F383314

General Info

Members Datasets Scaffolds Average Seq Length
279 226 558 102

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0773711|Ga0501031_0773711_136_429
Length 97
Sequence VQIIAKRTLRLFWEVHPQAERLLRLWHASVEKAVWSRPSDAKAMFGASVDFVGDRLVFDVGGNKYRLVVHVAYAYKRVLIKFIGTHAEYDRIDVRTI

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
76 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
81 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
82 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
83 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
85 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
104 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
105 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
106 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
107 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
118 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
175 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
178 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
179 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
180 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
181 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
182 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
183 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
184 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
185 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
186 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
187 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
190 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
191 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
192 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
193 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
194 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
195 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
196 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
197 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
198 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
199 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
200 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
201 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
202 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
203 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
205 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
206 2519899620 Rhizobium sp. Pop5 Isolate Nodule
207 2643221568 Rhizobium sp. Root564 Isolate Unclassified
208 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
209 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
210 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
211 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
212 2738543024 Aminobacter sp. AP02 Isolate Unclassified
213 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
214 2791355261 Rhizobium sp. J15 Isolate Nodule
215 2791355263 Rhizobium chutanense C5 Isolate Nodule
216 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
217 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
218 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
219 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
220 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
221 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
222 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
223 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
224 8005382845 Rhizobium sp. R634 Isolate Nodule
225 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
226 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.76
Metatranscriptomes 0.36
Isolates 7.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 23.3
Nodule 3.23
Rhizoplane 4.66
Rhizosphere 49.46
Stem 0
Stem Tuber 0
Unclassified 4.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0773711 3300049568 Bacteria 616
2 JGI24742J22300_10080823 3300002244 Bacteria 614
3 JGI25152J39213_1002910 3300002773 Bacteria 6108
4 JGI25151J46595_10001793 3300003187 Bacteria 13861
5 rootH1_10234024 3300003323 Bacteria 1454
6 JGI25160J50197_1003347 3300003354 Bacteria 7203
7 JGI25161J50226_1015619 3300003374 Bacteria 825
8 Ga0055526_1005633 3300003771 Bacteria 7131
9 Ga0055524_1017674 3300003775 Bacteria 2508
10 Ga0055536_1102928 3300003781 Bacteria 508
11 Ga0055528_1001657 3300003790 Bacteria 13057
12 Ga0055543_1000908 3300004625 Bacteria 13881
13 Ga0065165_1013133 3300005262 Bacteria 3313
14 Ga0065165_1024045 3300005262 Bacteria 2055
15 Ga0065165_1037416 3300005262 Bacteria 1471
16 Ga0070690_101761608 3300005330 Bacteria 504
17 Ga0070670_100007564 3300005331 Bacteria 9221
18 Ga0070671_100963163 3300005355 Bacteria 747
19 Ga0070709_10050915 3300005434 Bacteria 2597
20 Ga0070711_101415441 3300005439 Bacteria 605
21 Ga0070698_100144624 3300005471 Bacteria 2328
22 Ga0070699_101828527 3300005518 Bacteria 556
23 Ga0070679_101000499 3300005530 Unclassified 780
24 Ga0068853_100006519 3300005539 Bacteria 9289
25 Ga0068856_100977213 3300005614 Bacteria 865
26 Ga0068863_100183713 3300005841 Bacteria 2008
27 Ga0081538_10069405 3300005981 Bacteria 1952
28 Ga0081540_1119903 3300005983 Bacteria 1094
29 Ga0081539_10316357 3300005985 Bacteria 665
30 Ga0075368_10117888 3300006042 Bacteria 1098
31 Ga0075363_100159288 3300006048 Bacteria 1277
32 Ga0075363_100455995 3300006048 Bacteria 756
33 Ga0075364_10063628 3300006051 Bacteria 2422
34 Ga0070716_100768948 3300006173 Bacteria 743
35 Ga0070712_100911290 3300006175 Bacteria 758
36 Ga0075362_10096682 3300006177 Bacteria 1377
37 Ga0075367_10126862 3300006178 Bacteria 1575
38 Ga0097621_101147612 3300006237 Bacteria 731
39 Ga0075370_10174149 3300006353 Bacteria 1265
40 Ga0068871_100729266 3300006358 Bacteria 910
41 Ga0105245_11384122 3300009098 Bacteria 753
42 Ga0105241_10266229 3300009174 Bacteria 1458
43 Ga0105241_12588960 3300009174 Bacteria 509
44 Ga0105242_10639744 3300009176 Bacteria 1033
45 Ga0105248_10126540 3300009177 Bacteria 2882
46 Ga0105248_11525916 3300009177 Bacteria 756
47 Ga0105237_10042793 3300009545 Bacteria 4565
48 Ga0105237_10560473 3300009545 Bacteria 1149
49 Ga0105237_11884962 3300009545 Unclassified 606
50 Ga0105238_10148191 3300009551 Bacteria 2323
51 Ga0099796_10135065 3300010159 Bacteria 960
52 Ga0105239_10341691 3300010375 Bacteria 1689
53 Ga0105239_11979640 3300010375 Bacteria 676
54 Ga0157346_1027562 3300012480 Bacteria 535
55 Ga0157371_10003248 3300013102 Bacteria 14909
56 Ga0157369_10105251 3300013105 Bacteria 3004
57 Ga0157369_11312790 3300013105 Bacteria 737
58 Ga0163162_11781023 3300013306 Bacteria 704
59 Ga0163163_10662227 3300014325 Bacteria 1107
60 Ga0157379_10038798 3300014968 Bacteria 4249
61 Ga0157376_10778408 3300014969 Bacteria 968
62 Ga0182005_1022716 3300015265 Bacteria 1718
63 Ga0163161_11214222 3300017792 Bacteria 652
64 Ga0213872_10043247 3300021361 Bacteria 2053
65 Ga0213874_10035630 3300021377 Bacteria 1463
66 Ga0213874_10071887 3300021377 Bacteria 1105
67 Ga0213875_10052201 3300021388 Bacteria 1915
68 Ga0213871_10267822 3300021441 Unclassified 546
69 Ga0209129_1000524 3300025258 Bacteria 26835
70 Ga0209673_1000010 3300025273 Bacteria 596656
71 Ga0209676_1051838 3300025292 Bacteria 1074
72 Ga0209025_1001781 3300025294 Bacteria 25621
73 Ga0209025_1011122 3300025294 Bacteria 5990
74 Ga0209025_1054832 3300025294 Bacteria 1547
75 Ga0209758_1016664 3300025297 Bacteria 3715
76 Ga0209758_1130095 3300025297 Bacteria 667
77 Ga0209256_1002424 3300025299 Bacteria 15263
78 Ga0207426_1000221 3300025302 Bacteria 134756
79 Ga0207693_10871104 3300025915 Bacteria 692
80 Ga0207694_10058485 3300025924 Bacteria 2998
81 Ga0207650_10044408 3300025925 Bacteria 3266
82 Ga0207686_10932939 3300025934 Bacteria 702
83 Ga0207669_11762645 3300025937 Bacteria 529
84 Ga0207711_10334499 3300025941 Bacteria 1401
85 Ga0207639_10004580 3300026041 Bacteria 9303
86 Ga0207639_11033675 3300026041 Bacteria 770
87 Ga0207683_10583708 3300026121 Bacteria 1034
88 Ga0209179_1011608 3300027512 Bacteria 1564
89 Ga0209813_10066196 3300027866 Bacteria 1165
90 Ga0307517_10218489 3300028786 Bacteria 1162
91 Ga0307513_10119373 3300031456 Bacteria 2609
92 Ga0307513_10332082 3300031456 Bacteria 1274
93 Ga0307513_11026851 3300031456 Unclassified 535
94 Ga0307509_10110756 3300031507 Bacteria 2750
95 Ga0307508_10019400 3300031616 Bacteria 6181
96 Ga0307516_10135812 3300031730 Bacteria 2234
97 Ga0307507_10084267 3300033179 Bacteria 2772
98 Ga0373944_0354377 3300035089 Bacteria 559
99 Ga0373923_0005341 3300035111 Bacteria 4361
100 Ga0373936_0066675 3300035113 Bacteria 1478
101 Ga0373957_0062969 3300035120 Bacteria 1440
102 Ga0373946_0772207 3300035171 Bacteria 505
103 Ga0373931_0557912 3300035691 Unclassified 745
104 Ga0373935_0077574 3300035692 Bacteria 2153
105 Ga0373935_0176196 3300035692 Bacteria 1466
106 Ga0373927_0116496 3300035695 Bacteria 1742
107 Ga0373927_0165488 3300035695 Bacteria 1449
108 Ga0373927_0246930 3300035695 Bacteria 1173
109 Ga0373947_0816095 3300035725 Unclassified 637
110 Ga0373937_0147556 3300036401 Bacteria 2202
111 Ga0373925_0506561 3300037068 Bacteria 991
112 Ga0395899_0033298 3300037312 Bacteria 3870
113 Ga0395899_0246958 3300037312 Bacteria 1226
114 Ga0395899_0298539 3300037312 Bacteria 1091
115 Ga0395900_0000982 3300037418 Bacteria 37090
116 Ga0395898_0002984 3300037466 Bacteria 19218
117 Ga0395898_0173472 3300037466 Bacteria 2061
118 Ga0395905_0208312 3300037471 Bacteria 1832
119 Ga0395905_0410025 3300037471 Bacteria 1250
120 Ga0436364_0914623 3300037853 Unclassified 785
121 Ga0436364_1139869 3300037853 Bacteria 2460
122 Ga0395901_0224576 3300038443 Bacteria 1962
123 Ga0395901_0375173 3300038443 Bacteria 1465
124 Ga0395901_0446172 3300038443 Bacteria 1324
125 Ga0436365_1500271 3300039437 Bacteria 520
126 Ga0436361_0939016 3300039447 Bacteria 1577
127 Ga0436361_0964350 3300039447 Bacteria 3819
128 Ga0436363_0839613 3300039450 Bacteria 2967
129 Ga0436363_1469258 3300039450 Bacteria 1230
130 Ga0436363_1694062 3300039450 Bacteria 1633
131 Ga0436362_0122107 3300039453 Bacteria 530
132 Ga0439465_0085778 3300041413 Bacteria 1072
133 Ga0451795_1630010 3300041456 Bacteria 1299
134 Ga0451807_0151118 3300041486 Bacteria 505
135 Ga0451807_2333728 3300041486 Bacteria 652
136 Ga0451835_1074063 3300041492 Bacteria 657
137 Ga0451841_1110234 3300041498 Bacteria 767
138 Ga0451853_2113306 3300041512 Bacteria 780
139 Ga0453684_0002001 3300044712 Bacteria 52193
140 Ga0495592_0060877 3300046454 Bacteria 2776
141 Ga0495580_0538506 3300046472 Bacteria 776
142 Ga0495582_0020910 3300046473 Bacteria 3584
143 Ga0495664_0013448 3300046477 Bacteria 4641
144 Ga0495664_0029909 3300046477 Bacteria 3188
145 Ga0495664_0412785 3300046477 Bacteria 810
146 Ga0495596_0116394 3300046500 Bacteria 1038
147 Ga0495618_0795946 3300046514 Bacteria 551
148 Ga0495628_0476198 3300046516 Bacteria 904
149 Ga0495631_0121363 3300046518 Bacteria 1124
150 Ga0495665_0017120 3300046531 Bacteria 3899
151 Ga0495586_0152320 3300046535 Bacteria 1301
152 Ga0495645_0027495 3300046543 Bacteria 4133
153 Ga0495622_0348932 3300046557 Bacteria 641
154 Ga0495634_0078714 3300046642 Bacteria 2159
155 Ga0495588_0618277 3300046674 Bacteria 567
156 Ga0495599_0126210 3300046678 Bacteria 1590
157 Ga0495599_0273563 3300046678 Bacteria 1024
158 Ga0495647_0199145 3300046681 Bacteria 878
159 Ga0495624_0168870 3300046690 Unclassified 1335
160 Ga0495581_0129016 3300047315 Bacteria 1473
161 Ga0495604_0216852 3300047317 Bacteria 1320
162 Ga0495674_0561413 3300047319 Bacteria 908
163 Ga0495676_0125886 3300047321 Bacteria 1857
164 Ga0495684_0563434 3300047471 Bacteria 774
165 Ga0495593_0041799 3300047673 Bacteria 2463
166 Ga0496100_1035651 3300048903 Bacteria 646
167 Ga0496101_0577234 3300048904 Bacteria 889
168 Ga0496104_0991015 3300048907 Bacteria 744
169 Ga0496105_0285929 3300048908 Bacteria 1328
170 Ga0496106_0001214 3300048909 Bacteria 19272
171 Ga0496107_0281242 3300048910 Bacteria 1238
172 Ga0496108_1201959 3300048911 Bacteria 641
173 Ga0496110_0753103 3300048913 Bacteria 877
174 Ga0496112_0000004 3300048915 Bacteria 553294
175 Ga0496113_0794701 3300048916 Unclassified 752
176 Ga0496116_0217756 3300048919 Bacteria 982
177 Ga0496117_0012325 3300048920 Bacteria 7552
178 Ga0496117_0132839 3300048920 Bacteria 1505
179 Ga0496118_0003893 3300048921 Bacteria 18317
180 Ga0496118_0008358 3300048921 Bacteria 10712
181 Ga0496119_0000729 3300048922 Bacteria 44289
182 Ga0496119_0421342 3300048922 Bacteria 634
183 Ga0496121_0000370 3300048924 Bacteria 92397
184 Ga0496121_0053306 3300048924 Bacteria 3389
185 Ga0496121_0066015 3300048924 Bacteria 2940
186 Ga0496121_0318400 3300048924 Bacteria 1048
187 Ga0496122_0120098 3300048925 Bacteria 1697
188 Ga0496122_0120417 3300048925 Bacteria 1694
189 Ga0496123_0216149 3300048926 Bacteria 970
190 Ga0496123_0265061 3300048926 Bacteria 839
191 Ga0496124_0000235 3300048927 Bacteria 107983
192 Ga0496124_0320098 3300048927 Bacteria 1111
193 Ga0496124_0876503 3300048927 Bacteria 547
194 Ga0496125_0210987 3300048928 Bacteria 1261
195 Ga0496125_0360810 3300048928 Bacteria 864
196 Ga0496126_0006160 3300048929 Bacteria 13429
197 Ga0496126_0205340 3300048929 Bacteria 1661
198 Ga0501031_0787424 3300049568 Bacteria 610
199 Ga0501033_0018805 3300049570 Bacteria 5223
200 Ga0501034_0020168 3300049571 Bacteria 6806
201 Ga0501034_0984629 3300049571 Bacteria 728
202 Ga0501036_0223238 3300049572 Bacteria 1582
203 Ga0501039_0420419 3300049575 Bacteria 1050
204 Ga0501041_0641953 3300049577 Bacteria 678
205 Ga0501047_0264298 3300049581 Bacteria 1568
206 Ga0501047_0664532 3300049581 Unclassified 861
207 Ga0501048_1208126 3300049582 Unclassified 544
208 Ga0501070_0614092 3300049586 Bacteria 866
209 Ga0501074_0893165 3300049590 Bacteria 625
210 Ga0501076_0158588 3300049592 Bacteria 1843
211 Ga0501076_0208306 3300049592 Bacteria 1597
212 Ga0501077_0364482 3300049593 Bacteria 923
213 Ga0501079_0556645 3300049741 Bacteria 902
214 Ga0501080_1584890 3300049742 Unclassified 555
215 Ga0501035_1025834 3300049822 Bacteria 648
216 Ga0501044_0068185 3300049823 Bacteria 3624
217 Ga0501045_0315204 3300049824 Bacteria 1164
218 nmdc:mga03683_129510_c1 3300050489 Bacteria 1128
219 nmdc:mga00v17_78567_c1 3300050491 Bacteria 2056
220 nmdc:mga0k408_239407_c1 3300050493 Bacteria 1083
221 nmdc:mga04h51_81259_c1 3300050495 Bacteria 1151
222 nmdc:mga07m45_127378_c1 3300050496 Bacteria 1473
223 Ga0495612_0223391 3300053078 Bacteria 834
224 Ga0495612_0426512 3300053078 Unclassified 604
225 Ga0500635_0022453 3300053080 Bacteria 1956
226 Ga0495619_0079056 3300053085 Bacteria 2212
227 Ga0500643_000079 3300053087 Bacteria 104107
228 Ga0500644_0007778 3300053088 Bacteria 2803
229 Ga0500646_0041553 3300053090 Bacteria 1296
230 Ga0500583_0255974 3300053092 Bacteria 863
231 Ga0500650_0148594 3300053098 Bacteria 1084
232 Ga0500555_010388 3300053103 Bacteria 2669
233 Ga0500595_028276 3300053119 Bacteria 1913
234 Ga0500608_123738 3300053122 Bacteria 1169
235 Ga0500642_0005059 3300053130 Bacteria 4210
236 Ga0500652_043927 3300053131 Bacteria 1808
237 Ga0500652_099314 3300053131 Bacteria 1217
238 Ga0500658_0047533 3300053134 Bacteria 1742
239 Ga0500568_0008691 3300053139 Bacteria 4874
240 Ga0500573_0014952 3300053140 Bacteria 4393
241 Ga0500573_0213105 3300053140 Bacteria 1018
242 Ga0500577_0020051 3300053142 Bacteria 2180
243 Ga0500577_0088916 3300053142 Bacteria 1245
244 Ga0500588_0021528 3300053146 Bacteria 1742
245 Ga0500589_101058 3300053147 Bacteria 1252
246 Ga0500590_256244 3300053148 Bacteria 691
247 Ga0500603_201391 3300053150 Bacteria 631
248 Ga0500604_0120157 3300053151 Bacteria 878
249 Ga0500622_0000362 3300053156 Bacteria 43878
250 Ga0500627_0077761 3300053158 Bacteria 1476
251 Ga0500634_0095875 3300053161 Bacteria 1495
252 Ga0500636_0040486 3300053177 Bacteria 2755
253 Ga0500611_232480 3300053727 Bacteria 528
254 Ga0500645_139282 3300053730 Bacteria 672
255 Ga0500552_083046 3300053733 Bacteria 590
256 Ga0587069_038727 3300059642 Bacteria 805
257 Ga0530510_0117681 3300061734 Bacteria 1949
258 2513567995 2513237084 Bacteria 7231967
259 2520377212 2519899620 Bacteria 6499161
260 2643856739 2643221568 Bacteria 5187270
261 2644131586 2643221623 Bacteria 5239945
262 2694629336 2693429783 Bacteria 7019804
263 2694635432 2693429784 Bacteria 7241525
264 2738744006 2738541281 Bacteria 5112672
265 2739306058 2738543024 Bacteria 5603683
266 2739353236 2738543032 Bacteria 5115625
267 2793329561 2791355261 Bacteria 6661293
268 2793339187 2791355263 Bacteria 6872478
269 2838027525 2838022645 Bacteria 6494267
270 2838043947 2838042994 Bacteria 6046894
271 2842203535 2842198810 Bacteria 6608673
272 2842511151 2842509118 Bacteria 6850950
273 2888391236 2888388044 Bacteria 7304136
274 2919169274 2919166419 Bacteria 4952238
275 2978974651 2978969890 Bacteria 5400756
276 2984589972 2984587000 Bacteria 5263363
277 8005385207 8005382845 Bacteria 6732062
278 8006928065 8006926726 Bacteria 6749210
279 8054461165 8054460903 Bacteria 4872905
280 Ga0501031_0773711
281 JGI24742J22300_10080823
282 JGI25152J39213_1002910
283 JGI25151J46595_10001793
284 rootH1_10234024
285 JGI25160J50197_1003347
286 JGI25161J50226_1015619
287 Ga0055526_1005633
288 Ga0055524_1017674
289 Ga0055536_1102928
290 Ga0055528_1001657
291 Ga0055543_1000908
292 Ga0065165_1013133
293 Ga0065165_1024045
294 Ga0065165_1037416
295 Ga0070690_101761608
296 Ga0070670_100007564
297 Ga0070671_100963163
298 Ga0070709_10050915
299 Ga0070711_101415441
300 Ga0070698_100144624
301 Ga0070699_101828527
302 Ga0070679_101000499
303 Ga0068853_100006519
304 Ga0068856_100977213
305 Ga0068863_100183713
306 Ga0081538_10069405
307 Ga0081540_1119903
308 Ga0081539_10316357
309 Ga0075368_10117888
310 Ga0075363_100159288
311 Ga0075363_100455995
312 Ga0075364_10063628
313 Ga0070716_100768948
314 Ga0070712_100911290
315 Ga0075362_10096682
316 Ga0075367_10126862
317 Ga0097621_101147612
318 Ga0075370_10174149
319 Ga0068871_100729266
320 Ga0105245_11384122
321 Ga0105241_10266229
322 Ga0105241_12588960
323 Ga0105242_10639744
324 Ga0105248_10126540
325 Ga0105248_11525916
326 Ga0105237_10042793
327 Ga0105237_10560473
328 Ga0105237_11884962
329 Ga0105238_10148191
330 Ga0099796_10135065
331 Ga0105239_10341691
332 Ga0105239_11979640
333 Ga0157346_1027562
334 Ga0157371_10003248
335 Ga0157369_10105251
336 Ga0157369_11312790
337 Ga0163162_11781023
338 Ga0163163_10662227
339 Ga0157379_10038798
340 Ga0157376_10778408
341 Ga0182005_1022716
342 Ga0163161_11214222
343 Ga0213872_10043247
344 Ga0213874_10035630
345 Ga0213874_10071887
346 Ga0213875_10052201
347 Ga0213871_10267822
348 Ga0209129_1000524
349 Ga0209673_1000010
350 Ga0209676_1051838
351 Ga0209025_1001781
352 Ga0209025_1011122
353 Ga0209025_1054832
354 Ga0209758_1016664
355 Ga0209758_1130095
356 Ga0209256_1002424
357 Ga0207426_1000221
358 Ga0207693_10871104
359 Ga0207694_10058485
360 Ga0207650_10044408
361 Ga0207686_10932939
362 Ga0207669_11762645
363 Ga0207711_10334499
364 Ga0207639_10004580
365 Ga0207639_11033675
366 Ga0207683_10583708
367 Ga0209179_1011608
368 Ga0209813_10066196
369 Ga0307517_10218489
370 Ga0307513_10119373
371 Ga0307513_10332082
372 Ga0307513_11026851
373 Ga0307509_10110756
374 Ga0307508_10019400
375 Ga0307516_10135812
376 Ga0307507_10084267
377 Ga0373944_0354377
378 Ga0373923_0005341
379 Ga0373936_0066675
380 Ga0373957_0062969
381 Ga0373946_0772207
382 Ga0373931_0557912
383 Ga0373935_0077574
384 Ga0373935_0176196
385 Ga0373927_0116496
386 Ga0373927_0165488
387 Ga0373927_0246930
388 Ga0373947_0816095
389 Ga0373937_0147556
390 Ga0373925_0506561
391 Ga0395899_0033298
392 Ga0395899_0246958
393 Ga0395899_0298539
394 Ga0395900_0000982
395 Ga0395898_0002984
396 Ga0395898_0173472
397 Ga0395905_0208312
398 Ga0395905_0410025
399 Ga0436364_0914623
400 Ga0436364_1139869
401 Ga0395901_0224576
402 Ga0395901_0375173
403 Ga0395901_0446172
404 Ga0436365_1500271
405 Ga0436361_0939016
406 Ga0436361_0964350
407 Ga0436363_0839613
408 Ga0436363_1469258
409 Ga0436363_1694062
410 Ga0436362_0122107
411 Ga0439465_0085778
412 Ga0451795_1630010
413 Ga0451807_0151118
414 Ga0451807_2333728
415 Ga0451835_1074063
416 Ga0451841_1110234
417 Ga0451853_2113306
418 Ga0453684_0002001
419 Ga0495592_0060877
420 Ga0495580_0538506
421 Ga0495582_0020910
422 Ga0495664_0013448
423 Ga0495664_0029909
424 Ga0495664_0412785
425 Ga0495596_0116394
426 Ga0495618_0795946
427 Ga0495628_0476198
428 Ga0495631_0121363
429 Ga0495665_0017120
430 Ga0495586_0152320
431 Ga0495645_0027495
432 Ga0495622_0348932
433 Ga0495634_0078714
434 Ga0495588_0618277
435 Ga0495599_0126210
436 Ga0495599_0273563
437 Ga0495647_0199145
438 Ga0495624_0168870
439 Ga0495581_0129016
440 Ga0495604_0216852
441 Ga0495674_0561413
442 Ga0495676_0125886
443 Ga0495684_0563434
444 Ga0495593_0041799
445 Ga0496100_1035651
446 Ga0496101_0577234
447 Ga0496104_0991015
448 Ga0496105_0285929
449 Ga0496106_0001214
450 Ga0496107_0281242
451 Ga0496108_1201959
452 Ga0496110_0753103
453 Ga0496112_0000004
454 Ga0496113_0794701
455 Ga0496116_0217756
456 Ga0496117_0012325
457 Ga0496117_0132839
458 Ga0496118_0003893
459 Ga0496118_0008358
460 Ga0496119_0000729
461 Ga0496119_0421342
462 Ga0496121_0000370
463 Ga0496121_0053306
464 Ga0496121_0066015
465 Ga0496121_0318400
466 Ga0496122_0120098
467 Ga0496122_0120417
468 Ga0496123_0216149
469 Ga0496123_0265061
470 Ga0496124_0000235
471 Ga0496124_0320098
472 Ga0496124_0876503
473 Ga0496125_0210987
474 Ga0496125_0360810
475 Ga0496126_0006160
476 Ga0496126_0205340
477 Ga0501031_0787424
478 Ga0501033_0018805
479 Ga0501034_0020168
480 Ga0501034_0984629
481 Ga0501036_0223238
482 Ga0501039_0420419
483 Ga0501041_0641953
484 Ga0501047_0264298
485 Ga0501047_0664532
486 Ga0501048_1208126
487 Ga0501070_0614092
488 Ga0501074_0893165
489 Ga0501076_0158588
490 Ga0501076_0208306
491 Ga0501077_0364482
492 Ga0501079_0556645
493 Ga0501080_1584890
494 Ga0501035_1025834
495 Ga0501044_0068185
496 Ga0501045_0315204
497 nmdc:mga03683_129510_c1
498 nmdc:mga00v17_78567_c1
499 nmdc:mga0k408_239407_c1
500 nmdc:mga04h51_81259_c1
501 nmdc:mga07m45_127378_c1
502 Ga0495612_0223391
503 Ga0495612_0426512
504 Ga0500635_0022453
505 Ga0495619_0079056
506 Ga0500643_000079
507 Ga0500644_0007778
508 Ga0500646_0041553
509 Ga0500583_0255974
510 Ga0500650_0148594
511 Ga0500555_010388
512 Ga0500595_028276
513 Ga0500608_123738
514 Ga0500642_0005059
515 Ga0500652_043927
516 Ga0500652_099314
517 Ga0500658_0047533
518 Ga0500568_0008691
519 Ga0500573_0014952
520 Ga0500573_0213105
521 Ga0500577_0020051
522 Ga0500577_0088916
523 Ga0500588_0021528
524 Ga0500589_101058
525 Ga0500590_256244
526 Ga0500603_201391
527 Ga0500604_0120157
528 Ga0500622_0000362
529 Ga0500627_0077761
530 Ga0500634_0095875
531 Ga0500636_0040486
532 Ga0500611_232480
533 Ga0500645_139282
534 Ga0500552_083046
535 Ga0587069_038727
536 Ga0530510_0117681
537 2513567995
538 2520377212
539 2643856739
540 2644131586
541 2694629336
542 2694635432
543 2738744006
544 2739306058
545 2739353236
546 2793329561
547 2793339187
548 2838027525
549 2838043947
550 2842203535
551 2842511151
552 2888391236
553 2919169274
554 2978974651
555 2984589972
556 8005385207
557 8006928065
558 8054461165

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09907

HigB_toxin

HigB_toxin, RelE-like toxic component of a toxin-antitoxin system

19

92

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kmq-assembly1.cif.gz_A 2.3 angstrom resolution structure of dimeric higba toxin-antitoxin complex from e. coli 0.9118 1 87
6kml-assembly1.cif.gz_A 2.09 angstrom resolution crystal structure of tetrameric higba toxin-antitoxin complex from e.coli 0.9059 1 91
5ifg-assembly1.cif.gz_C crystal structure of higa-higb complex from e. coli 0.8964 1 91
5ycl-assembly1.cif.gz_D crystal structure of higba complex from shigella flexneri 0.8843 1 91
6kmq-assembly1.cif.gz_A 2.3 angstrom resolution structure of dimeric higba toxin-antitoxin complex from e. coli 0.8656 1 87
ID Description Score Start End Superfamily
af_O13856_4_201_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9264 49 86 2.130.10.10
af_P64578_19_94_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9087 20 91 3.30.2310.20
af_Q9NAQ2_39_458_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.876 55 86 2.130.10.10
af_A0A1D8PQF7_20_323_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8608 49 86 2.130.10.10
af_P64578_19_94_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8539 20 91 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A2A6JH76-F1-model_v4 Addiction module toxin RelE 1.001 1 98 GO:0003723
GO:0004519
GO:0110001
AF-A0A4R2XC90-F1-model_v4 deleted 1.001 1 98
AF-A0A142BPI9-F1-model_v4 Type II toxin-antitoxin system HigB family toxin 0.9997 1 98 GO:0003723
GO:0004519
GO:0110001
AF-A0A5R9J0L1-F1-model_v4 Type II toxin-antitoxin system HigB family toxin 0.9997 1 98 GO:0003723
GO:0004519
GO:0110001
AF-A0A1I4Z7J7-F1-model_v4 mRNA interferase HigB 0.9996 22 98 GO:0003723
GO:0004519
GO:0110001

Map