F383077

General Info

Members Datasets Scaffolds Average Seq Length
279 173 558 319

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10095189|Ga0157380_100951892
Length 359
Sequence VLDAVDDHESIGVVDLVAGAVHAASGFDPRSRGQASVISVSEMAEGESRDGVPLTNLDQPLFDGANATKRDLVDYLDAVSDRILPVLRDRPLSVIRVHRGQEAFMQKNVPKYTPDWVQTVALWADASKREVSYALCNDRRTLLWFANQRAIEYHPPLARMGHPDQATHLVLDLDPPQGSPFGTVVQVAHLVRQALADVGLAGAVKTSGSKGVHVFVPVDGAALDDAAAATRAIAARVEQLDPSIATTAFVKDERDGKVFVDSTRVGGATVVAAYSPRVRPGVPVSFPIGWDRLDEITPTDFTIHSALDALGDADPWADQMPTPQRLDDDLIAEGHAIPVARVQAMHEGKRRARAKRSTP

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
66 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
67 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
68 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
89 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
106 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
107 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
108 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
165 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
166 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
167 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
168 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
169 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
170 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
171 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
172 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
173 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.77
Metatranscriptomes 0
Isolates 3.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.24
Nodule 0
Rhizoplane 6.09
Rhizosphere 81.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10095189 3300014326 Bacteria 2466
2 JGI25406J46586_10004555 3300003203 Bacteria 6451
3 rootH1_10017596 3300003316 Bacteria 5660
4 rootL2_10099083 3300003322 Bacteria 5581
5 Ga0068868_100271629 3300005338 Bacteria 1432
6 Ga0070661_100378783 3300005344 Bacteria 1115
7 Ga0070674_100069086 3300005356 Bacteria 2491
8 Ga0070673_100099632 3300005364 Bacteria 2391
9 Ga0070688_100245397 3300005365 Bacteria 1273
10 Ga0070714_100000007 3300005435 Bacteria 285654
11 Ga0070714_100001385 3300005435 Bacteria 17558
12 Ga0070708_100227876 3300005445 Bacteria 1748
13 Ga0070706_100001753 3300005467 Bacteria 22514
14 Ga0070706_100173447 3300005467 Bacteria 2013
15 Ga0070707_100015763 3300005468 Bacteria 7093
16 Ga0070707_100039302 3300005468 Bacteria 4521
17 Ga0070707_100121156 3300005468 Bacteria 2540
18 Ga0070707_100372295 3300005468 Bacteria 1388
19 Ga0070698_100028450 3300005471 Bacteria 5805
20 Ga0070699_100385284 3300005518 Bacteria 1266
21 Ga0068857_100043312 3300005577 Bacteria 3993
22 Ga0068860_100017309 3300005843 Bacteria 7023
23 Ga0068862_100309730 3300005844 Bacteria 1455
24 Ga0081455_10002332 3300005937 Bacteria 22646
25 Ga0081455_10006010 3300005937 Bacteria 13156
26 Ga0081455_10066629 3300005937 Bacteria 3006
27 Ga0081455_10241208 3300005937 Bacteria 1328
28 Ga0081539_10000031 3300005985 Bacteria 313232
29 Ga0081539_10000125 3300005985 Bacteria 180646
30 Ga0081539_10031395 3300005985 Bacteria 3274
31 Ga0070717_10003312 3300006028 Bacteria 11512
32 Ga0070717_10033612 3300006028 Bacteria 4138
33 Ga0070717_10112099 3300006028 Bacteria 2328
34 Ga0075365_10003102 3300006038 Bacteria 8450
35 Ga0075365_10017383 3300006038 Bacteria 4399
36 Ga0075365_10199376 3300006038 Bacteria 1402
37 Ga0075363_100000558 3300006048 Bacteria 12153
38 Ga0075364_10005347 3300006051 Bacteria 7456
39 Ga0075364_10014227 3300006051 Bacteria 4913
40 Ga0075362_10084256 3300006177 Bacteria 1468
41 Ga0075367_10013908 3300006178 Bacteria 4342
42 Ga0075367_10036436 3300006178 Bacteria 2853
43 Ga0075369_10064444 3300006186 Bacteria 1604
44 Ga0075370_10002132 3300006353 Bacteria 9040
45 Ga0075370_10005262 3300006353 Bacteria 6406
46 Ga0075428_100001321 3300006844 Bacteria 26248
47 Ga0075428_100025671 3300006844 Bacteria 6524
48 Ga0075428_100036244 3300006844 Bacteria 5434
49 Ga0075428_100054502 3300006844 Bacteria 4382
50 Ga0075430_100003138 3300006846 Bacteria 13823
51 Ga0075430_100005666 3300006846 Bacteria 10543
52 Ga0075430_100010370 3300006846 Bacteria 7890
53 Ga0075431_100000794 3300006847 Bacteria 27545
54 Ga0075431_100022053 3300006847 Bacteria 6512
55 Ga0075431_100070315 3300006847 Bacteria 3611
56 Ga0075434_100106248 3300006871 Bacteria 2817
57 Ga0075429_100000722 3300006880 Bacteria 25876
58 Ga0075429_100012865 3300006880 Bacteria 7259
59 Ga0075436_100052994 3300006914 Bacteria 2800
60 Ga0111539_10015943 3300009094 Bacteria 9336
61 Ga0111539_10225418 3300009094 Bacteria 2183
62 Ga0105245_10009819 3300009098 Bacteria 8341
63 Ga0114129_10001368 3300009147 Bacteria 32779
64 Ga0114129_10004277 3300009147 Bacteria 20169
65 Ga0114129_10030361 3300009147 Bacteria 7649
66 Ga0114129_10113919 3300009147 Bacteria 3729
67 Ga0114129_10217516 3300009147 Bacteria 2579
68 Ga0105242_10022671 3300009176 Bacteria 4943
69 Ga0105248_10796924 3300009177 Bacteria 1066
70 Ga0105249_10168103 3300009553 Bacteria 2124
71 Ga0105028_105258 3300009993 Bacteria 1344
72 Ga0105239_10231060 3300010375 Bacteria 2075
73 Ga0105246_10101014 3300011119 Bacteria 2100
74 Ga0163163_10220796 3300014325 Bacteria 1944
75 Ga0157380_10068502 3300014326 Bacteria 2860
76 Ga0157380_10605087 3300014326 Bacteria 1085
77 Ga0163161_10023139 3300017792 Bacteria 4379
78 Ga0163161_10027157 3300017792 Bacteria 4060
79 Ga0207647_10119147 3300025904 Bacteria 1557
80 Ga0207684_10002850 3300025910 Bacteria 17173
81 Ga0207684_10408887 3300025910 Bacteria 1166
82 Ga0207646_10015921 3300025922 Bacteria 7071
83 Ga0207646_10030706 3300025922 Bacteria 4869
84 Ga0207646_10155620 3300025922 Bacteria 2062
85 Ga0207646_10166415 3300025922 Bacteria 1990
86 Ga0207646_10501622 3300025922 Bacteria 1093
87 Ga0207650_10275413 3300025925 Bacteria 1369
88 Ga0207700_10009316 3300025928 Bacteria 6128
89 Ga0207700_10130224 3300025928 Bacteria 2053
90 Ga0207664_10000448 3300025929 Bacteria 29275
91 Ga0207664_10134011 3300025929 Bacteria 2088
92 Ga0207664_10399838 3300025929 Bacteria 1222
93 Ga0207709_10372833 3300025935 Bacteria 1084
94 Ga0207711_10290338 3300025941 Bacteria 1507
95 Ga0207658_10071853 3300025986 Bacteria 2622
96 Ga0207703_10379730 3300026035 Bacteria 1307
97 Ga0207708_10459040 3300026075 Bacteria 1062
98 Ga0207674_10063339 3300026116 Bacteria 3732
99 Ga0207675_100030227 3300026118 Bacteria 5045
100 Ga0268265_10029127 3300028380 Bacteria 3961
101 Ga0268264_10010062 3300028381 Bacteria 7828
102 Ga0307515_10118181 3300028794 Bacteria 3028
103 Ga0265338_10006674 3300028800 Bacteria 14589
104 Ga0307512_10018232 3300030522 Bacteria 6415
105 Ga0265325_10013001 3300031241 Bacteria 4747
106 Ga0265339_10009401 3300031249 Bacteria 6146
107 Ga0307513_10059443 3300031456 Bacteria 4057
108 Ga0265313_10007346 3300031595 Bacteria 7552
109 Ga0307508_10000180 3300031616 Bacteria 76716
110 Ga0307508_10258343 3300031616 Bacteria 1337
111 Ga0307405_10000829 3300031731 Bacteria 12161
112 Ga0307413_10000111 3300031824 Bacteria 20707
113 Ga0307413_10007984 3300031824 Bacteria 4960
114 Ga0307413_10014980 3300031824 Bacteria 3960
115 Ga0307518_10009264 3300031838 Bacteria 7028
116 Ga0307410_10139272 3300031852 Bacteria 1793
117 Ga0307406_10029449 3300031901 Bacteria 3325
118 Ga0307407_10177739 3300031903 Bacteria 1408
119 Ga0307409_100211545 3300031995 Bacteria 1743
120 Ga0307416_100014041 3300032002 Bacteria 5467
121 Ga0307414_10006133 3300032004 Bacteria 6677
122 Ga0307414_10191076 3300032004 Bacteria 1657
123 Ga0307411_10000179 3300032005 Bacteria 20135
124 Ga0307411_10001431 3300032005 Bacteria 9742
125 Ga0307411_10141846 3300032005 Bacteria 1773
126 Ga0307411_10157630 3300032005 Bacteria 1695
127 Ga0307415_100012664 3300032126 Bacteria 4886
128 Ga0373943_0028471 3300035170 Bacteria 2633
129 Ga0373961_0008994 3300035241 Bacteria 2437
130 Ga0373931_0107230 3300035691 Bacteria 1580
131 Ga0373937_0313657 3300036401 Bacteria 1484
132 Ga0373925_0008437 3300037068 Bacteria 7504
133 Ga0395900_0201583 3300037418 Bacteria 2013
134 Ga0395898_0032812 3300037466 Bacteria 5185
135 Ga0395901_0004935 3300038443 Bacteria 13465
136 Ga0395901_0664369 3300038443 Bacteria 1044
137 Ga0439465_0066066 3300041413 Bacteria 1205
138 Ga0450920_014632 3300042122 Bacteria 1487
139 Ga0466961_0019923 3300044693 Bacteria 4318
140 Ga0466963_0003630 3300044694 Bacteria 8867
141 Ga0466964_0045891 3300044706 Bacteria 1780
142 Ga0466971_0006713 3300044719 Bacteria 5007
143 Ga0466959_0017974 3300045049 Bacteria 5188
144 Ga0466959_0095525 3300045049 Bacteria 2132
145 Ga0466958_0031402 3300045836 Bacteria 3157
146 Ga0466958_0096064 3300045836 Bacteria 1838
147 Ga0466967_0007749 3300045976 Bacteria 7788
148 Ga0466967_0139766 3300045976 Bacteria 2255
149 Ga0495653_0214060 3300046463 Bacteria 1300
150 Ga0495582_0076562 3300046473 Bacteria 1855
151 Ga0495606_0012733 3300046507 Bacteria 6706
152 Ga0495630_0217932 3300046517 Bacteria 1457
153 Ga0495645_0152600 3300046543 Bacteria 1603
154 Ga0495668_0004729 3300046616 Bacteria 9543
155 Ga0495625_0012871 3300046660 Bacteria 6760
156 Ga0495635_0201385 3300046663 Bacteria 1350
157 Ga0495624_0038071 3300046690 Bacteria 3092
158 Ga0495672_0132817 3300047320 Bacteria 1308
159 Ga0495683_0098573 3300047323 Bacteria 1407
160 Ga0495626_0003985 3300048091 Bacteria 9223
161 Ga0496102_0000911 3300048905 Bacteria 27936
162 Ga0496102_0148831 3300048905 Bacteria 2199
163 Ga0496103_0014813 3300048906 Bacteria 4636
164 Ga0496105_0056017 3300048908 Bacteria 3255
165 Ga0496108_0040741 3300048911 Bacteria 3874
166 Ga0496108_0064068 3300048911 Bacteria 3096
167 Ga0496108_0301372 3300048911 Bacteria 1396
168 Ga0496109_0031116 3300048912 Bacteria 4787
169 Ga0496109_0044645 3300048912 Bacteria 4021
170 Ga0496109_0079621 3300048912 Bacteria 3019
171 Ga0496110_0099000 3300048913 Bacteria 2614
172 Ga0496111_0143455 3300048914 Bacteria 1770
173 Ga0496112_0009174 3300048915 Bacteria 8889
174 Ga0496112_0086951 3300048915 Bacteria 3093
175 Ga0496112_0187959 3300048915 Bacteria 2029
176 Ga0496113_0203766 3300048916 Bacteria 1573
177 Ga0496114_0336822 3300048917 Bacteria 1334
178 Ga0501031_0075788 3300049568 Bacteria 2190
179 Ga0501032_0041134 3300049569 Bacteria 3141
180 Ga0501032_0206330 3300049569 Bacteria 1282
181 Ga0501033_0196779 3300049570 Bacteria 1441
182 Ga0501034_0014299 3300049571 Bacteria 8178
183 Ga0501034_0067998 3300049571 Bacteria 3574
184 Ga0501034_0326296 3300049571 Bacteria 1467
185 Ga0501036_0023664 3300049572 Bacteria 5176
186 Ga0501036_0179518 3300049572 Bacteria 1782
187 Ga0501038_0322686 3300049574 Bacteria 1208
188 Ga0501039_0009984 3300049575 Bacteria 7238
189 Ga0501039_0028265 3300049575 Bacteria 4316
190 Ga0501039_0181954 3300049575 Bacteria 1653
191 Ga0501039_0189154 3300049575 Bacteria 1619
192 Ga0501039_0253215 3300049575 Bacteria 1384
193 Ga0501040_0016279 3300049576 Bacteria 4919
194 Ga0501040_0153047 3300049576 Bacteria 1628
195 Ga0501040_0243039 3300049576 Bacteria 1284
196 Ga0501041_0054602 3300049577 Bacteria 2437
197 Ga0501041_0100030 3300049577 Bacteria 1794
198 Ga0501042_0011270 3300049578 Bacteria 6027
199 Ga0501042_0025986 3300049578 Bacteria 4115
200 Ga0501042_0107145 3300049578 Bacteria 2012
201 Ga0501043_0046641 3300049579 Bacteria 3408
202 Ga0501046_0003350 3300049580 Bacteria 14712
203 Ga0501047_0010630 3300049581 Bacteria 8702
204 Ga0501047_0028117 3300049581 Bacteria 5420
205 Ga0501048_0036721 3300049582 Bacteria 3521
206 Ga0501068_0027871 3300049584 Bacteria 3338
207 Ga0501069_0200440 3300049585 Bacteria 1156
208 Ga0501070_0009325 3300049586 Bacteria 8301
209 Ga0501070_0383288 3300049586 Bacteria 1139
210 Ga0501071_0012589 3300049587 Bacteria 5744
211 Ga0501071_0097941 3300049587 Bacteria 2159
212 Ga0501071_0153095 3300049587 Bacteria 1721
213 Ga0501072_0003125 3300049588 Bacteria 12452
214 Ga0501072_0004487 3300049588 Bacteria 10604
215 Ga0501072_0025326 3300049588 Bacteria 4621
216 Ga0501075_0001643 3300049591 Bacteria 14686
217 Ga0501075_0002689 3300049591 Bacteria 11888
218 Ga0501075_0137120 3300049591 Bacteria 1864
219 Ga0501075_0200629 3300049591 Bacteria 1521
220 Ga0501076_0032254 3300049592 Bacteria 4087
221 Ga0501076_0054885 3300049592 Bacteria 3158
222 Ga0501076_0126052 3300049592 Bacteria 2075
223 Ga0501076_0199024 3300049592 Bacteria 1635
224 Ga0501076_0394225 3300049592 Bacteria 1138
225 Ga0501077_0040003 3300049593 Bacteria 2987
226 Ga0501079_0002072 3300049741 Bacteria 14374
227 Ga0501079_0117528 3300049741 Bacteria 2067
228 Ga0501079_0175509 3300049741 Bacteria 1671
229 Ga0501080_0020669 3300049742 Bacteria 6098
230 Ga0501080_0068400 3300049742 Bacteria 3304
231 Ga0501080_0069781 3300049742 Bacteria 3269
232 Ga0501081_0066576 3300049743 Bacteria 2505
233 Ga0501083_0013609 3300049744 Bacteria 5687
234 Ga0501083_0030691 3300049744 Bacteria 3691
235 Ga0501083_0098676 3300049744 Bacteria 1927
236 Ga0501035_0292074 3300049822 Bacteria 1376
237 Ga0501044_0333482 3300049823 Bacteria 1439
238 Ga0501045_0248241 3300049824 Bacteria 1325
239 nmdc:mga03n38_2149_c1 3300050490 Bacteria 5993
240 nmdc:mga00v17_15434_c1 3300050491 Bacteria 4287
241 nmdc:mga00v17_39243_c1 3300050491 Bacteria 2835
242 nmdc:mga0yw44_3006_c1 3300050492 Bacteria 7367
243 nmdc:mga0yw44_3527_c1 3300050492 Bacteria 6971
244 nmdc:mga06z11_181463_c1 3300050494 Bacteria 1214
245 nmdc:mga06z11_3380_c1 3300050494 Bacteria 6168
246 nmdc:mga07m45_3288_c1 3300050496 Bacteria 7778
247 nmdc:mga07m45_3876_c2 3300050496 Bacteria 5745
248 nmdc:mga05p37_373_c1 3300050507 Bacteria 48181
249 nmdc:mga05p37_65927_c1 3300050507 Bacteria 4455
250 nmdc:mga09592_60689_c1 3300050508 Bacteria 3197
251 nmdc:mga09592_75543_c1 3300050508 Bacteria 2865
252 nmdc:mga09592_826_c1 3300050508 Bacteria 23970
253 nmdc:mga0qj67_41080_c1 3300050509 Bacteria 3637
254 nmdc:mga0qj67_88130_c1 3300050509 Bacteria 2492
255 nmdc:mga06r32_312624_c1 3300050510 Bacteria 1557
256 nmdc:mga06r32_796_c1 3300050510 Bacteria 27911
257 nmdc:mga08y16_72147_c1 3300050511 Bacteria 3598
258 Ga0500635_0000369 3300053080 Bacteria 14229
259 Ga0495619_0017081 3300053085 Bacteria 4600
260 Ga0500604_0030700 3300053151 Bacteria 1573
261 Ga0501084_0000548 3300054114 Bacteria 28624
262 Ga0501084_0033216 3300054114 Bacteria 4316
263 Ga0501084_0035750 3300054114 Bacteria 4152
264 Ga0501084_0052127 3300054114 Bacteria 3424
265 Ga0501082_0190707 3300060353 Bacteria 1783
266 Ga0501082_0509832 3300060353 Bacteria 1051
267 Ga0466962_0049459 3300061719 Bacteria 2009
268 Ga0530510_0009365 3300061734 Bacteria 6867
269 Ga0530510_0042171 3300061734 Bacteria 3296
270 Ga0530510_0055868 3300061734 Bacteria 2852
271 2515857089 2515154155 Bacteria 7985436
272 2731905990 2731639228 Bacteria 4187555
273 2795795794 2795385472 Bacteria 6627535
274 2816503647 2816332139 Bacteria 9138787
275 2867305546 2867302475 Bacteria 7087181
276 2868089466 2868088558 Bacteria 7609351
277 2887480329 2887478801 Bacteria 8972725
278 2899364373 2899359706 Bacteria 10940472
279 8001790162 8001781756 Bacteria 9586736
280 Ga0157380_10095189
281 JGI25406J46586_10004555
282 rootH1_10017596
283 rootL2_10099083
284 Ga0068868_100271629
285 Ga0070661_100378783
286 Ga0070674_100069086
287 Ga0070673_100099632
288 Ga0070688_100245397
289 Ga0070714_100000007
290 Ga0070714_100001385
291 Ga0070708_100227876
292 Ga0070706_100001753
293 Ga0070706_100173447
294 Ga0070707_100015763
295 Ga0070707_100039302
296 Ga0070707_100121156
297 Ga0070707_100372295
298 Ga0070698_100028450
299 Ga0070699_100385284
300 Ga0068857_100043312
301 Ga0068860_100017309
302 Ga0068862_100309730
303 Ga0081455_10002332
304 Ga0081455_10006010
305 Ga0081455_10066629
306 Ga0081455_10241208
307 Ga0081539_10000031
308 Ga0081539_10000125
309 Ga0081539_10031395
310 Ga0070717_10003312
311 Ga0070717_10033612
312 Ga0070717_10112099
313 Ga0075365_10003102
314 Ga0075365_10017383
315 Ga0075365_10199376
316 Ga0075363_100000558
317 Ga0075364_10005347
318 Ga0075364_10014227
319 Ga0075362_10084256
320 Ga0075367_10013908
321 Ga0075367_10036436
322 Ga0075369_10064444
323 Ga0075370_10002132
324 Ga0075370_10005262
325 Ga0075428_100001321
326 Ga0075428_100025671
327 Ga0075428_100036244
328 Ga0075428_100054502
329 Ga0075430_100003138
330 Ga0075430_100005666
331 Ga0075430_100010370
332 Ga0075431_100000794
333 Ga0075431_100022053
334 Ga0075431_100070315
335 Ga0075434_100106248
336 Ga0075429_100000722
337 Ga0075429_100012865
338 Ga0075436_100052994
339 Ga0111539_10015943
340 Ga0111539_10225418
341 Ga0105245_10009819
342 Ga0114129_10001368
343 Ga0114129_10004277
344 Ga0114129_10030361
345 Ga0114129_10113919
346 Ga0114129_10217516
347 Ga0105242_10022671
348 Ga0105248_10796924
349 Ga0105249_10168103
350 Ga0105028_105258
351 Ga0105239_10231060
352 Ga0105246_10101014
353 Ga0163163_10220796
354 Ga0157380_10068502
355 Ga0157380_10605087
356 Ga0163161_10023139
357 Ga0163161_10027157
358 Ga0207647_10119147
359 Ga0207684_10002850
360 Ga0207684_10408887
361 Ga0207646_10015921
362 Ga0207646_10030706
363 Ga0207646_10155620
364 Ga0207646_10166415
365 Ga0207646_10501622
366 Ga0207650_10275413
367 Ga0207700_10009316
368 Ga0207700_10130224
369 Ga0207664_10000448
370 Ga0207664_10134011
371 Ga0207664_10399838
372 Ga0207709_10372833
373 Ga0207711_10290338
374 Ga0207658_10071853
375 Ga0207703_10379730
376 Ga0207708_10459040
377 Ga0207674_10063339
378 Ga0207675_100030227
379 Ga0268265_10029127
380 Ga0268264_10010062
381 Ga0307515_10118181
382 Ga0265338_10006674
383 Ga0307512_10018232
384 Ga0265325_10013001
385 Ga0265339_10009401
386 Ga0307513_10059443
387 Ga0265313_10007346
388 Ga0307508_10000180
389 Ga0307508_10258343
390 Ga0307405_10000829
391 Ga0307413_10000111
392 Ga0307413_10007984
393 Ga0307413_10014980
394 Ga0307518_10009264
395 Ga0307410_10139272
396 Ga0307406_10029449
397 Ga0307407_10177739
398 Ga0307409_100211545
399 Ga0307416_100014041
400 Ga0307414_10006133
401 Ga0307414_10191076
402 Ga0307411_10000179
403 Ga0307411_10001431
404 Ga0307411_10141846
405 Ga0307411_10157630
406 Ga0307415_100012664
407 Ga0373943_0028471
408 Ga0373961_0008994
409 Ga0373931_0107230
410 Ga0373937_0313657
411 Ga0373925_0008437
412 Ga0395900_0201583
413 Ga0395898_0032812
414 Ga0395901_0004935
415 Ga0395901_0664369
416 Ga0439465_0066066
417 Ga0450920_014632
418 Ga0466961_0019923
419 Ga0466963_0003630
420 Ga0466964_0045891
421 Ga0466971_0006713
422 Ga0466959_0017974
423 Ga0466959_0095525
424 Ga0466958_0031402
425 Ga0466958_0096064
426 Ga0466967_0007749
427 Ga0466967_0139766
428 Ga0495653_0214060
429 Ga0495582_0076562
430 Ga0495606_0012733
431 Ga0495630_0217932
432 Ga0495645_0152600
433 Ga0495668_0004729
434 Ga0495625_0012871
435 Ga0495635_0201385
436 Ga0495624_0038071
437 Ga0495672_0132817
438 Ga0495683_0098573
439 Ga0495626_0003985
440 Ga0496102_0000911
441 Ga0496102_0148831
442 Ga0496103_0014813
443 Ga0496105_0056017
444 Ga0496108_0040741
445 Ga0496108_0064068
446 Ga0496108_0301372
447 Ga0496109_0031116
448 Ga0496109_0044645
449 Ga0496109_0079621
450 Ga0496110_0099000
451 Ga0496111_0143455
452 Ga0496112_0009174
453 Ga0496112_0086951
454 Ga0496112_0187959
455 Ga0496113_0203766
456 Ga0496114_0336822
457 Ga0501031_0075788
458 Ga0501032_0041134
459 Ga0501032_0206330
460 Ga0501033_0196779
461 Ga0501034_0014299
462 Ga0501034_0067998
463 Ga0501034_0326296
464 Ga0501036_0023664
465 Ga0501036_0179518
466 Ga0501038_0322686
467 Ga0501039_0009984
468 Ga0501039_0028265
469 Ga0501039_0181954
470 Ga0501039_0189154
471 Ga0501039_0253215
472 Ga0501040_0016279
473 Ga0501040_0153047
474 Ga0501040_0243039
475 Ga0501041_0054602
476 Ga0501041_0100030
477 Ga0501042_0011270
478 Ga0501042_0025986
479 Ga0501042_0107145
480 Ga0501043_0046641
481 Ga0501046_0003350
482 Ga0501047_0010630
483 Ga0501047_0028117
484 Ga0501048_0036721
485 Ga0501068_0027871
486 Ga0501069_0200440
487 Ga0501070_0009325
488 Ga0501070_0383288
489 Ga0501071_0012589
490 Ga0501071_0097941
491 Ga0501071_0153095
492 Ga0501072_0003125
493 Ga0501072_0004487
494 Ga0501072_0025326
495 Ga0501075_0001643
496 Ga0501075_0002689
497 Ga0501075_0137120
498 Ga0501075_0200629
499 Ga0501076_0032254
500 Ga0501076_0054885
501 Ga0501076_0126052
502 Ga0501076_0199024
503 Ga0501076_0394225
504 Ga0501077_0040003
505 Ga0501079_0002072
506 Ga0501079_0117528
507 Ga0501079_0175509
508 Ga0501080_0020669
509 Ga0501080_0068400
510 Ga0501080_0069781
511 Ga0501081_0066576
512 Ga0501083_0013609
513 Ga0501083_0030691
514 Ga0501083_0098676
515 Ga0501035_0292074
516 Ga0501044_0333482
517 Ga0501045_0248241
518 nmdc:mga03n38_2149_c1
519 nmdc:mga00v17_15434_c1
520 nmdc:mga00v17_39243_c1
521 nmdc:mga0yw44_3006_c1
522 nmdc:mga0yw44_3527_c1
523 nmdc:mga06z11_181463_c1
524 nmdc:mga06z11_3380_c1
525 nmdc:mga07m45_3288_c1
526 nmdc:mga07m45_3876_c2
527 nmdc:mga05p37_373_c1
528 nmdc:mga05p37_65927_c1
529 nmdc:mga09592_60689_c1
530 nmdc:mga09592_75543_c1
531 nmdc:mga09592_826_c1
532 nmdc:mga0qj67_41080_c1
533 nmdc:mga0qj67_88130_c1
534 nmdc:mga06r32_312624_c1
535 nmdc:mga06r32_796_c1
536 nmdc:mga08y16_72147_c1
537 Ga0500635_0000369
538 Ga0495619_0017081
539 Ga0500604_0030700
540 Ga0501084_0000548
541 Ga0501084_0033216
542 Ga0501084_0035750
543 Ga0501084_0052127
544 Ga0501082_0190707
545 Ga0501082_0509832
546 Ga0466962_0049459
547 Ga0530510_0009365
548 Ga0530510_0042171
549 Ga0530510_0055868
550 2515857089
551 2731905990
552 2795795794
553 2816503647
554 2867305546
555 2868089466
556 2887480329
557 2899364373
558 8001790162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21686

LigD_Prim-Pol

LigD, primase-polymerase domain

68

316

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.9107 10 289
2iry-assembly1.cif.gz_A crystal structure of the polymerase domain from mycobacterium tuberculosis ligase d with dgtp and manganese. 0.8863 6 273
6sa1-assembly1.cif.gz_A post catalytic complex of prim-polc from mycobacterium smegmatis with gapped dna and 3'-dutp 0.8824 13 290
2far-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa ligd polymerase domain with datp and manganese 0.8798 11 296
2far-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa ligd polymerase domain with datp and manganese 0.8517 11 296
ID Description Score Start End Superfamily
af_O69697_22_304_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9269 25 282 3.90.920.10
af_P95226_24_305_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9128 29 285 3.90.920.10
2iruB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9 127 262 3.30.70.3300
2iruB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8818 127 262 3.30.70.3300
2faqB01 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.8734 20 296 3.90.920.10
ID Description Score Start End GO Terms
AF-A0A7W0R4P4-F1-model_v4 ATP-dependent DNA ligase 0.9915 5 123 GO:0005524
GO:0016874
GO:0046872
AF-A0A2W2GLN9-F1-model_v4 ATP-dependent DNA ligase 0.9865 5 283 GO:0005524
GO:0016874
GO:0046872
AF-A0A2S9FM71-F1-model_v4 ATP-dependent DNA ligase 0.9823 155 291 GO:0016874
AF-A0A4V2XR24-F1-model_v4 ATP-dependent DNA ligase 0.9808 8 213 GO:0005524
GO:0016874
GO:0046872
AF-A0A2W2GLN9-F1-model_v4 ATP-dependent DNA ligase 0.9795 5 283 GO:0005524
GO:0016874
GO:0046872

Map