_10234240
457 Ga0207675_100007553
458 Ga0207675_100118235
459 Ga0207675_100185915
460 Ga0207675_100393069
461 Ga0207683_10341936
462 Ga0207698_10047197
463 Ga0209974_10057982
464 Ga0207428_10090461
465 Ga0268265_10038528
466 Ga0268264_10032790
467 Ga0268264_10101775
468 Ga0268264_10288753
469 Ga0307408_100007280
470 Ga0307408_100158409
471 Ga0307408_100246810
472 Ga0307413_10002671
473 Ga0307413_10015001
474 Ga0307410_10025522
475 Ga0307410_10091643
476 Ga0307410_10098155
477 Ga0307410_10144094
478 Ga0307406_10018054
479 Ga0307406_10045740
480 Ga0307407_10000422
481 Ga0307407_10008731
482 Ga0307407_10029201
483 Ga0307407_10088412
484 Ga0307412_10023597
485 Ga0307412_10082466
486 Ga0307409_100009168
487 Ga0307409_100171173
488 Ga0307409_100240221
489 Ga0307416_100149992
490 Ga0307416_100213430
491 Ga0307416_100429147
492 Ga0307414_10018475
493 Ga0307414_10021521
494 Ga0307414_10239979
495 Ga0307414_10414982
496 Ga0307411_10024817
497 Ga0307411_10086716
498 Ga0307415_100054149
499 Ga0373951_0000514
500 Ga0436365_1820221
501 Ga0439441_016700
502 Ga0439445_0018592
503 Ga0439434_0017513
504 Ga0439464_0013290
505 Ga0495632_0043680
506 Ga0495658_0250781
507 Ga0496103_0114783
508 Ga0496104_0190066
509 Ga0496104_0257920
510 Ga0496105_0072784
511 Ga0496108_0077544
512 Ga0496109_0007465
513 Ga0496110_0002426
514 Ga0496110_0136869
515 Ga0496111_0112546
516 Ga0496113_0101458
517 Ga0501034_0000584
518 Ga0501036_0109759
519 Ga0501038_0000574
520 Ga0501039_0248418
521 Ga0501072_0008577
522 Ga0501075_0032220
523 Ga0501076_0116039
524 Ga0501202_011966
525 Ga0501223_003547
526 Ga0501233_023366
527 Ga0501243_006144
528 Ga0501259_009182
529 Ga0501225_0003175
530 Ga0501268_008582
531 Ga0501044_0364866
532 Ga0501045_0008169
533 nmdc:mga05p37_151035_c1
534 nmdc:mga05p37_248301_c1
535 nmdc:mga05p37_462164_c1
536 nmdc:mga09592_458740_c1
537 nmdc:mga0qj67_318932_c1
538 nmdc:mga0qj67_3646_c1
539 nmdc:mga06r32_110774_c1
540 nmdc:mga06r32_265101_c1
541 nmdc:mga06r32_28340_c1
542 nmdc:mga08y16_336787_c1
543 nmdc:mga08y16_4912_c1
544 nmdc:mga08y16_6309_c1
545 nmdc:mga0n895_23485_c1
546 nmdc:mga0n895_263776_c1
547 nmdc:mga0n895_280581_c1
548 nmdc:mga0n895_352133_c1
549 nmdc:mga0a205_174388_c1
550 nmdc:mga0a205_180085_c1
551 nmdc:mga0a205_186671_c1
552 nmdc:mga0a205_406850_c1
553 Ga0590077_003228
554 2508727572
555 2509077460
556 2774868701
557 2776258309
558 2835315273
559 2882457533
560 2894235452

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

52

245

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

58

272

0.89

PF08659

KR

KR domain

52

231

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pej-assembly1.cif.gz_B structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol 0.941 13 194
7e6o-assembly1.cif.gz_B crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.94 6 194
1zem-assembly1.cif.gz_A crystal structure of nad+-bound xylitol dehydrogenase 0.94 6 193
7e6o-assembly1.cif.gz_A crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.9392 6 194
2uvd-assembly1.cif.gz_C the crystal structure of a 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis (ba3989) 0.9389 8 193
ID Description Score Start End Superfamily
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9627 11 97 3.40.50.720
af_Q0E0D3_22_224_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9428 11 195 3.40.50.720
af_Q0D3U8_30_207_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9411 11 172 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9401 7 199 3.40.50.720
1zemG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9392 6 193 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7V9M2H9-F1-model_v4 SDR family oxidoreductase 0.9675 12 304 GO:0016020
GO:0016491
AF-A0A5N7ZMG8-F1-model_v4 SDR family oxidoreductase 0.9652 8 145
AF-A0A7Y1UM02-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9599 6 160 GO:0005811
GO:0016616
AF-A0A0P9EU25-F1-model_v4 Short-chain dehydrogenase 0.9598 8 151 GO:0016020
GO:0016491
AF-A0A351DW70-F1-model_v4 Oxidoreductase 0.9597 11 185 GO:0016020
GO:0016491

Map