F382800

General Info

Members Datasets Scaffolds Average Seq Length
279 208 558 405

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10016865|JGI25404J52841_100168651
Length 485
Sequence MNYDAHFRRQLEGLHREGRYRIFADLERKAGAFPRARHHHKGGAGEVTVWCSNDYLGMGQHPKVLAAMHEALDSCGAGAGGTRNIAGTXHYHVLLERELADLHGKEAALLFTSGYVSNMAAISTLASRMPGCTILSDELNHASMIEGIRHSRSGTRIFAHNDPRDLERKLSDLDPHAPKLVAFESVYSMDGDIAPIAELCDVADANNAMTYLDEVHGVGLYGPRGGGIADREGLSHRLTVIEGTLAKAFGVIGGYVAASSTICDFIRSFASGFIFTTSLPPAVAAGALTSIRHLKSSADERERHQERVARLRLRLDQAGVAHLDNPSHIVPVMVCDPVLCKQISDALIDRYGIYVQPINYPTVPRGTERLRSIRHLKSSADERERHQERVARLRLRLDQAGVAHLDNPSHIVPVMVCDPVLCKQISDVLIDRYGIYVQPINYPTVPRGTERLRITPSPHHTDADIEHLVQALAEIWTEVGLAKAA

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
91 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
92 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
116 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
123 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
139 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
143 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
144 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
145 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
146 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
147 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
148 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
149 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
150 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
153 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
154 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
155 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
156 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
157 2643221618 Ensifer sp. Root231 Isolate Unclassified
158 2643221626 Ensifer sp. Root31 Isolate Unclassified
159 2643221655 Ensifer sp. Root1252 Isolate Unclassified
160 2643221659 Ensifer sp. Root127 Isolate Unclassified
161 2643221698 Ensifer sp. Root142 Isolate Unclassified
162 2643221712 Ensifer sp. Root258 Isolate Unclassified
163 2643221734 Bosea sp. Root670 Isolate Unclassified
164 2643221736 Bosea sp. Root483D1 Isolate Unclassified
165 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
166 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
167 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
168 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
169 2818991467 Bosea vestrisii 3192 Isolate Unclassified
170 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
171 2841760612 Bosea sp. Tri-49 Isolate Nodule
172 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
173 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
174 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
175 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
176 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
177 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
178 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
179 2844104063 Bosea sp. Tri-39 Isolate Nodule
180 2844163670 Ensifer sp. 1H6 Isolate Unclassified
181 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
182 2851182111 Bosea sp. Tri-44 Isolate Nodule
183 2851246043 Bosea sp. Tri-54 Isolate Nodule
184 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
185 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
186 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
187 2902330777 Methylobacterium sp. 2A Isolate Unclassified
188 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
189 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
190 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
191 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
192 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
193 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
194 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
195 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
196 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
197 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
198 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
199 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
200 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
201 641522639 Methylobacterium sp. 4-46 Isolate Nodule
202 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
203 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
204 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
205 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
206 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
207 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
208 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.85
Metatranscriptomes 0.36
Isolates 20.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.26
Nodule 10.75
Rhizoplane 0.36
Rhizosphere 59.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10016865 3300003659 Bacteria 1584
2 JGI25159J45721_1011840 3300002987 Bacteria 2111
3 JGI25407J50210_10004732 3300003373 Bacteria 3320
4 Ga0006562J51391_1113397 3300003578 Bacteria 3097
5 JGI25404J52841_10001492 3300003659 Bacteria 4132
6 Ga0055526_1000456 3300003771 Bacteria 32569
7 Ga0055526_1002618 3300003771 Bacteria 12030
8 Ga0055524_1000189 3300003775 Bacteria 68000
9 Ga0055524_1010789 3300003775 Bacteria 3615
10 Ga0055543_1011112 3300004625 Bacteria 1857
11 Ga0065165_1000694 3300005262 Bacteria 48071
12 Ga0065704_10079823 3300005289 Bacteria 4073
13 Ga0065707_10091151 3300005295 Bacteria 3995
14 Ga0070691_10001095 3300005341 Bacteria 11240
15 Ga0070668_100008236 3300005347 Bacteria 7738
16 Ga0070674_100008322 3300005356 Bacteria 6172
17 Ga0070709_10060147 3300005434 Bacteria 2414
18 Ga0070714_100002143 3300005435 Bacteria 14516
19 Ga0070711_100168430 3300005439 Bacteria 1667
20 Ga0070708_100007598 3300005445 Bacteria 8679
21 Ga0070708_100023532 3300005445 Bacteria 5241
22 Ga0070706_100014438 3300005467 Bacteria 7298
23 Ga0070707_100002829 3300005468 Bacteria 16509
24 Ga0070707_100007999 3300005468 Bacteria 9824
25 Ga0070698_100007142 3300005471 Bacteria 12096
26 Ga0070698_100041638 3300005471 Bacteria 4715
27 Ga0070699_100013158 3300005518 Bacteria 7134
28 Ga0070699_100142049 3300005518 Bacteria 2121
29 Ga0070684_100360913 3300005535 Bacteria 1337
30 Ga0070697_100024928 3300005536 Bacteria 4765
31 Ga0070697_100037936 3300005536 Bacteria 3892
32 Ga0068853_100015847 3300005539 Bacteria 6191
33 Ga0070695_100107589 3300005545 Bacteria 1887
34 Ga0070693_100006902 3300005547 Bacteria 5521
35 Ga0070665_100006135 3300005548 Bacteria 12288
36 Ga0070665_100044901 3300005548 Bacteria 4436
37 Ga0070665_100115144 3300005548 Bacteria 2691
38 Ga0068855_100038085 3300005563 Bacteria 5715
39 Ga0068857_100001169 3300005577 Bacteria 20462
40 Ga0068854_100052686 3300005578 Bacteria 2919
41 Ga0068856_100003390 3300005614 Bacteria 16131
42 Ga0068856_100080125 3300005614 Bacteria 3239
43 Ga0068852_100006165 3300005616 Bacteria 8648
44 Ga0068852_100183415 3300005616 Bacteria 1969
45 Ga0068859_100220147 3300005617 Bacteria 1986
46 Ga0068858_100043937 3300005842 Bacteria 4143
47 Ga0081538_10005569 3300005981 Bacteria 11304
48 Ga0081540_1000728 3300005983 Bacteria 30330
49 Ga0081540_1001444 3300005983 Bacteria 20535
50 Ga0081540_1003327 3300005983 Bacteria 12746
51 Ga0070716_100114682 3300006173 Bacteria 1676
52 Ga0070712_100052200 3300006175 Bacteria 2850
53 Ga0070712_100075617 3300006175 Bacteria 2422
54 Ga0075362_10000368 3300006177 Bacteria 13038
55 Ga0075369_10004004 3300006186 Bacteria 5411
56 Ga0075369_10045559 3300006186 Bacteria 1886
57 Ga0075366_10008068 3300006195 Bacteria 5835
58 Ga0097621_100221174 3300006237 Bacteria 1650
59 Ga0075370_10003223 3300006353 Bacteria 7720
60 Ga0075430_100095073 3300006846 Bacteria 2491
61 Ga0075434_100254981 3300006871 Bacteria 1773
62 Ga0075434_100257137 3300006871 Bacteria 1765
63 Ga0075436_100089158 3300006914 Bacteria 2143
64 Ga0097620_100220157 3300006931 Bacteria 1986
65 Ga0099795_10052483 3300007788 Bacteria 1489
66 Ga0105240_10005179 3300009093 Bacteria 19500
67 Ga0105240_10394495 3300009093 Bacteria 1560
68 Ga0105240_10394758 3300009093 Bacteria 1560
69 Ga0105241_10025950 3300009174 Bacteria 4358
70 Ga0105242_10146007 3300009176 Bacteria 2058
71 Ga0105248_10044320 3300009177 Bacteria 4990
72 Ga0105237_10023534 3300009545 Bacteria 6311
73 Ga0105238_10002514 3300009551 Bacteria 18349
74 Ga0099796_10005269 3300010159 Bacteria 3213
75 Ga0099796_10018127 3300010159 Bacteria 2109
76 Ga0105239_10191017 3300010375 Bacteria 2292
77 Ga0105239_10194343 3300010375 Bacteria 2272
78 Ga0157373_10002098 3300013100 Bacteria 15092
79 Ga0157370_10004421 3300013104 Bacteria 16104
80 Ga0157369_10007353 3300013105 Bacteria 12681
81 Ga0171462_1013 3300013250 Bacteria 202864
82 Ga0157378_10019223 3300013297 Bacteria 6003
83 Ga0157380_10068068 3300014326 Bacteria 2869
84 Ga0213873_10018279 3300021358 Bacteria 1610
85 Ga0213876_10000549 3300021384 Bacteria 28086
86 Ga0213875_10001417 3300021388 Bacteria 15584
87 Ga0213875_10001838 3300021388 Bacteria 13191
88 Ga0213875_10063082 3300021388 Bacteria 1733
89 Ga0209675_1003405 3300025291 Bacteria 7577
90 Ga0209025_1007043 3300025294 Bacteria 8517
91 Ga0209564_1000043 3300025295 Bacteria 388153
92 Ga0209564_1000076 3300025295 Bacteria 283602
93 Ga0209758_1000557 3300025297 Bacteria 58827
94 Ga0209256_1000187 3300025299 Bacteria 118793
95 Ga0209256_1000316 3300025299 Bacteria 83704
96 Ga0207426_1000328 3300025302 Bacteria 90659
97 Ga0209051_1007710 3300025303 Bacteria 5837
98 Ga0207684_10041001 3300025910 Bacteria 3926
99 Ga0207684_10083971 3300025910 Bacteria 2712
100 Ga0207695_10016406 3300025913 Bacteria 8665
101 Ga0207695_10046069 3300025913 Bacteria 4623
102 Ga0207695_10055970 3300025913 Bacteria 4107
103 Ga0207671_10009428 3300025914 Bacteria 8161
104 Ga0207693_10009750 3300025915 Bacteria 7820
105 Ga0207693_10060903 3300025915 Bacteria 2957
106 Ga0207693_10088188 3300025915 Bacteria 2431
107 Ga0207663_10156049 3300025916 Bacteria 1606
108 Ga0207646_10025146 3300025922 Bacteria 5450
109 Ga0207665_10020751 3300025939 Bacteria 4320
110 Ga0207689_10005682 3300025942 Bacteria 11098
111 Ga0207667_10007496 3300025949 Bacteria 13097
112 Ga0207668_10018665 3300025972 Bacteria 4371
113 Ga0207668_10088920 3300025972 Bacteria 2263
114 Ga0207668_10102338 3300025972 Bacteria 2131
115 Ga0207703_10367308 3300026035 Bacteria 1328
116 Ga0207639_10007967 3300026041 Bacteria 7236
117 Ga0207678_10017321 3300026067 Bacteria 6325
118 Ga0207702_10004736 3300026078 Bacteria 12020
119 Ga0207702_10141889 3300026078 Bacteria 2175
120 Ga0207641_10208487 3300026088 Bacteria 1806
121 Ga0207674_10001294 3300026116 Bacteria 32678
122 Ga0268266_10000539 3300028379 Bacteria 52742
123 Ga0268266_10037176 3300028379 Bacteria 4148
124 Ga0268266_10207417 3300028379 Bacteria 1796
125 Ga0265319_1004046 3300028563 Bacteria 7408
126 Ga0265318_10013519 3300028577 Bacteria 3447
127 Ga0265336_10000861 3300028666 Bacteria 15760
128 Ga0265338_10000081 3300028800 Bacteria 176402
129 Ga0265338_10029159 3300028800 Bacteria 5480
130 Ga0265324_10004557 3300029957 Bacteria 6206
131 Ga0265332_10001180 3300031238 Bacteria 15121
132 Ga0265332_10033659 3300031238 Bacteria 2230
133 Ga0265325_10000622 3300031241 Bacteria 25870
134 Ga0265325_10008051 3300031241 Bacteria 6249
135 Ga0265340_10029206 3300031247 Bacteria 2770
136 Ga0265339_10005061 3300031249 Bacteria 8853
137 Ga0265339_10013028 3300031249 Bacteria 5054
138 Ga0265339_10031943 3300031249 Bacteria 2971
139 Ga0265331_10045398 3300031250 Bacteria 2121
140 Ga0265331_10046235 3300031250 Bacteria 2098
141 Ga0265316_10025758 3300031344 Bacteria 4903
142 Ga0265316_10040360 3300031344 Bacteria 3742
143 Ga0265316_10084800 3300031344 Bacteria 2426
144 Ga0265313_10001758 3300031595 Bacteria 19875
145 Ga0265313_10009190 3300031595 Bacteria 6446
146 Ga0265314_10002338 3300031711 Bacteria 19597
147 Ga0265314_10014662 3300031711 Bacteria 6256
148 Ga0265314_10082940 3300031711 Bacteria 2108
149 Ga0265314_10158183 3300031711 Bacteria 1382
150 Ga0265342_10000087 3300031712 Bacteria 100045
151 Ga0265342_10017852 3300031712 Bacteria 4606
152 Ga0307414_10073646 3300032004 Bacteria 2472
153 Ga0373933_0019272 3300035724 Bacteria 3851
154 Ga0373937_0083983 3300036401 Bacteria 2946
155 Ga0316582_0059765 3300036647 Bacteria 2442
156 Ga0395900_0159567 3300037418 Bacteria 2301
157 Ga0436364_0328296 3300037853 Bacteria 143298
158 Ga0436364_0524718 3300037853 Bacteria 3216
159 Ga0436364_0875825 3300037853 Bacteria 32110
160 Ga0436364_1057094 3300037853 Bacteria 52413
161 Ga0436364_1101807 3300037853 Bacteria 3178
162 Ga0436364_1437406 3300037853 Bacteria 17975
163 Ga0400483_054255 3300039062 Bacteria 3430
164 Ga0400483_226014 3300039062 Bacteria 3488
165 Ga0436365_0322801 3300039437 Bacteria 1834
166 Ga0436365_1026614 3300039437 Bacteria 53933
167 Ga0436360_0781768 3300039438 Bacteria 11744
168 Ga0436361_0034727 3300039447 Bacteria 1475
169 Ga0436361_0559873 3300039447 Bacteria 2133
170 Ga0436361_0843956 3300039447 Bacteria 2829
171 Ga0436362_0028787 3300039453 Bacteria 2294
172 Ga0436362_0085634 3300039453 Bacteria 2711
173 Ga0439449_0029857 3300042007 Bacteria 2031
174 Ga0439462_0019253 3300042015 Bacteria 1776
175 Ga0451577_0094863 3300042876 Bacteria 2664
176 Ga0451576_0002473 3300045051 Bacteria 27484
177 Ga0451576_0004104 3300045051 Bacteria 19212
178 Ga0451576_0052777 3300045051 Bacteria 4260
179 Ga0451576_0093701 3300045051 Bacteria 3123
180 Ga0495594_0034768 3300046499 Bacteria 2743
181 Ga0495587_0073040 3300046536 Bacteria 1993
182 Ga0496108_0148268 3300048911 Bacteria 2024
183 Ga0496117_0039956 3300048920 Bacteria 3457
184 Ga0496118_0072867 3300048921 Bacteria 2464
185 Ga0496121_0011690 3300048924 Bacteria 9695
186 Ga0496122_0136977 3300048925 Bacteria 1540
187 Ga0496123_0036966 3300048926 Bacteria 3454
188 Ga0496126_0118211 3300048929 Bacteria 2302
189 Ga0501036_0210841 3300049572 Bacteria 1632
190 Ga0501038_0031285 3300049574 Bacteria 4703
191 Ga0501038_0065774 3300049574 Bacteria 3088
192 Ga0501039_0104254 3300049575 Bacteria 2214
193 Ga0501039_0250215 3300049575 Bacteria 1393
194 Ga0501046_0010212 3300049580 Bacteria 8079
195 Ga0501047_0009386 3300049581 Bacteria 9240
196 Ga0501047_0012856 3300049581 Bacteria 7931
197 Ga0501047_0046629 3300049581 Bacteria 4188
198 Ga0501073_0112978 3300049589 Bacteria 1884
199 Ga0501035_0013091 3300049822 Bacteria 7656
200 Ga0501044_0001467 3300049823 Bacteria 27692
201 Ga0501044_0096071 3300049823 Bacteria 2986
202 nmdc:mga03683_519_c1 3300050489 Bacteria 11030
203 nmdc:mga00v17_98442_c1 3300050491 Bacteria 1844
204 nmdc:mga0yw44_99861_c1 3300050492 Bacteria 1847
205 nmdc:mga07m45_1457_c2 3300050496 Bacteria 8781
206 nmdc:mga0n895_242848_c1 3300050512 Bacteria 1828
207 nmdc:mga0n895_60402_c1 3300050512 Bacteria 3740
208 nmdc:mga08x19_86050_c1 3300050514 Bacteria 2069
209 nmdc:mga0sz30_15_c1 3300050516 Bacteria 83405
210 nmdc:mga0sz30_1769_c1 3300050516 Bacteria 7674
211 Ga0500643_011701 3300053087 Bacteria 3184
212 Ga0500595_000084 3300053119 Bacteria 66292
213 Ga0500614_005581 3300053123 Bacteria 2639
214 Ga0500559_0004317 3300053136 Bacteria 6789
215 Ga0500559_0009345 3300053136 Bacteria 4249
216 Ga0500559_0016387 3300053136 Bacteria 3128
217 Ga0500577_0000235 3300053142 Bacteria 14718
218 Ga0500590_086621 3300053148 Bacteria 1528
219 Ga0500622_0001032 3300053156 Bacteria 23277
220 Ga0500636_0149744 3300053177 Bacteria 1283
221 Ga0501082_0108812 3300060353 Bacteria 2399
222 2511185811 2510917028 Bacteria 6185411
223 2524458344 2524023209 Bacteria 6679728
224 2535514395 2534681796 Bacteria 7146037
225 2545674122 2545555834 Bacteria 8130841
226 2585200947 2582581294 Bacteria 6626667
227 2644109980 2643221618 Bacteria 7717186
228 2644150256 2643221626 Bacteria 8069654
229 2644312860 2643221655 Bacteria 7722067
230 2644336406 2643221659 Bacteria 7890716
231 2644546054 2643221698 Bacteria 7756764
232 2644618590 2643221712 Bacteria 7729434
233 2644737660 2643221734 Bacteria 5365412
234 2644746498 2643221736 Bacteria 6608466
235 2738744053 2738541281 Bacteria 5112672
236 2739353283 2738543032 Bacteria 5115625
237 2753459110 2751185821 Bacteria 6189929
238 2792641407 2791355094 Bacteria 7011481
239 2819722147 2818991467 Bacteria 5893227
240 2829750152 2829745981 Bacteria 5406054
241 2841764988 2841760612 Bacteria 6454112
242 2841915167 2841911363 Bacteria 6173697
243 2841922064 2841917233 Bacteria 6173500
244 2842300400 2842298080 Bacteria 6123127
245 2842336647 2842333319 Bacteria 8899485
246 2842361083 2842357229 Bacteria 6485165
247 2842511832 2842509118 Bacteria 6850950
248 2842514344 2842509118 Bacteria 6850950
249 2842701500 2842698319 Bacteria 5190321
250 2844107564 2844104063 Bacteria 6440972
251 2844164173 2844163670 Bacteria 7266046
252 2844315641 2844315083 Bacteria 8138177
253 2851183689 2851182111 Bacteria 6047226
254 2851249670 2851246043 Bacteria 6439203
255 2879103319 2879099564 Bacteria 10442239
256 2888389529 2888388044 Bacteria 7304136
257 2889306698 2889306138 Bacteria 6358934
258 2902332303 2902330777 Bacteria 6395352
259 2902409654 2902405164 Bacteria 6784948
260 2903732665 2903727486 Bacteria 8281579
261 2906605433 2906602504 Bacteria 8295279
262 2919681553 2919679072 Bacteria 4629602
263 2928126294 2928125067 Bacteria 5937560
264 2935888118 2935883170 Bacteria 7964738
265 2935915729 2935908558 Bacteria 8568796
266 2935924333 2935916978 Bacteria 9113783
267 2935933054 2935926038 Bacteria 8601059
268 2935941628 2935934488 Bacteria 8602579
269 2935950106 2935942939 Bacteria 8599779
270 2935958525 2935951376 Bacteria 8602333
271 2935974691 2935967501 Bacteria 8603075
272 641643900 641522639 Bacteria 7737025
273 643827258 643692032 Bacteria 6891900
274 8005543031 8005542996 Bacteria 7077758
275 8016636262 8016630954 Bacteria 9217207
276 8019691871 8019687851 Bacteria 8712826
277 8024492727 8024486573 Bacteria 6540512
278 8054565009 8054563764 Bacteria 5592885
279 8057532982 8057529695 Bacteria 6306553
280 JGI25404J52841_10016865
281 JGI25159J45721_1011840
282 JGI25407J50210_10004732
283 Ga0006562J51391_1113397
284 JGI25404J52841_10001492
285 Ga0055526_1000456
286 Ga0055526_1002618
287 Ga0055524_1000189
288 Ga0055524_1010789
289 Ga0055543_1011112
290 Ga0065165_1000694
291 Ga0065704_10079823
292 Ga0065707_10091151
293 Ga0070691_10001095
294 Ga0070668_100008236
295 Ga0070674_100008322
296 Ga0070709_10060147
297 Ga0070714_100002143
298 Ga0070711_100168430
299 Ga0070708_100007598
300 Ga0070708_100023532
301 Ga0070706_100014438
302 Ga0070707_100002829
303 Ga0070707_100007999
304 Ga0070698_100007142
305 Ga0070698_100041638
306 Ga0070699_100013158
307 Ga0070699_100142049
308 Ga0070684_100360913
309 Ga0070697_100024928
310 Ga0070697_100037936
311 Ga0068853_100015847
312 Ga0070695_100107589
313 Ga0070693_100006902
314 Ga0070665_100006135
315 Ga0070665_100044901
316 Ga0070665_100115144
317 Ga0068855_100038085
318 Ga0068857_100001169
319 Ga0068854_100052686
320 Ga0068856_100003390
321 Ga0068856_100080125
322 Ga0068852_100006165
323 Ga0068852_100183415
324 Ga0068859_100220147
325 Ga0068858_100043937
326 Ga0081538_10005569
327 Ga0081540_1000728
328 Ga0081540_1001444
329 Ga0081540_1003327
330 Ga0070716_100114682
331 Ga0070712_100052200
332 Ga0070712_100075617
333 Ga0075362_10000368
334 Ga0075369_10004004
335 Ga0075369_10045559
336 Ga0075366_10008068
337 Ga0097621_100221174
338 Ga0075370_10003223
339 Ga0075430_100095073
340 Ga0075434_100254981
341 Ga0075434_100257137
342 Ga0075436_100089158
343 Ga0097620_100220157
344 Ga0099795_10052483
345 Ga0105240_10005179
346 Ga0105240_10394495
347 Ga0105240_10394758
348 Ga0105241_10025950
349 Ga0105242_10146007
350 Ga0105248_10044320
351 Ga0105237_10023534
352 Ga0105238_10002514
353 Ga0099796_10005269
354 Ga0099796_10018127
355 Ga0105239_10191017
356 Ga0105239_10194343
357 Ga0157373_10002098
358 Ga0157370_10004421
359 Ga0157369_10007353
360 Ga0171462_1013
361 Ga0157378_10019223
362 Ga0157380_10068068
363 Ga0213873_10018279
364 Ga0213876_10000549
365 Ga0213875_10001417
366 Ga0213875_10001838
367 Ga0213875_10063082
368 Ga0209675_1003405
369 Ga0209025_1007043
370 Ga0209564_1000043
371 Ga0209564_1000076
372 Ga0209758_1000557
373 Ga0209256_1000187
374 Ga0209256_1000316
375 Ga0207426_1000328
376 Ga0209051_1007710
377 Ga0207684_10041001
378 Ga0207684_10083971
379 Ga0207695_10016406
380 Ga0207695_10046069
381 Ga0207695_10055970
382 Ga0207671_10009428
383 Ga0207693_10009750
384 Ga0207693_10060903
385 Ga0207693_10088188
386 Ga0207663_10156049
387 Ga0207646_10025146
388 Ga0207665_10020751
389 Ga0207689_10005682
390 Ga0207667_10007496
391 Ga0207668_10018665
392 Ga0207668_10088920
393 Ga0207668_10102338
394 Ga0207703_10367308
395 Ga0207639_10007967
396 Ga0207678_10017321
397 Ga0207702_10004736
398 Ga0207702_10141889
399 Ga0207641_10208487
400 Ga0207674_10001294
401 Ga0268266_10000539
402 Ga0268266_10037176
403 Ga0268266_10207417
404 Ga0265319_1004046
405 Ga0265318_10013519
406 Ga0265336_10000861
407 Ga0265338_10000081
408 Ga0265338_10029159
409 Ga0265324_10004557
410 Ga0265332_10001180
411 Ga0265332_10033659
412 Ga0265325_10000622
413 Ga0265325_10008051
414 Ga0265340_10029206
415 Ga0265339_10005061
416 Ga0265339_10013028
417 Ga0265339_10031943
418 Ga0265331_10045398
419 Ga0265331_10046235
420 Ga0265316_10025758
421 Ga0265316_10040360
422 Ga0265316_10084800
423 Ga0265313_10001758
424 Ga0265313_10009190
425 Ga0265314_10002338
426 Ga0265314_10014662
427 Ga0265314_10082940
428 Ga0265314_10158183
429 Ga0265342_10000087
430 Ga0265342_10017852
431 Ga0307414_10073646
432 Ga0373933_0019272
433 Ga0373937_0083983
434 Ga0316582_0059765
435 Ga0395900_0159567
436 Ga0436364_0328296
437 Ga0436364_0524718
438 Ga0436364_0875825
439 Ga0436364_1057094
440 Ga0436364_1101807
441 Ga0436364_1437406
442 Ga0400483_054255
443 Ga0400483_226014
444 Ga0436365_0322801
445 Ga0436365_1026614
446 Ga0436360_0781768
447 Ga0436361_0034727
448 Ga0436361_0559873
449 Ga0436361_0843956
450 Ga0436362_0028787
451 Ga0436362_0085634
452 Ga0439449_0029857
453 Ga0439462_0019253
454 Ga0451577_0094863
455 Ga0451576_0002473
456 Ga0451576_0004104
457 Ga0451576_0052777
458 Ga0451576_0093701
459 Ga0495594_0034768
460 Ga0495587_0073040
461 Ga0496108_0148268
462 Ga0496117_0039956
463 Ga0496118_0072867
464 Ga0496121_0011690
465 Ga0496122_0136977
466 Ga0496123_0036966
467 Ga0496126_0118211
468 Ga0501036_0210841
469 Ga0501038_0031285
470 Ga0501038_0065774
471 Ga0501039_0104254
472 Ga0501039_0250215
473 Ga0501046_0010212
474 Ga0501047_0009386
475 Ga0501047_0012856
476 Ga0501047_0046629
477 Ga0501073_0112978
478 Ga0501035_0013091
479 Ga0501044_0001467
480 Ga0501044_0096071
481 nmdc:mga03683_519_c1
482 nmdc:mga00v17_98442_c1
483 nmdc:mga0yw44_99861_c1
484 nmdc:mga07m45_1457_c2
485 nmdc:mga0n895_242848_c1
486 nmdc:mga0n895_60402_c1
487 nmdc:mga08x19_86050_c1
488 nmdc:mga0sz30_15_c1
489 nmdc:mga0sz30_1769_c1
490 Ga0500643_011701
491 Ga0500595_000084
492 Ga0500614_005581
493 Ga0500559_0004317
494 Ga0500559_0009345
495 Ga0500559_0016387
496 Ga0500577_0000235
497 Ga0500590_086621
498 Ga0500622_0001032
499 Ga0500636_0149744
500 Ga0501082_0108812
501 2511185811
502 2524458344
503 2535514395
504 2545674122
505 2585200947
506 2644109980
507 2644150256
508 2644312860
509 2644336406
510 2644546054
511 2644618590
512 2644737660
513 2644746498
514 2738744053
515 2739353283
516 2753459110
517 2792641407
518 2819722147
519 2829750152
520 2841764988
521 2841915167
522 2841922064
523 2842300400
524 2842336647
525 2842361083
526 2842511832
527 2842514344
528 2842701500
529 2844107564
530 2844164173
531 2844315641
532 2851183689
533 2851249670
534 2879103319
535 2888389529
536 2889306698
537 2902332303
538 2902409654
539 2903732665
540 2906605433
541 2919681553
542 2928126294
543 2935888118
544 2935915729
545 2935924333
546 2935933054
547 2935941628
548 2935950106
549 2935958525
550 2935974691
551 641643900
552 643827258
553 8005543031
554 8016636262
555 8019691871
556 8024492727
557 8054565009
558 8057532982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

45

375

0.97

PF00155

Aminotran_1_2

Aminotransferase class I and II

372

472

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bwo-assembly2.cif.gz_D 5-aminolevulinate synthase from rhodobacter capsulatus in complex with succinyl-coa 0.9832 1 393
7x98-assembly2.cif.gz_D 5-aminolevulinate synthase hema from rhodopseudomonas palustris 0.9826 1 398
7x98-assembly2.cif.gz_D 5-aminolevulinate synthase hema from rhodopseudomonas palustris 0.9778 1 398
5txt-assembly2.cif.gz_D structure of asymmetric apo/holo alas dimer from s. cerevisiae 0.9755 47 395
5txt-assembly3.cif.gz_E structure of asymmetric apo/holo alas dimer from s. cerevisiae 0.9749 47 395
ID Description Score Start End Superfamily
af_O18680_387_483_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9906 298 385 3.90.1150.10
af_O94069_405_493_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9864 300 385 3.90.1150.10
af_Q8I4X1_515_606_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9792 299 387 3.90.1150.10
af_P13196_493_597_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9791 298 395 3.90.1150.10
af_P09950_130_384_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9772 62 293 3.40.640.10
ID Description Score Start End GO Terms
AF-F6RYA6-F1-model_v4 Aminolevulinic acid synthase 1 0.9918 162 250 GO:0009058
GO:0016746
GO:0030170
AF-A0A442G7G1-F1-model_v4 5-aminolevulinate synthase (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-ALA synthase) (Delta-aminolevulinate synthase) 0.9911 166 395 GO:0003870
GO:0006782
GO:0030170
AF-A0A434SYN6-F1-model_v4 deleted 0.9901 87 395
AF-A0A7X4J9M6-F1-model_v4 deleted 0.9896 1 401
AF-A0A0F7KQF2-F1-model_v4 5-aminolevulinate synthase (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-ALA synthase) (Delta-aminolevulinate synthase) 0.9885 1 396 GO:0003870
GO:0006782
GO:0030170

Map