F382661

General Info

Members Datasets Scaffolds Average Seq Length
278 196 249 244

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0234911|Ga0501038_0234911_226_975
Length 239
Sequence MTGPHPDSALVLFSGGQDSATCLAWALDRFAHVETVGFAYGQRHAVEMECRAPLREGMAAIGEWGARLGADHIVATALTSEAEIGIGAEGLPTTFVPGRNLLFLTYAAAIAFRRGLRRIVGGMCETDYSGYPDCRDDAVKAMQLALNLGMDRRFLLETPLMWLDKAQTWTLAERLGGAALVELILERSHSCYRGERGRRHPWGYGCGTCPACELRAAGWRLFSAPVAAGLGAGGARHHQ

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
7 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
10 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
11 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
12 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
13 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
14 2904699407
15 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
16 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
17 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
18 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
19 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
20 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
21 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
22 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
23 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
24 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
175 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
176 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
177 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
178 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
179 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
180 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
181 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
182 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
183 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
184 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
185 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
186 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
187 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
188 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
189 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
190 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
193 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
194 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
195 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
196 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.89
Metatranscriptomes 0
Isolates 10.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.35
Nodule 7.55
Rhizoplane 6.12
Rhizosphere 68.71
Stem 0
Stem Tuber 0
Unclassified 8.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10075166 3300005327 Bacteria 2771
2 Ga0070670_100433242 3300005331 Bacteria 1164
3 Ga0070660_100005361 3300005339 Bacteria 8874
4 Ga0070691_10005214 3300005341 Bacteria 5905
5 Ga0070668_100011304 3300005347 Bacteria 6650
6 Ga0070671_100018824 3300005355 Bacteria 5613
7 Ga0070671_100103876 3300005355 Bacteria 2384
8 Ga0070659_100000145 3300005366 Bacteria 54825
9 Ga0070714_100061901 3300005435 Bacteria 3215
10 Ga0070714_100063341 3300005435 Bacteria 3180
11 Ga0070714_100931582 3300005435 Bacteria 844
12 Ga0070713_100217037 3300005436 Bacteria 1734
13 Ga0070678_100021276 3300005456 Bacteria 4274
14 Ga0070662_100032215 3300005457 Bacteria 3683
15 Ga0070681_10010088 3300005458 Bacteria 9310
16 Ga0070707_100259415 3300005468 Bacteria 1691
17 Ga0070698_100080639 3300005471 Bacteria 3249
18 Ga0070679_100034606 3300005530 Bacteria 5006
19 Ga0068853_100143713 3300005539 Bacteria 2143
20 Ga0068853_100502267 3300005539 Bacteria 1145
21 Ga0070665_100000194 3300005548 Bacteria 107719
22 Ga0070665_100010424 3300005548 Bacteria 9405
23 Ga0070664_100621335 3300005564 Bacteria 1003
24 Ga0068856_100054658 3300005614 Bacteria 3939
25 Ga0068856_100080083 3300005614 Bacteria 3240
26 Ga0068852_100488872 3300005616 Bacteria 1224
27 Ga0068859_100105885 3300005617 Bacteria 2872
28 Ga0068864_100000038 3300005618 Bacteria 181005
29 Ga0068864_100000979 3300005618 Bacteria 23959
30 Ga0068864_100007942 3300005618 Bacteria 8745
31 Ga0068863_100000026 3300005841 Bacteria 185590
32 Ga0068863_100614049 3300005841 Bacteria 1077
33 Ga0068860_100565509 3300005843 Bacteria 1140
34 Ga0081540_1123459 3300005983 Bacteria 1070
35 Ga0075370_10039480 3300006353 Bacteria 2660
36 Ga0075428_100453237 3300006844 Bacteria 1374
37 Ga0075431_100006372 3300006847 Bacteria 11712
38 Ga0075431_100259643 3300006847 Bacteria 1763
39 Ga0075429_100106453 3300006880 Bacteria 2450
40 Ga0097620_100105886 3300006931 Bacteria 2872
41 Ga0105250_10020631 3300009092 Bacteria 2662
42 Ga0105240_10006985 3300009093 Bacteria 16489
43 Ga0105240_10065617 3300009093 Bacteria 4505
44 Ga0105240_10181424 3300009093 Bacteria 2484
45 Ga0105240_10265989 3300009093 Bacteria 1976
46 Ga0105242_10428298 3300009176 Bacteria 1242
47 Ga0105248_10000115 3300009177 Bacteria 90607
48 Ga0105248_10196397 3300009177 Bacteria 2273
49 Ga0105237_10044524 3300009545 Bacteria 4469
50 Ga0105238_10015127 3300009551 Bacteria 7815
51 Ga0105238_10625965 3300009551 Bacteria 1085
52 Ga0157373_10024548 3300013100 Bacteria 4366
53 Ga0157378_10175261 3300013297 Bacteria 2014
54 Ga0163162_10101540 3300013306 Bacteria 2968
55 Ga0157375_10307592 3300013308 Bacteria 1749
56 Ga0163163_10023849 3300014325 Bacteria 5814
57 Ga0163163_10042048 3300014325 Bacteria 4473
58 Ga0213872_10025115 3300021361 Bacteria 2739
59 Ga0213872_10132594 3300021361 Bacteria 1097
60 Ga0213876_10000543 3300021384 Bacteria 28405
61 Ga0209026_1000649 3300025250 Bacteria 21325
62 Ga0207707_10138841 3300025912 Bacteria 2125
63 Ga0207695_10002873 3300025913 Bacteria 24991
64 Ga0207695_10005482 3300025913 Bacteria 16805
65 Ga0207695_10289978 3300025913 Bacteria 1529
66 Ga0207671_10639920 3300025914 Bacteria 847
67 Ga0207693_10101228 3300025915 Bacteria 2259
68 Ga0207657_10015349 3300025919 Bacteria 7423
69 Ga0207657_10162268 3300025919 Bacteria 1815
70 Ga0207652_10039777 3300025921 Bacteria 3992
71 Ga0207694_10109095 3300025924 Bacteria 2200
72 Ga0207694_10574682 3300025924 Bacteria 947
73 Ga0207650_10441943 3300025925 Bacteria 1081
74 Ga0207700_10307201 3300025928 Bacteria 1371
75 Ga0207664_10013783 3300025929 Bacteria 5817
76 Ga0207664_10175136 3300025929 Bacteria 1839
77 Ga0207644_10144674 3300025931 Bacteria 1834
78 Ga0207644_10177666 3300025931 Bacteria 1666
79 Ga0207690_10000090 3300025932 Bacteria 75242
80 Ga0207706_10145198 3300025933 Bacteria 2087
81 Ga0207711_10000227 3300025941 Bacteria 60371
82 Ga0207711_10325479 3300025941 Bacteria 1421
83 Ga0207711_10451739 3300025941 Bacteria 1196
84 Ga0207679_10204649 3300025945 Bacteria 1651
85 Ga0207667_10049333 3300025949 Bacteria 4446
86 Ga0207667_10447684 3300025949 Bacteria 1313
87 Ga0207668_10001882 3300025972 Bacteria 12270
88 Ga0207639_10016852 3300026041 Bacteria 5177
89 Ga0207639_10032354 3300026041 Bacteria 3850
90 Ga0207639_10056026 3300026041 Bacteria 3020
91 Ga0207702_10000187 3300026078 Bacteria 74357
92 Ga0207702_10597032 3300026078 Bacteria 1083
93 Ga0207641_10000005 3300026088 Bacteria 470841
94 Ga0207641_10073488 3300026088 Bacteria 2947
95 Ga0207676_10000085 3300026095 Bacteria 90147
96 Ga0207676_10001421 3300026095 Bacteria 17792
97 Ga0207676_10178578 3300026095 Bacteria 1857
98 Ga0207698_10569355 3300026142 Bacteria 1113
99 Ga0209981_1000304 3300027378 Bacteria 6305
100 Ga0268266_10000005 3300028379 Bacteria 1448194
101 Ga0268266_10598063 3300028379 Bacteria 1059
102 Ga0268265_10422307 3300028380 Bacteria 1238
103 Ga0307517_10001634 3300028786 Bacteria 37081
104 Ga0265338_10009472 3300028800 Bacteria 11607
105 Ga0265338_10029690 3300028800 Bacteria 5413
106 Ga0265330_10067019 3300031235 Bacteria 1556
107 Ga0307513_10001259 3300031456 Bacteria 36698
108 Ga0307513_10002183 3300031456 Bacteria 27367
109 Ga0307408_100002162 3300031548 Bacteria 14068
110 Ga0265314_10011848 3300031711 Bacteria 7164
111 Ga0265342_10123470 3300031712 Bacteria 1456
112 Ga0307406_10004635 3300031901 Bacteria 7487
113 Ga0307510_10022030 3300033180 Bacteria 7407
114 Ga0307510_10097172 3300033180 Bacteria 2757
115 Ga0315911_1000001 3300033442 Bacteria 1088602
116 Ga0373936_0004694 3300035113 Bacteria 5164
117 Ga0373936_0022298 3300035113 Bacteria 2466
118 Ga0373936_0138615 3300035113 Bacteria 1049
119 Ga0373946_0025989 3300035171 Bacteria 2306
120 Ga0373927_0000471 3300035695 Bacteria 30867
121 Ga0373925_0000202 3300037068 Bacteria 64772
122 Ga0395899_0000004 3300037312 Bacteria 874267
123 Ga0395899_0000712 3300037312 Bacteria 33319
124 Ga0395899_0016921 3300037312 Bacteria 5558
125 Ga0395900_0000016 3300037418 Bacteria 382407
126 Ga0395900_0021633 3300037418 Bacteria 6575
127 Ga0395900_0741679 3300037418 Bacteria 913
128 Ga0395898_0028399 3300037466 Bacteria 5605
129 Ga0395898_0038639 3300037466 Bacteria 4729
130 Ga0395905_0084178 3300037471 Bacteria 2980
131 Ga0436364_0414132 3300037853 Bacteria 3716
132 Ga0395901_0000022 3300038443 Bacteria 296356
133 Ga0395901_0211323 3300038443 Bacteria 2031
134 Ga0436365_0209892 3300039437 Bacteria 72774
135 Ga0436361_0382854 3300039447 Bacteria 1223
136 Ga0436361_1221565 3300039447 Bacteria 13730
137 Ga0436363_0719732 3300039450 Bacteria 5113
138 Ga0466966_0067008 3300044684 Bacteria 2256
139 Ga0466960_0103051 3300044901 Bacteria 1473
140 Ga0451576_0000040 3300045051 Bacteria 349778
141 Ga0495603_0016658 3300046455 Bacteria 4447
142 Ga0495650_0039780 3300046471 Bacteria 2026
143 Ga0495663_0079431 3300046525 Bacteria 1055
144 Ga0495642_0005358 3300046528 Bacteria 4921
145 Ga0495652_0200691 3300046529 Bacteria 1514
146 Ga0495622_0001552 3300046557 Bacteria 11410
147 Ga0495668_0113108 3300046616 Bacteria 1485
148 Ga0495668_0120857 3300046616 Bacteria 1433
149 Ga0495668_0148202 3300046616 Bacteria 1285
150 Ga0495611_0004650 3300046648 Bacteria 5901
151 Ga0495625_0106356 3300046660 Bacteria 1921
152 Ga0495588_0017794 3300046674 Bacteria 3457
153 Ga0495613_0000188 3300046689 Bacteria 60791
154 Ga0495589_0060804 3300046794 Bacteria 1855
155 Ga0495674_0769214 3300047319 Bacteria 751
156 Ga0495672_0007262 3300047320 Bacteria 8358
157 Ga0496100_0070278 3300048903 Bacteria 2334
158 Ga0496101_0299991 3300048904 Bacteria 1258
159 Ga0496105_0090195 3300048908 Bacteria 2532
160 Ga0496106_0024811 3300048909 Bacteria 4458
161 Ga0496107_0029798 3300048910 Bacteria 3886
162 Ga0496107_0076147 3300048910 Bacteria 2443
163 Ga0496107_0120441 3300048910 Bacteria 1933
164 Ga0496108_0027140 3300048911 Bacteria 4724
165 Ga0496108_0193038 3300048911 Bacteria 1765
166 Ga0496109_0035385 3300048912 Bacteria 4504
167 Ga0496109_0123080 3300048912 Bacteria 2417
168 Ga0496110_0090467 3300048913 Bacteria 2736
169 Ga0496112_0019002 3300048915 Bacteria 6477
170 Ga0496115_0000519 3300048918 Bacteria 29990
171 Ga0496115_0022232 3300048918 Bacteria 4911
172 Ga0496115_0160268 3300048918 Bacteria 1859
173 Ga0496121_0021993 3300048924 Bacteria 6213
174 Ga0496121_0376156 3300048924 Bacteria 938
175 Ga0496121_0430551 3300048924 Bacteria 856
176 Ga0496125_0002453 3300048928 Bacteria 24089
177 Ga0496126_0011729 3300048929 Bacteria 9028
178 Ga0501031_0075606 3300049568 Bacteria 2192
179 Ga0501031_0165191 3300049568 Bacteria 1447
180 Ga0501032_0026002 3300049569 Bacteria 4031
181 Ga0501032_0060497 3300049569 Bacteria 2540
182 Ga0501032_0298003 3300049569 Bacteria 1042
183 Ga0501032_0445736 3300049569 Bacteria 829
184 Ga0501033_0015614 3300049570 Bacteria 5759
185 Ga0501033_0015840 3300049570 Bacteria 5712
186 Ga0501033_0096026 3300049570 Bacteria 2166
187 Ga0501034_0030947 3300049571 Bacteria 5438
188 Ga0501034_0069049 3300049571 Bacteria 3544
189 Ga0501034_0072387 3300049571 Bacteria 3455
190 Ga0501034_0109326 3300049571 Bacteria 2755
191 Ga0501034_0175394 3300049571 Bacteria 2110
192 Ga0501034_0528360 3300049571 Bacteria 1091
193 Ga0501036_0013594 3300049572 Bacteria 6765
194 Ga0501037_0048806 3300049573 Bacteria 3100
195 Ga0501037_0185703 3300049573 Bacteria 1473
196 Ga0501038_0001212 3300049574 Bacteria 23356
197 Ga0501038_0039216 3300049574 Bacteria 4144
198 Ga0501038_0234911 3300049574 Bacteria 1457
199 Ga0501042_0027292 3300049578 Bacteria 4014
200 Ga0501042_0122814 3300049578 Bacteria 1870
201 Ga0501043_0020198 3300049579 Bacteria 5229
202 Ga0501046_0000023 3300049580 Bacteria 213965
203 Ga0501046_0030220 3300049580 Bacteria 4399
204 Ga0501047_0001969 3300049581 Bacteria 19723
205 Ga0501047_0024609 3300049581 Bacteria 5779
206 Ga0501048_0033778 3300049582 Bacteria 3694
207 Ga0501067_0022907 3300049583 Bacteria 3458
208 Ga0501069_0023712 3300049585 Bacteria 3345
209 Ga0501070_0069459 3300049586 Bacteria 2916
210 Ga0501072_0050309 3300049588 Bacteria 3281
211 Ga0501073_0109666 3300049589 Bacteria 1915
212 Ga0501073_0165964 3300049589 Bacteria 1529
213 Ga0501074_0015511 3300049590 Bacteria 5538
214 Ga0501077_0107594 3300049593 Bacteria 1767
215 Ga0501080_0716613 3300049742 Bacteria 882
216 Ga0501083_0279757 3300049744 Bacteria 1085
217 Ga0501035_0023936 3300049822 Bacteria 5604
218 Ga0501035_0239272 3300049822 Bacteria 1544
219 Ga0501044_0011267 3300049823 Bacteria 9690
220 Ga0501044_0022141 3300049823 Bacteria 6776
221 Ga0501044_0465233 3300049823 Bacteria 1169
222 nmdc:mga00v17_89938_c1 3300050491 Bacteria 1927
223 nmdc:mga07m45_22194_c1 3300050496 Bacteria 3464
224 nmdc:mga09592_5047_c1 3300050508 Bacteria 10709
225 nmdc:mga06r32_3249_c1 3300050510 Bacteria 14541
226 Ga0500635_0001509 3300053080 Bacteria 5595
227 Ga0500635_0020736 3300053080 Bacteria 2016
228 Ga0500643_007030 3300053087 Bacteria 4614
229 Ga0500643_013054 3300053087 Bacteria 2949
230 Ga0500647_0161626 3300053091 Bacteria 1039
231 Ga0500566_0000012 3300053094 Bacteria 117873
232 Ga0500640_000836 3300053095 Bacteria 8489
233 Ga0500554_003914 3300053102 Bacteria 3098
234 Ga0500562_000354 3300053108 Bacteria 11039
235 Ga0500562_041435 3300053108 Bacteria 1224
236 Ga0500572_000233 3300053111 Bacteria 19766
237 Ga0500572_000387 3300053111 Bacteria 15658
238 Ga0500595_032898 3300053119 Bacteria 1726
239 Ga0500614_001625 3300053123 Bacteria 5298
240 Ga0500559_0002848 3300053136 Bacteria 8736
241 Ga0500603_000170 3300053150 Bacteria 16461
242 Ga0500603_001448 3300053150 Bacteria 5418
243 Ga0500630_000455 3300053159 Bacteria 17894
244 Ga0500638_002918 3300053162 Bacteria 6161
245 Ga0500639_000095 3300053163 Bacteria 41536
246 Ga0500637_0000793 3300053178 Bacteria 12680
247 Ga0500637_0009623 3300053178 Bacteria 4927
248 Ga0500645_003400 3300053730 Bacteria 6492
249 Ga0501084_0077860 3300054114 Bacteria 2780

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047319 Ga0495674_0769214 Ga0495674_0769214_48_731 227
2 iso_pu_bacteria 2643221596 2643992503 231
3 3300045051 Ga0451576_0000040 Ga0451576_0000040_330796_331494 232
4 3300049570 Ga0501033_0015614 Ga0501033_0015614_1713_2462 232
5 3300049574 Ga0501038_0234911 Ga0501038_0234911_226_975 232
6 3300049580 Ga0501046_0000023 Ga0501046_0000023_106620_107318 232
7 iso_pu_bacteria 8006984368 8006993632 232
8 3300006353 Ga0075370_10039480 Ga0075370_100394801 233
9 3300046616 Ga0495668_0148202 Ga0495668_0148202_274_975 233
10 3300050496 nmdc:mga07m45_22194_c1 nmdc:mga07m45_22194_c1_250_951 233
11 iso_pu_bacteria 2922386360 2922390679 233
12 iso_pu_bacteria 8006933436 8006940917 233
13 iso_pu_bacteria 8006973647 8006980890 233
14 iso_pu_bacteria 8056681323 8056688127 233
15 3300031711 Ga0265314_10011848 Ga0265314_100118489 234
16 iso_pu_bacteria 2513237098 2513675588 234
17 iso_pu_bacteria 2824661429 2824665627 234
18 3300005435 Ga0070714_100061901 Ga0070714_1000619012 235
19 3300025929 Ga0207664_10013783 Ga0207664_100137833 235
20 3300037312 Ga0395899_0016921 Ga0395899_0016921_2493_3200 235
21 3300037418 Ga0395900_0021633 Ga0395900_0021633_2847_3554 235
22 3300037466 Ga0395898_0038639 Ga0395898_0038639_1174_1881 235
23 3300048924 Ga0496121_0376156 Ga0496121_0376156_149_856 235
24 iso_pu_bacteria 2513237096 2513654333 235
25 iso_pu_bacteria 2513237137 2513863730 235
26 iso_pu_bacteria 2513237145 2513915488 235
27 iso_pu_bacteria 2517572143 2517892818 235
28 iso_pu_bacteria 2667528175 2671117507 235
29 iso_pu_bacteria 2904690495 2904696127 235
30 iso_pu_bacteria 2906635258 2906642501 235
31 iso_pu_bacteria 2906660503 2906664269 235
32 iso_pu_bacteria 2908756301 2908760761 235
33 iso_pu_bacteria 3005474847 3005479787 235
34 3300005331 Ga0070670_100433242 Ga0070670_1004332422 236
35 3300005347 Ga0070668_100011304 Ga0070668_1000113042 236
36 3300005617 Ga0068859_100105885 Ga0068859_1001058855 236
37 3300006931 Ga0097620_100105886 Ga0097620_1001058862 236
38 3300013297 Ga0157378_10175261 Ga0157378_101752612 236
39 3300025925 Ga0207650_10441943 Ga0207650_104419432 236
40 3300025972 Ga0207668_10001882 Ga0207668_100018822 236
41 3300046674 Ga0495588_0017794 Ga0495588_0017794_1109_1819 236
42 3300033180 Ga0307510_10097172 Ga0307510_100971725 237
43 3300046455 Ga0495603_0016658 Ga0495603_0016658_2351_3067 237
44 3300048928 Ga0496125_0002453 Ga0496125_0002453_23324_24040 237
45 3300049569 Ga0501032_0026002 Ga0501032_0026002_2608_3321 237
46 3300049569 Ga0501032_0298003 Ga0501032_0298003_298_1014 237
47 3300049570 Ga0501033_0015840 Ga0501033_0015840_1336_2049 237
48 3300049570 Ga0501033_0096026 Ga0501033_0096026_469_1185 237
49 3300049571 Ga0501034_0030947 Ga0501034_0030947_2389_3105 237
50 3300049571 Ga0501034_0069049 Ga0501034_0069049_2004_2717 237
51 3300049572 Ga0501036_0013594 Ga0501036_0013594_1818_2531 237
52 3300049573 Ga0501037_0048806 Ga0501037_0048806_1241_1957 237
53 3300049573 Ga0501037_0185703 Ga0501037_0185703_372_1085 237
54 3300049574 Ga0501038_0001212 Ga0501038_0001212_20830_21546 237
55 3300049574 Ga0501038_0039216 Ga0501038_0039216_837_1550 237
56 3300049578 Ga0501042_0122814 Ga0501042_0122814_612_1325 237
57 3300049579 Ga0501043_0020198 Ga0501043_0020198_4177_4893 237
58 3300049580 Ga0501046_0030220 Ga0501046_0030220_529_1242 237
59 3300049581 Ga0501047_0024609 Ga0501047_0024609_2481_3194 237
60 3300049582 Ga0501048_0033778 Ga0501048_0033778_944_1657 237
61 3300049589 Ga0501073_0165964 Ga0501073_0165964_454_1167 237
62 3300049742 Ga0501080_0716613 Ga0501080_0716613_73_789 237
63 3300049822 Ga0501035_0023936 Ga0501035_0023936_2081_2794 237
64 3300049823 Ga0501044_0011267 Ga0501044_0011267_7182_7898 237
65 3300049823 Ga0501044_0022141 Ga0501044_0022141_1823_2536 237
66 3300053080 Ga0500635_0020736 Ga0500635_0020736_737_1453 237
67 3300053102 Ga0500554_003914 Ga0500554_003914_1381_2097 237
68 3300053150 Ga0500603_000170 Ga0500603_000170_8665_9381 237
69 3300053178 Ga0500637_0000793 Ga0500637_0000793_8410_9126 237
70 3300005618 Ga0068864_100007942 Ga0068864_1000079426 238
71 3300005983 Ga0081540_1123459 Ga0081540_11234592 238
72 3300021361 Ga0213872_10025115 Ga0213872_100251154 238
73 3300033442 Ga0315911_1000001 Ga0315911_1000001815 238
74 3300039447 Ga0436361_1221565 Ga0436361_1221565_8842_9558 238
75 3300050491 nmdc:mga00v17_89938_c1 nmdc:mga00v17_89938_c1_454_1176 238
76 iso_pu_bacteria 2524023210 2524464257 238
77 iso_pu_bacteria 2524023228 2524541062 238
78 iso_pu_bacteria 2842333319 2842337952 238
79 iso_pu_bacteria 2885383462 2885385535 238
80 iso_pu_bacteria 2904699407 2904702947 238
81 iso_pu_bacteria 2908739725 2908743211 238
82 iso_pu_bacteria 2935630451 2935633516 238
83 iso_pu_bacteria 2941507105 2941510407 238
84 iso_pu_bacteria 2941515067 2941517856 238
85 iso_pu_bacteria 2941523033 2941525872 238
86 iso_pu_bacteria 8056673599 8056674180 238
87 3300005618 Ga0068864_100000038 Ga0068864_10000003896 239
88 3300005841 Ga0068863_100000026 Ga0068863_10000002695 239
89 3300006844 Ga0075428_100453237 Ga0075428_1004532372 239
90 3300006847 Ga0075431_100006372 Ga0075431_1000063725 239
91 3300006880 Ga0075429_100106453 Ga0075429_1001064532 239
92 3300021361 Ga0213872_10132594 Ga0213872_101325942 239
93 3300031548 Ga0307408_100002162 Ga0307408_10000216211 239
94 3300031901 Ga0307406_10004635 Ga0307406_100046355 239
95 3300039447 Ga0436361_0382854 Ga0436361_0382854_189_908 239
96 3300046471 Ga0495650_0039780 Ga0495650_0039780_314_1033 239
97 3300048924 Ga0496121_0430551 Ga0496121_0430551_48_770 239
98 3300050508 nmdc:mga09592_5047_c1 nmdc:mga09592_5047_c1_9460_10179 239
99 3300050510 nmdc:mga06r32_3249_c1 nmdc:mga06r32_3249_c1_4748_5467 239
100 3300005435 Ga0070714_100063341 Ga0070714_1000633415 240
101 3300006847 Ga0075431_100259643 Ga0075431_1002596432 240
102 3300009545 Ga0105237_10044524 Ga0105237_100445244 240
103 3300009551 Ga0105238_10625965 Ga0105238_106259652 240
104 3300014325 Ga0163163_10023849 Ga0163163_100238497 240
105 3300014325 Ga0163163_10042048 Ga0163163_100420482 240
106 3300025914 Ga0207671_10639920 Ga0207671_106399201 240
107 3300025915 Ga0207693_10101228 Ga0207693_101012283 240
108 3300025924 Ga0207694_10574682 Ga0207694_105746821 240
109 3300025928 Ga0207700_10307201 Ga0207700_103072012 240
110 3300025929 Ga0207664_10175136 Ga0207664_101751362 240
111 3300028786 Ga0307517_10001634 Ga0307517_1000163412 240
112 3300031456 Ga0307513_10001259 Ga0307513_1000125930 240
113 3300033180 Ga0307510_10022030 Ga0307510_1002203010 240
114 3300035113 Ga0373936_0022298 Ga0373936_0022298_1303_2025 240
115 3300037312 Ga0395899_0000004 Ga0395899_0000004_641762_642502 240
116 3300038443 Ga0395901_0211323 Ga0395901_0211323_1267_1989 240
117 3300044684 Ga0466966_0067008 Ga0466966_0067008_1330_2070 240
118 3300049568 Ga0501031_0075606 Ga0501031_0075606_225_962 240
119 3300049571 Ga0501034_0072387 Ga0501034_0072387_2175_2912 240
120 3300049571 Ga0501034_0109326 Ga0501034_0109326_463_1200 240
121 3300049571 Ga0501034_0528360 Ga0501034_0528360_110_847 240
122 3300049578 Ga0501042_0027292 Ga0501042_0027292_1583_2320 240
123 3300049583 Ga0501067_0022907 Ga0501067_0022907_788_1525 240
124 3300049585 Ga0501069_0023712 Ga0501069_0023712_2551_3288 240
125 3300049586 Ga0501070_0069459 Ga0501070_0069459_675_1412 240
126 3300049588 Ga0501072_0050309 Ga0501072_0050309_2478_3215 240
127 3300049590 Ga0501074_0015511 Ga0501074_0015511_4616_5353 240
128 3300049593 Ga0501077_0107594 Ga0501077_0107594_316_1053 240
129 3300049744 Ga0501083_0279757 Ga0501083_0279757_120_857 240
130 3300049822 Ga0501035_0239272 Ga0501035_0239272_596_1333 240
131 3300053087 Ga0500643_013054 Ga0500643_013054_2131_2865 240
132 3300053730 Ga0500645_003400 Ga0500645_003400_2834_3568 240
133 3300054114 Ga0501084_0077860 Ga0501084_0077860_433_1170 240
134 3300005436 Ga0070713_100217037 Ga0070713_1002170372 241
135 3300005471 Ga0070698_100080639 Ga0070698_1000806391 241
136 3300021384 Ga0213876_10000543 Ga0213876_1000054321 241
137 3300025250 Ga0209026_1000649 Ga0209026_100064911 241
138 3300037853 Ga0436364_0414132 Ga0436364_0414132_956_1681 241
139 3300039437 Ga0436365_0209892 Ga0436365_0209892_62611_63336 241
140 3300044901 Ga0466960_0103051 Ga0466960_0103051_361_1086 241
141 3300049571 Ga0501034_0175394 Ga0501034_0175394_1136_1861 241
142 3300005468 Ga0070707_100259415 Ga0070707_1002594152 242
143 3300009092 Ga0105250_10020631 Ga0105250_100206314 242
144 3300026088 Ga0207641_10000005 Ga0207641_10000005306 242
145 3300026095 Ga0207676_10000085 Ga0207676_1000008537 242
146 3300028800 Ga0265338_10009472 Ga0265338_100094725 242
147 3300031235 Ga0265330_10067019 Ga0265330_100670192 242
148 3300035113 Ga0373936_0138615 Ga0373936_0138615_169_900 242
149 3300037312 Ga0395899_0000712 Ga0395899_0000712_32222_32962 242
150 3300037418 Ga0395900_0000016 Ga0395900_0000016_166061_166801 242
151 3300037466 Ga0395898_0028399 Ga0395898_0028399_3593_4333 242
152 3300038443 Ga0395901_0000022 Ga0395901_0000022_204143_204883 242
153 3300046557 Ga0495622_0001552 Ga0495622_0001552_5990_6739 242
154 3300046794 Ga0495589_0060804 Ga0495589_0060804_221_970 242
155 3300047320 Ga0495672_0007262 Ga0495672_0007262_4808_5557 242
156 3300053080 Ga0500635_0001509 Ga0500635_0001509_3578_4327 242
157 3300053087 Ga0500643_007030 Ga0500643_007030_1360_2088 242
158 3300053091 Ga0500647_0161626 Ga0500647_0161626_42_773 242
159 3300053094 Ga0500566_0000012 Ga0500566_0000012_81750_82481 242
160 3300053095 Ga0500640_000836 Ga0500640_000836_244_975 242
161 3300053111 Ga0500572_000233 Ga0500572_000233_10198_10929 242
162 3300053123 Ga0500614_001625 Ga0500614_001625_2350_3081 242
163 3300053136 Ga0500559_0002848 Ga0500559_0002848_2026_2757 242
164 3300053150 Ga0500603_001448 Ga0500603_001448_721_1452 242
165 3300053159 Ga0500630_000455 Ga0500630_000455_491_1222 242
166 3300053162 Ga0500638_002918 Ga0500638_002918_347_1078 242
167 3300053163 Ga0500639_000095 Ga0500639_000095_34080_34811 242
168 3300053178 Ga0500637_0009623 Ga0500637_0009623_70_819 242
169 3300005355 Ga0070671_100018824 Ga0070671_1000188242 243
170 3300005355 Ga0070671_100103876 Ga0070671_1001038762 243
171 3300005456 Ga0070678_100021276 Ga0070678_1000212761 243
172 3300005457 Ga0070662_100032215 Ga0070662_1000322151 243
173 3300005564 Ga0070664_100621335 Ga0070664_1006213351 243
174 3300005616 Ga0068852_100488872 Ga0068852_1004888721 243
175 3300005618 Ga0068864_100000979 Ga0068864_10000097910 243
176 3300005841 Ga0068863_100614049 Ga0068863_1006140491 243
177 3300005843 Ga0068860_100565509 Ga0068860_1005655091 243
178 3300009177 Ga0105248_10000115 Ga0105248_1000011522 243
179 3300009177 Ga0105248_10196397 Ga0105248_101963971 243
180 3300013100 Ga0157373_10024548 Ga0157373_100245486 243
181 3300013306 Ga0163162_10101540 Ga0163162_101015402 243
182 3300013308 Ga0157375_10307592 Ga0157375_103075922 243
183 3300025931 Ga0207644_10144674 Ga0207644_101446742 243
184 3300025931 Ga0207644_10177666 Ga0207644_101776662 243
185 3300025933 Ga0207706_10145198 Ga0207706_101451982 243
186 3300025941 Ga0207711_10000227 Ga0207711_1000022736 243
187 3300025941 Ga0207711_10451739 Ga0207711_104517392 243
188 3300025945 Ga0207679_10204649 Ga0207679_102046491 243
189 3300026078 Ga0207702_10000187 Ga0207702_1000018776 243
190 3300026088 Ga0207641_10073488 Ga0207641_100734882 243
191 3300026095 Ga0207676_10001421 Ga0207676_100014219 243
192 3300026095 Ga0207676_10178578 Ga0207676_101785782 243
193 3300026142 Ga0207698_10569355 Ga0207698_105693551 243
194 3300027378 Ga0209981_1000304 Ga0209981_10003042 243
195 3300028380 Ga0268265_10422307 Ga0268265_104223071 243
196 3300031456 Ga0307513_10002183 Ga0307513_1000218317 243
197 3300035171 Ga0373946_0025989 Ga0373946_0025989_293_1024 243
198 3300035695 Ga0373927_0000471 Ga0373927_0000471_12661_13392 243
199 3300037068 Ga0373925_0000202 Ga0373925_0000202_57824_58555 243
200 3300046525 Ga0495663_0079431 Ga0495663_0079431_303_1034 243
201 3300046528 Ga0495642_0005358 Ga0495642_0005358_798_1529 243
202 3300046616 Ga0495668_0113108 Ga0495668_0113108_612_1343 243
203 3300048910 Ga0496107_0076147 Ga0496107_0076147_1446_2177 243
204 3300048911 Ga0496108_0193038 Ga0496108_0193038_254_985 243
205 3300048912 Ga0496109_0123080 Ga0496109_0123080_645_1376 243
206 3300048915 Ga0496112_0019002 Ga0496112_0019002_111_842 243
207 3300048929 Ga0496126_0011729 Ga0496126_0011729_7626_8363 243
208 3300049568 Ga0501031_0165191 Ga0501031_0165191_244_990 243
209 3300049569 Ga0501032_0060497 Ga0501032_0060497_976_1707 243
210 3300049569 Ga0501032_0445736 Ga0501032_0445736_37_774 243
211 3300049581 Ga0501047_0001969 Ga0501047_0001969_16590_17342 243
212 3300053108 Ga0500562_041435 Ga0500562_041435_232_963 243
213 3300053119 Ga0500595_032898 Ga0500595_032898_153_884 243
214 3300009176 Ga0105242_10428298 Ga0105242_104282982 244
215 3300025941 Ga0207711_10325479 Ga0207711_103254792 244
216 3300025949 Ga0207667_10447684 Ga0207667_104476842 244
217 3300026041 Ga0207639_10016852 Ga0207639_100168522 244
218 3300028800 Ga0265338_10029690 Ga0265338_100296902 244
219 3300031712 Ga0265342_10123470 Ga0265342_101234702 244
220 3300037418 Ga0395900_0741679 Ga0395900_0741679_76_816 244
221 3300037471 Ga0395905_0084178 Ga0395905_0084178_533_1273 244
222 3300046529 Ga0495652_0200691 Ga0495652_0200691_594_1334 244
223 3300046689 Ga0495613_0000188 Ga0495613_0000188_27512_28252 244
224 3300049823 Ga0501044_0465233 Ga0501044_0465233_28_768 244
225 3300053111 Ga0500572_000387 Ga0500572_000387_9858_10598 244
226 3300005435 Ga0070714_100931582 Ga0070714_1009315821 245
227 3300048903 Ga0496100_0070278 Ga0496100_0070278_1435_2202 245
228 3300048904 Ga0496101_0299991 Ga0496101_0299991_354_1121 245
229 3300048908 Ga0496105_0090195 Ga0496105_0090195_1403_2170 245
230 3300048909 Ga0496106_0024811 Ga0496106_0024811_1429_2196 245
231 3300048910 Ga0496107_0029798 Ga0496107_0029798_1322_2089 245
232 3300048910 Ga0496107_0120441 Ga0496107_0120441_341_1105 245
233 3300048911 Ga0496108_0027140 Ga0496108_0027140_1632_2399 245
234 3300048912 Ga0496109_0035385 Ga0496109_0035385_2319_3086 245
235 3300048913 Ga0496110_0090467 Ga0496110_0090467_1356_2123 245
236 3300048918 Ga0496115_0160268 Ga0496115_0160268_835_1602 245
237 3300048924 Ga0496121_0021993 Ga0496121_0021993_1685_2449 245
238 3300048918 Ga0496115_0000519 Ga0496115_0000519_18418_19170 246
239 3300046616 Ga0495668_0120857 Ga0495668_0120857_82_825 247
240 3300046648 Ga0495611_0004650 Ga0495611_0004650_1501_2244 247
241 3300005341 Ga0070691_10005214 Ga0070691_100052143 248
242 3300005366 Ga0070659_100000145 Ga0070659_10000014524 248
243 3300005458 Ga0070681_10010088 Ga0070681_100100882 248
244 3300005530 Ga0070679_100034606 Ga0070679_1000346066 248
245 3300005539 Ga0068853_100143713 Ga0068853_1001437132 248
246 3300005539 Ga0068853_100502267 Ga0068853_1005022671 248
247 3300009093 Ga0105240_10065617 Ga0105240_100656172 248
248 3300009093 Ga0105240_10265989 Ga0105240_102659892 248
249 3300025912 Ga0207707_10138841 Ga0207707_101388412 248
250 3300025913 Ga0207695_10002873 Ga0207695_1000287315 248
251 3300025919 Ga0207657_10162268 Ga0207657_101622681 248
252 3300025921 Ga0207652_10039777 Ga0207652_100397776 248
253 3300025924 Ga0207694_10109095 Ga0207694_101090952 248
254 3300025932 Ga0207690_10000090 Ga0207690_1000009020 248
255 3300025949 Ga0207667_10049333 Ga0207667_100493336 248
256 3300026041 Ga0207639_10032354 Ga0207639_100323545 248
257 3300026041 Ga0207639_10056026 Ga0207639_100560261 248
258 3300035113 Ga0373936_0004694 Ga0373936_0004694_2974_3732 248
259 3300005614 Ga0068856_100054658 Ga0068856_1000546582 252
260 3300039450 Ga0436363_0719732 Ga0436363_0719732_30_788 252
261 3300046660 Ga0495625_0106356 Ga0495625_0106356_663_1502 254
262 3300049589 Ga0501073_0109666 Ga0501073_0109666_360_1178 254
263 3300009093 Ga0105240_10006985 Ga0105240_1000698517 255
264 3300025913 Ga0207695_10005482 Ga0207695_1000548217 255
265 3300005548 Ga0070665_100010424 Ga0070665_1000104244 257
266 3300028379 Ga0268266_10598063 Ga0268266_105980631 257
267 3300053108 Ga0500562_000354 Ga0500562_000354_691_1512 258
268 3300005614 Ga0068856_100080083 Ga0068856_1000800832 261
269 3300026078 Ga0207702_10597032 Ga0207702_105970322 261
270 3300005327 Ga0070658_10075166 Ga0070658_100751663 266
271 3300005339 Ga0070660_100005361 Ga0070660_10000536110 266
272 3300005548 Ga0070665_100000194 Ga0070665_10000019424 266
273 3300009093 Ga0105240_10181424 Ga0105240_101814242 266
274 3300009551 Ga0105238_10015127 Ga0105238_100151276 266
275 3300025913 Ga0207695_10289978 Ga0207695_102899782 266
276 3300025919 Ga0207657_10015349 Ga0207657_100153499 266
277 3300028379 Ga0268266_10000005 Ga0268266_10000005538 266
278 3300048918 Ga0496115_0022232 Ga0496115_0022232_1919_2719 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06508

QueC

Queuosine biosynthesis protein QueC

8

223

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bl5-assembly6.cif.gz_F crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.9042 31 259
3bl5-assembly1.cif.gz_A crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.8999 31 259
3bl5-assembly6.cif.gz_F crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.8912 31 259
3bl5-assembly1.cif.gz_A crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.8868 31 259
2pg3-assembly1.cif.gz_A-2 crystal structure of a queuosine biosynthesis protein quec (eca1155) from erwinia carotovora subsp. atroseptica scri1043 at 2.40 a resolution 0.8777 31 260
ID Description Score Start End Superfamily
af_Q2G1X6_7_221_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8993 30 260 3.40.50.620
af_Q2G1X6_7_221_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8873 30 260 3.40.50.620
af_Q58742_1_231_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7144 32 263 3.40.50.620
af_Q58742_1_231_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7029 32 263 3.40.50.620
4kr9B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6975 31 214 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A090MKU4-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9945 186 258 GO:0008616
AF-A0A3D1IUU2-F1-model_v4 7-cyano-7-deazaguanine synthase 0.9943 193 258 GO:0008616
AF-J3HMG5-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9884 143 260 GO:0008616
AF-A0A537QG75-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9856 129 260 GO:0008616
AF-A0A7C3GC97-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9849 140 258 GO:0008616

Feature Viewer

pLDDT pTM Quality
82.95 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map